Psyllid ID: psy16199

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840--
MSTAKVCLSKDPPDIEMSTAKVCLSKDLPDIERPVAALPDSSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPEQGSFLNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPKRQINTPVETILSVKDVIGQAVQRVTNYTELDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYITGLQTLLYLKSTQLKGWDGQSPPTPVHQKGKPAYQFRDKEGKAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPRQLK
cccccEEEcccccHHHHcccccEEEEEccccccccccccEEcccccccccHHHHHHHHHHHHHcccEEEEccEEccccccHHHHHHccccEEEEcccccccccccccccccccccEEEHHHHHHHHHHccccccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHcccEEEcccccEEEEEcccEEEEEEEEEcccccccccEEccccEEEEEccEEEEcccccccccHHHcccccccccccccEEEcccccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccEEEEEEcccccccccccccEEEccccccccccccccccEEEEcccHHHHHHHHHHccccccccccccEEccEEccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccEEEEEEcccccccccccccccccccccEEEcccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccc
cccHHHHccccHHHHHHHHHHHHcccEEEEEEccccccHHHHccccccccHHHHHHHHHHHHccccEEEEcccEccccEcHHHHHHccccEEEEcccccEEcccHHHccccccccEEEHHHHHHHHHHHHccccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccHHHccccHHHHHHHHHcccEEEccEEEEEEEEEccEEEEEEEEEEEEcccccEEEEEEEEEEEEccEEEEcccEEcccHHHHHccccccEcccccEcccccccEcccccEEEccHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccEcccccHHHHccccEEEccEEEcccEEEcccHHHccHHHHHHHHHHcccEEEcccEccHHHccccccccEEEccccccccccccccEEEccccccccHHHHHHHHHHcHccccccEEHHHEEHcccHHHHHHcccccccccccccccccccccccHHHHccccHHHEccHHHccccccEEEEEcccccccccHHHHHHHHHccccEEEccccccEEEccccccccHHHcEEEEEEcccccHHHHHHHHHHHHHccccEEEEEcccEccccccccccEHHHcHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccEEEEcccEEEcccEcccccEcccEccccEEccEEEEcHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHccccEEEEcHHHHcccccHHHHHHHHHHHHHHHcccHHcccEccEcccccEEccEEcccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHcc
mstakvclskdppdiemstakvclskdlpdierpvaalpdsseipqyrlpfdaVNFEVELVKDLGvkiecerslstrdITIEKLRKDGYTAIFIGigkpnanvipIFQGlteemgfytsktflprvatsskkglcggckkeslpilkGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKgctniravPEEVQLAWEEkceflpfmspvqvdvkdnkiagmqfnrteqnekgewveDEEQRIKLKANYIISAFGstlldndvleaikpvkldkygypevnyttmatsvpgvfcggdtanlsdttvesVNDGKTAAWHIHKYIQeknnltvpdkpclpkfmshidlvDISVEicglkfpnpfglasappttaSSMVRRAFENGWGFAVTKTFSLQKdmvtnvsprivkgttsrhlygpeqgsflNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLkklnsdgvslqnglpkrqintpveTILSVKDVIGQAVQRVtnyteldnkKQVVALINDDmcincgkcymacndsgyqaitfhpethqahvtdectgcTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELnlscphgmgergmglacgqdpemvRNISLWVRssvkipffvkltpnitNITDIAKAAyegkadgvSAINTVSGLMslsadgnpwpavgtkklttyggvsgnatrpmgLKAVSSIAkmfpnfpilgiggidSADVALQFIQAGAHAVQICSavqnqdftvVDDYITGLQTLLYLKStqlkgwdgqspptpvhqkgkpayqfrdkegkaipnfgEYKKIRENLITELNLkklnsdgvslqnglprqlk
mstakvclskdppdiemsTAKVCLSKDLPDIERPVAalpdsseipqyRLPFDAVNFEVELVKDlgvkiecerslstrditieklrKDGYTAIFigigkpnaNVIPIFQGLTEEMGFYTSKTFLPRVATSskkglcggckkeslpiLKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFnrteqnekgewvEDEEQRIKLKANYIISAFgstlldndvLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTfslqkdmvtnvSPRIvkgttsrhlygpeQGSFLNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSlqnglpkrqintpvETILSVKDVIGQAVQRvtnyteldnkkqVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKipffvkltpniTNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTyggvsgnatRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYITGLQTLLYLKSTQLKGWDgqspptpvhqkgkpayqfrdkegkaipnfgeYKKIRENLITElnlkklnsdgvslqnglprqlk
MSTAKVCLSKDPPDIEMSTAKVCLSKDLPDIERPVAALPDSSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATsskkglcggckkeslPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPEQGSFLNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPKRQINTPVETILSVKDVIGQAVQRVTNYTELDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYITGLQTLLYLKSTQLKGWDGQSPPTPVHQKGKPAYQFRDKEGKAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPRQLK
*******************************************IPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQF**********WVE*EEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFPNPFGLASA****ASSMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPEQGSFLNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPKRQINTPVETILSVKDVIGQAVQRVTNYTELDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYITGLQTLLYLKSTQLKGW*****************************************************************
***AKVC*SKDPPDIEMSTAKVCLSKDLPDIERPVAALPDSSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTE*******VEDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFPNPFG**********SMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPEQGSFLNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPKRQINTPVETILSVKDVIGQAVQRVTNYTELDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYITGLQTLLYLKSTQLKGWDGQSPPTPVHQKGKPAYQFRDKEGKAIPNFGEYKKIRENLITELNLKKLNSDGVSLQ*G******
MSTAKVCLSKDPPDIEMSTAKVCLSKDLPDIERPVAALPDSSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQ*********EEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPEQGSFLNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPKRQINTPVETILSVKDVIGQAVQRVTNYTELDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYITGLQTLLYLKSTQLKGWDGQSPPTPVHQKGKPAYQFRDKEGKAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPRQLK
*STAKVCLSKDPPDIEMSTAKVCLSKDLPDIERPVAALPDSSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPEQGSFLNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPKRQINTPVETILSVKDVIGQAVQRVTNYTELDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYITGLQTLLYLKSTQLKGWDGQSPPTPVHQKGKPAYQFRDKEGKAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNG******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTAKVCLSKDPPDIEMSTAKVCLSKDLPDIERPVAALPDSSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPEQGSFLNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPKRQINTPVETILSVKDVIGQAVQRVTNYTELDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYITGLQTLLYLKSTQLKGWDGQSPPTPVHQKGKPAYQFRDKEGKAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPRQLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query842 2.2.26 [Sep-21-2011]
Q8CHR61025 Dihydropyrimidine dehydro yes N/A 0.464 0.381 0.659 1e-150
O890001025 Dihydropyrimidine dehydro yes N/A 0.464 0.381 0.656 1e-149
Q289431025 Dihydropyrimidine dehydro yes N/A 0.464 0.381 0.656 1e-146
Q5R8951025 Dihydropyrimidine dehydro yes N/A 0.464 0.381 0.653 1e-146
Q128821025 Dihydropyrimidine dehydro yes N/A 0.464 0.381 0.648 1e-145
Q280071025 Dihydropyrimidine dehydro yes N/A 0.464 0.381 0.651 1e-144
Q6NYG81022 Dihydropyrimidine dehydro yes N/A 0.464 0.382 0.638 1e-143
A8XKG61053 Probable dihydropyrimidin N/A N/A 0.464 0.371 0.604 1e-138
Q181641059 Dihydropyrimidine dehydro yes N/A 0.464 0.369 0.602 1e-136
Q55FT11009 Dihydropyrimidine dehydro yes N/A 0.464 0.387 0.562 1e-124
>sp|Q8CHR6|DPYD_MOUSE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Mus musculus GN=Dpyd PE=2 SV=1 Back     alignment and function desciption
 Score =  531 bits (1369), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 259/393 (65%), Positives = 312/393 (79%), Gaps = 2/393 (0%)

Query: 41  SSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPN 100
           +SEIPQ+RLP+D VNFE+EL+KDLGVKI C +SLST ++T+  L+++GY A FIGIG P 
Sbjct: 228 TSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSTDEMTLSSLKENGYRAAFIGIGLPE 287

Query: 101 ANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAF 160
                IFQGLT+  GFYTSK FLP VA SSK G+C  C    LP ++G VIVLGAGDTAF
Sbjct: 288 PKKDHIFQGLTQVQGFYTSKDFLPLVAKSSKTGMCA-CH-SPLPSIRGAVIVLGAGDTAF 345

Query: 161 DCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAG 220
           DCATSALRCGA +V +VFRKG  NIRAVPEE++LA EEKCEFLPF+SP +V VKD KI  
Sbjct: 346 DCATSALRCGALRVFIVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKDGKIVA 405

Query: 221 MQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVN 280
           MQF RTEQ+E G WVEDEEQ ++LKA+ +ISAFGS L D  V EA+ P+K +++G PEVN
Sbjct: 406 MQFVRTEQDETGNWVEDEEQTVRLKADVVISAFGSVLEDPKVKEALSPIKFNRWGLPEVN 465

Query: 281 YTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFM 340
             TM TS P VF GGD   +++TTVESVNDGK A+W+IHK+IQ +   +VP +P +P F 
Sbjct: 466 PETMQTSEPWVFAGGDVVGMANTTVESVNDGKQASWYIHKHIQAQYGTSVPSQPTMPLFY 525

Query: 341 SHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTN 400
           + +DLVDISVE+ GL+FPNPFGLASA P T++ M+RRAFE GWGFA+TKTFSL KD+VTN
Sbjct: 526 TPVDLVDISVEMAGLRFPNPFGLASATPATSTPMIRRAFEAGWGFALTKTFSLDKDIVTN 585

Query: 401 VSPRIVKGTTSRHLYGPEQGSFLNIELISEKTA 433
           VSPRI++GTTS  LYGP Q SFLNIELISEKTA
Sbjct: 586 VSPRIIRGTTSGPLYGPGQSSFLNIELISEKTA 618
Involved in pyrimidine base degradation. Catalyzes the reduction of uracil and thymine.
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 2
>sp|O89000|DPYD_RAT Dihydropyrimidine dehydrogenase [NADP(+)] OS=Rattus norvegicus GN=Dpyd PE=2 SV=1 Back     alignment and function description
>sp|Q28943|DPYD_PIG Dihydropyrimidine dehydrogenase [NADP(+)] OS=Sus scrofa GN=DPYD PE=1 SV=1 Back     alignment and function description
>sp|Q5R895|DPYD_PONAB Dihydropyrimidine dehydrogenase [NADP(+)] OS=Pongo abelii GN=DPYD PE=2 SV=1 Back     alignment and function description
>sp|Q12882|DPYD_HUMAN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Homo sapiens GN=DPYD PE=1 SV=2 Back     alignment and function description
>sp|Q28007|DPYD_BOVIN Dihydropyrimidine dehydrogenase [NADP(+)] OS=Bos taurus GN=DPYD PE=1 SV=1 Back     alignment and function description
>sp|Q6NYG8|DPYD_DANRE Dihydropyrimidine dehydrogenase [NADP(+)] OS=Danio rerio GN=dpyd PE=2 SV=1 Back     alignment and function description
>sp|A8XKG6|DPYD_CAEBR Probable dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis briggsae GN=dpyd-1 PE=3 SV=2 Back     alignment and function description
>sp|Q18164|DPYD_CAEEL Dihydropyrimidine dehydrogenase [NADP(+)] OS=Caenorhabditis elegans GN=dpyd-1 PE=3 SV=2 Back     alignment and function description
>sp|Q55FT1|DPYD_DICDI Dihydropyrimidine dehydrogenase [NADP(+)] OS=Dictyostelium discoideum GN=pyd1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query842
380027208 1024 PREDICTED: dihydropyrimidine dehydrogena 0.464 0.381 0.701 1e-160
110760297 1024 PREDICTED: dihydropyrimidine dehydrogena 0.464 0.381 0.693 1e-160
405954438903 Dihydropyrimidine dehydrogenase [NADP+] 0.464 0.433 0.692 1e-159
383863176 1027 PREDICTED: dihydropyrimidine dehydrogena 0.464 0.380 0.688 1e-159
332028865 1019 Dihydropyrimidine dehydrogenase [Acromyr 0.476 0.393 0.686 1e-158
307201146 962 Dihydropyrimidine dehydrogenase [NADP+] 0.476 0.416 0.689 1e-157
340720144 1024 PREDICTED: dihydropyrimidine dehydrogena 0.464 0.381 0.688 1e-155
156543632 1025 PREDICTED: dihydropyrimidine dehydrogena 0.465 0.382 0.671 1e-155
350408298 1024 PREDICTED: dihydropyrimidine dehydrogena 0.464 0.381 0.683 1e-155
340720146 1022 PREDICTED: dihydropyrimidine dehydrogena 0.459 0.378 0.686 1e-154
>gi|380027208|ref|XP_003697321.1| PREDICTED: dihydropyrimidine dehydrogenase [NADP+]-like [Apis florea] Back     alignment and taxonomy information
 Score =  573 bits (1476), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 275/392 (70%), Positives = 323/392 (82%), Gaps = 1/392 (0%)

Query: 41  SSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPN 100
           SSEIPQYRLP+D VNFE++LVKDLGVKIE  ++LS  ++TIE L+  GY AIF+GIG P 
Sbjct: 225 SSEIPQYRLPYDIVNFEIDLVKDLGVKIELGKALSKDNLTIEGLQNSGYKAIFLGIGLPE 284

Query: 101 ANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAF 160
           A  IPIF  LTEEMGF+TSK+FLP+VA  SK G+C  CK+  LP L G V+VLGAGDTAF
Sbjct: 285 AKAIPIFSNLTEEMGFFTSKSFLPKVAKGSKPGMCA-CKRNELPSLHGKVVVLGAGDTAF 343

Query: 161 DCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAG 220
           DCATSALRC A KV VVFRKG TNIRAVPEE  LA EEKCEF+PF SP QV V++ KI  
Sbjct: 344 DCATSALRCEAKKVYVVFRKGFTNIRAVPEEFDLAREEKCEFIPFQSPKQVIVRNGKIIA 403

Query: 221 MQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVN 280
           ++F RTE+NE GEW+ED+EQ  +LK +++ISAFGS L D DV++A+ P+K++K+  PEV+
Sbjct: 404 IEFYRTEENENGEWIEDKEQICRLKTDFVISAFGSGLQDQDVIQAMVPIKMNKWNLPEVD 463

Query: 281 YTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFM 340
             TM+TSVPGVFCGGD A ++ TTVESVNDGKTAAW+IHK+IQ   NL VP  P LPKF 
Sbjct: 464 SQTMSTSVPGVFCGGDLAGIAHTTVESVNDGKTAAWYIHKFIQNSYNLEVPKIPQLPKFH 523

Query: 341 SHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTN 400
           + ID VD+SVEICGLKF NPFGLASAPPTT+S+M+RRAFE GWGF VTKTFSL KD+VTN
Sbjct: 524 TPIDDVDLSVEICGLKFENPFGLASAPPTTSSTMIRRAFEAGWGFVVTKTFSLDKDLVTN 583

Query: 401 VSPRIVKGTTSRHLYGPEQGSFLNIELISEKT 432
           VSPRI+KGTTSRH YGPEQGSFLNIELISEK+
Sbjct: 584 VSPRIIKGTTSRHHYGPEQGSFLNIELISEKS 615

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|110760297|ref|XP_393690.3| PREDICTED: dihydropyrimidine dehydrogenase [NADP+]-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|405954438|gb|EKC21880.1| Dihydropyrimidine dehydrogenase [NADP+] [Crassostrea gigas] Back     alignment and taxonomy information
>gi|383863176|ref|XP_003707058.1| PREDICTED: dihydropyrimidine dehydrogenase [NADP(+)]-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332028865|gb|EGI68891.1| Dihydropyrimidine dehydrogenase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307201146|gb|EFN81057.1| Dihydropyrimidine dehydrogenase [NADP+] [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340720144|ref|XP_003398503.1| PREDICTED: dihydropyrimidine dehydrogenase [NADP+]-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|156543632|ref|XP_001604620.1| PREDICTED: dihydropyrimidine dehydrogenase [NADP+]-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350408298|ref|XP_003488363.1| PREDICTED: dihydropyrimidine dehydrogenase [NADP+]-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340720146|ref|XP_003398504.1| PREDICTED: dihydropyrimidine dehydrogenase [NADP+]-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query842
RGD|6212181025 Dpyd "dihydropyrimidine dehydr 0.508 0.417 0.602 1.1e-229
UNIPROTKB|O890001025 Dpyd "Dihydropyrimidine dehydr 0.508 0.417 0.602 1.1e-229
UNIPROTKB|Q289431025 DPYD "Dihydropyrimidine dehydr 0.508 0.417 0.6 5.9e-229
MGI|MGI:21396671025 Dpyd "dihydropyrimidine dehydr 0.464 0.381 0.641 1.6e-228
UNIPROTKB|F1S550949 DPYD "Dihydropyrimidine dehydr 0.508 0.451 0.6 1e-226
UNIPROTKB|F1N5491025 DPYD "Dihydropyrimidine dehydr 0.508 0.417 0.6 2.6e-226
ZFIN|ZDB-GENE-040426-24591022 dpydb "dihydropyrimidine dehyd 0.464 0.382 0.623 7.8e-225
UNIPROTKB|Q280071025 DPYD "Dihydropyrimidine dehydr 0.508 0.417 0.590 6.9e-224
UNIPROTKB|Q128821025 DPYD "Dihydropyrimidine dehydr 0.508 0.417 0.595 1.2e-223
UNIPROTKB|Q5R8951025 DPYD "Dihydropyrimidine dehydr 0.508 0.417 0.6 3.1e-223
RGD|621218 Dpyd "dihydropyrimidine dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 1297 (461.6 bits), Expect = 1.1e-229, Sum P(3) = 1.1e-229
 Identities = 262/435 (60%), Positives = 320/435 (73%)

Query:     3 TAKVCL-SKDPPDIEMSTAKVCLS-KDLPDIERP--VAALPDSSEIPQYRLPFDAVNFEV 58
             +AK+ L    P  I  ++    L   D+   E+   V  L  +SEIPQ+RLP+D VNFE+
Sbjct:   187 SAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGL-STSEIPQFRLPYDVVNFEI 245

Query:    59 ELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPNANVIPIFQGLTEEMGFYT 118
             EL+KDLGVKI C +S+ST ++T+  L+++GY A FIGIG P      IFQGLT+  GFYT
Sbjct:   246 ELMKDLGVKIICGKSISTDEMTLSTLKENGYKAAFIGIGLPEPKKDHIFQGLTQVQGFYT 305

Query:   119 SKTFLPRVATXXXXXXXXXXXXXXXPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVF 178
             SK FLP VA                P ++G VIVLGAGDTAFDCATSALRCGA +V +VF
Sbjct:   306 SKDFLPLVAKGSKPGMCACHSPL--PSVRGAVIVLGAGDTAFDCATSALRCGARRVFIVF 363

Query:   179 RKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDE 238
             RKG  NIRAVPEE++LA EEKCEFLPF+SP +V VKD KI GMQF RTEQ+E G WVEDE
Sbjct:   364 RKGFANIRAVPEEMELAKEEKCEFLPFLSPRKVIVKDGKIVGMQFVRTEQDETGNWVEDE 423

Query:   239 EQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTA 298
             EQ ++LKA+ +IS FGS L D  V+EA+ P+K +++G PEVN  TM TS P VF GGD  
Sbjct:   424 EQIVRLKADVVISPFGSVLDDPKVIEALSPIKFNRWGLPEVNPETMQTSEPWVFAGGDVV 483

Query:   299 NLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFP 358
              +++TTVESVNDGK A+W+IH+YIQ +    VP +P LP F + +DLVDISVE+ GL+FP
Sbjct:   484 GMANTTVESVNDGKQASWYIHEYIQAQYGALVPSQPTLPLFYTPVDLVDISVEMAGLRFP 543

Query:   359 NPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPE 418
             NPFGLASA P T++ M+RRAFE GWGFA+TKTFSL KD+VTNVSPRI++GTTS  LYGP 
Sbjct:   544 NPFGLASATPATSTPMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPLYGPG 603

Query:   419 QGSFLNIELISEKTA 433
             Q SFLNIELISEKTA
Sbjct:   604 QSSFLNIELISEKTA 618
GO:0002058 "uracil binding" evidence=IDA
GO:0004158 "dihydroorotate oxidase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA;ISO;ISS
GO:0005829 "cytosol" evidence=ISO;IDA
GO:0006145 "purine nucleobase catabolic process" evidence=ISO
GO:0006208 "pyrimidine nucleobase catabolic process" evidence=ISO;IDA;TAS
GO:0006210 "thymine catabolic process" evidence=ISO
GO:0006212 "uracil catabolic process" evidence=ISO;ISS
GO:0006214 "thymidine catabolic process" evidence=ISO;ISS
GO:0006222 "UMP biosynthetic process" evidence=IEA
GO:0007584 "response to nutrient" evidence=IDA
GO:0007623 "circadian rhythm" evidence=IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0017113 "dihydropyrimidine dehydrogenase (NADP+) activity" evidence=ISO;ISS;IDA
GO:0019483 "beta-alanine biosynthetic process" evidence=IEA
GO:0019860 "uracil metabolic process" evidence=IDA
GO:0042493 "response to drug" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=ISO;IDA
GO:0046872 "metal ion binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IDA
GO:0051384 "response to glucocorticoid stimulus" evidence=IEP
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=ISO
UNIPROTKB|O89000 Dpyd "Dihydropyrimidine dehydrogenase [NADP(+)]" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q28943 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2139667 Dpyd "dihydropyrimidine dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S550 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N549 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2459 dpydb "dihydropyrimidine dehydrogenase b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q28007 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q12882 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R895 DPYD "Dihydropyrimidine dehydrogenase [NADP(+)]" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R895DPYD_PONAB1, ., 3, ., 1, ., 20.65390.46430.3814yesN/A
Q55FT1DPYD_DICDI1, ., 3, ., 1, ., 20.56280.46430.3875yesN/A
Q28007DPYD_BOVIN1, ., 3, ., 1, ., 20.65130.46430.3814yesN/A
Q28943DPYD_PIG1, ., 3, ., 1, ., 20.65640.46430.3814yesN/A
Q12882DPYD_HUMAN1, ., 3, ., 1, ., 20.64880.46430.3814yesN/A
Q8CHR6DPYD_MOUSE1, ., 3, ., 1, ., 20.65900.46430.3814yesN/A
Q6NYG8DPYD_DANRE1, ., 3, ., 1, ., 20.63860.46430.3825yesN/A
O89000DPYD_RAT1, ., 3, ., 1, ., 20.65640.46430.3814yesN/A
Q18164DPYD_CAEEL1, ., 3, ., 1, ., 20.60200.46430.3692yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.10.766
3rd Layer1.3.1.20.824
3rd Layer2.5.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query842
cd02940299 cd02940, DHPD_FMN, Dihydropyrimidine dehydrogenase 1e-108
PRK08318420 PRK08318, PRK08318, dihydropyrimidine dehydrogenas 1e-66
cd02810289 cd02810, DHOD_DHPD_FMN, Dihydroorotate dehydrogena 9e-56
PRK07259301 PRK07259, PRK07259, dihydroorotate dehydrogenase 1 3e-51
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 1e-50
PLN02495385 PLN02495, PLN02495, oxidoreductase, acting on the 3e-50
cd04740296 cd04740, DHOD_1B_like, Dihydroorotate dehydrogenas 5e-49
COG0167310 COG0167, PyrD, Dihydroorotate dehydrogenase [Nucle 4e-48
TIGR01037300 TIGR01037, pyrD_sub1_fam, dihydroorotate dehydroge 1e-41
cd02940299 cd02940, DHPD_FMN, Dihydropyrimidine dehydrogenase 1e-40
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 2e-36
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 8e-34
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 5e-33
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 1e-32
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 6e-32
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, Y 1e-31
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 1e-29
pfam01180290 pfam01180, DHO_dh, Dihydroorotate dehydrogenase 3e-28
PRK127751006 PRK12775, PRK12775, putative trifunctional 2-polyp 8e-27
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 9e-27
PRK12814652 PRK12814, PRK12814, putative NADPH-dependent gluta 2e-25
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase smal 9e-23
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provi 2e-20
cd04738327 cd04738, DHOD_2_like, Dihydroorotate dehydrogenase 2e-19
PRK12779944 PRK12779, PRK12779, putative bifunctional glutamat 4e-19
PRK08318420 PRK08318, PRK08318, dihydropyrimidine dehydrogenas 1e-18
PRK12769654 PRK12769, PRK12769, putative oxidoreductase Fe-S b 2e-17
PRK08318420 PRK08318, PRK08318, dihydropyrimidine dehydrogenas 4e-17
PLN02495385 PLN02495, PLN02495, oxidoreductase, acting on the 1e-16
PRK05286344 PRK05286, PRK05286, dihydroorotate dehydrogenase 2 1e-15
PRK12809639 PRK12809, PRK12809, putative oxidoreductase Fe-S b 1e-15
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 7e-15
cd04739325 cd04739, DHOD_like, Dihydroorotate dehydrogenase ( 2e-14
cd04741294 cd04741, DHOD_1A_like, Dihydroorotate dehydrogenas 2e-14
TIGR01036336 TIGR01036, pyrD_sub2, dihydroorotate dehydrogenase 7e-14
PRK07565334 PRK07565, PRK07565, dihydroorotate dehydrogenase 2 1e-13
cd02810289 cd02810, DHOD_DHPD_FMN, Dihydroorotate dehydrogena 7e-13
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel protein 2e-10
COG0167310 COG0167, PyrD, Dihydroorotate dehydrogenase [Nucle 3e-09
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 5e-09
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 3e-08
COG2878198 COG2878, COG2878, Predicted NADH:ubiquinone oxidor 4e-08
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 1e-07
pfam1323751 pfam13237, Fer4_10, 4Fe-4S dicluster domain 2e-07
TIGR01317485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 3e-07
PRK05113191 PRK05113, PRK05113, electron transport complex pro 2e-06
TIGR01944165 TIGR01944, rnfB, electron transport complex, RnfAB 4e-06
PRK02506310 PRK02506, PRK02506, dihydroorotate dehydrogenase 1 8e-06
COG114668 COG1146, COG1146, Ferredoxin [Energy production an 2e-05
pfam1283848 pfam12838, Fer4_7, 4Fe-4S dicluster domain 3e-05
PLN02826409 PLN02826, PLN02826, dihydroorotate dehydrogenase 3e-05
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 1e-04
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 2e-04
cd00564196 cd00564, TMP_TenI, Thiamine monophosphate synthase 2e-04
COG0042323 COG0042, COG0042, tRNA-dihydrouridine synthase [Tr 4e-04
COG0437203 COG0437, HybA, Fe-S-cluster-containing hydrogenase 5e-04
PRK00043212 PRK00043, thiE, thiamine-phosphate pyrophosphoryla 5e-04
PRK06991270 PRK06991, PRK06991, ferredoxin; Provisional 0.001
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 0.001
COG1149284 COG1149, COG1149, MinD superfamily P-loop ATPase c 0.002
TIGR00737319 TIGR00737, nifR3_yhdG, putative TIM-barrel protein 0.003
TIGR00693196 TIGR00693, thiE, thiamine-phosphate pyrophosphoryl 0.003
cd02803327 cd02803, OYE_like_FMN_family, Old yellow enzyme (O 0.003
pfam1283724 pfam12837, Fer4_6, 4Fe-4S binding domain 0.004
TIGR03143555 TIGR03143, AhpF_homolog, putative alkyl hydroperox 0.004
>gnl|CDD|239244 cd02940, DHPD_FMN, Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information 
 Score =  332 bits (854), Expect = e-108
 Identities = 127/200 (63%), Positives = 149/200 (74%), Gaps = 2/200 (1%)

Query: 565 ILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNIS 624
           ILIASIMC YNK+DW EL+K  E+AGADALELN SCPHGM ERGMG A GQDPE+V  I 
Sbjct: 101 ILIASIMCEYNKEDWTELAKLVEEAGADALELNFSCPHGMPERGMGAAVGQDPELVEEIC 160

Query: 625 LWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVG 684
            WVR +VKIP   KLTPNIT+I +IA+AA EG ADGVSAINTV+ LM +  DG P PA G
Sbjct: 161 RWVREAVKIPVIAKLTPNITDIREIARAAKEGGADGVSAINTVNSLMGVDLDGTP-PAPG 219

Query: 685 TKKLTTYGGVSGNATRPMGLKAVSSIAK-MFPNFPILGIGGIDSADVALQFIQAGAHAVQ 743
            +  TTYGG SG A +P+ L+AVS IA+   P  PI GIGGI+S + A +F+  GA  VQ
Sbjct: 220 VEGKTTYGGYSGPAVKPIALRAVSQIARAPEPGLPISGIGGIESWEDAAEFLLLGASVVQ 279

Query: 744 ICSAVQNQDFTVVDDYITGL 763
           +C+AV NQ FT+VDD  TGL
Sbjct: 280 VCTAVMNQGFTIVDDMCTGL 299

DHPD catalyzes the first step in pyrimidine degradation: the NADPH-dependent reduction of uracil and thymine to the corresponding 5,6-dihydropyrimidines. DHPD contains two FAD, two FMN, and eight [4Fe-4S] clusters, arranged in two electron transfer chains that pass the dimer interface twice. Two of the Fe-S clusters show a hitherto unobserved coordination involving a glutamine residue. Length = 299
>gnl|CDD|236237 PRK08318, PRK08318, dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|239204 cd02810, DHOD_DHPD_FMN, Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>gnl|CDD|235982 PRK07259, PRK07259, dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|215273 PLN02495, PLN02495, oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>gnl|CDD|240091 cd04740, DHOD_1B_like, Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>gnl|CDD|223245 COG0167, PyrD, Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130109 TIGR01037, pyrD_sub1_fam, dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>gnl|CDD|239244 cd02940, DHPD_FMN, Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|216348 pfam01180, DHO_dh, Dihydroorotate dehydrogenase Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|240089 cd04738, DHOD_2_like, Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|236237 PRK08318, PRK08318, dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236237 PRK08318, PRK08318, dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|215273 PLN02495, PLN02495, oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>gnl|CDD|235388 PRK05286, PRK05286, dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|240090 cd04739, DHOD_like, Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>gnl|CDD|240092 cd04741, DHOD_1A_like, Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>gnl|CDD|233243 TIGR01036, pyrD_sub2, dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>gnl|CDD|236051 PRK07565, PRK07565, dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>gnl|CDD|239204 cd02810, DHOD_DHPD_FMN, Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>gnl|CDD|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>gnl|CDD|223245 COG0167, PyrD, Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|225433 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|205417 pfam13237, Fer4_10, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|235347 PRK05113, PRK05113, electron transport complex protein RnfB; Provisional Back     alignment and domain information
>gnl|CDD|233648 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>gnl|CDD|235045 PRK02506, PRK02506, dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>gnl|CDD|224069 COG1146, COG1146, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|221801 pfam12838, Fer4_7, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|178421 PLN02826, PLN02826, dihydroorotate dehydrogenase Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|238317 cd00564, TMP_TenI, Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>gnl|CDD|223120 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|223514 COG0437, HybA, Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|234590 PRK00043, thiE, thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>gnl|CDD|235903 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|129820 TIGR00737, nifR3_yhdG, putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>gnl|CDD|233094 TIGR00693, thiE, thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>gnl|CDD|239201 cd02803, OYE_like_FMN_family, Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>gnl|CDD|205098 pfam12837, Fer4_6, 4Fe-4S binding domain Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 842
KOG1799|consensus471 100.0
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 100.0
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 100.0
PLN02826409 dihydroorotate dehydrogenase 100.0
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 100.0
KOG1436|consensus398 100.0
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 100.0
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 100.0
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 100.0
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 100.0
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 100.0
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 100.0
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 100.0
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 100.0
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 100.0
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 100.0
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 100.0
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 100.0
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 100.0
PRK12779944 putative bifunctional glutamate synthase subunit b 100.0
PRK12831464 putative oxidoreductase; Provisional 100.0
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 100.0
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
PRK12814652 putative NADPH-dependent glutamate synthase small 100.0
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 100.0
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 100.0
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 100.0
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 100.0
PRK098531019 putative selenate reductase subunit YgfK; Provisio 100.0
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 100.0
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.98
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.97
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.97
PRK13984604 putative oxidoreductase; Provisional 99.97
PLN02852491 ferredoxin-NADP+ reductase 99.97
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.97
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.96
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.96
KOG0399|consensus2142 99.96
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.94
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.94
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.94
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.94
PRK06370463 mercuric reductase; Validated 99.94
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 99.94
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 99.94
TIGR02053463 MerA mercuric reductase. This model represents the 99.93
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.93
PRK06116450 glutathione reductase; Validated 99.93
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.93
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.93
PRK07846451 mycothione reductase; Reviewed 99.93
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.93
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.93
PLN02546558 glutathione reductase 99.93
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.93
KOG0404|consensus322 99.93
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.93
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.93
PLN02507499 glutathione reductase 99.93
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.92
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.92
PRK065671028 putative bifunctional glutamate synthase subunit b 99.92
PRK10262321 thioredoxin reductase; Provisional 99.92
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 99.92
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.92
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 99.92
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.92
PRK14989847 nitrite reductase subunit NirD; Provisional 99.92
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 99.92
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 99.92
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.92
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.91
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.91
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.91
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.91
PRK13748561 putative mercuric reductase; Provisional 99.91
TIGR02374785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.91
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 99.91
PRK13512438 coenzyme A disulfide reductase; Provisional 99.91
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.91
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.91
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 99.91
PRK14694468 putative mercuric reductase; Provisional 99.91
PRK14727479 putative mercuric reductase; Provisional 99.91
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.91
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.91
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.91
PTZ00058561 glutathione reductase; Provisional 99.9
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.9
KOG2335|consensus358 99.9
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.9
PTZ00153659 lipoamide dehydrogenase; Provisional 99.89
PTZ00318424 NADH dehydrogenase-like protein; Provisional 99.89
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 99.89
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.89
PTZ00052499 thioredoxin reductase; Provisional 99.89
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 99.88
KOG1336|consensus478 99.88
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 99.87
KOG0405|consensus478 99.87
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 99.86
KOG1335|consensus506 99.86
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 99.84
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 99.84
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 99.84
COG1251793 NirB NAD(P)H-nitrite reductase [Energy production 99.83
PTZ00188506 adrenodoxin reductase; Provisional 99.79
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 99.78
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.75
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.74
KOG4716|consensus503 99.73
KOG1800|consensus468 99.71
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 99.68
KOG2495|consensus491 99.67
PRK13523337 NADPH dehydrogenase NamA; Provisional 99.67
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 99.67
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 99.66
PLN02535364 glycolate oxidase 99.65
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 99.64
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 99.64
KOG2333|consensus614 99.63
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.62
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 99.61
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 99.6
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 99.6
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 99.59
PLN02979366 glycolate oxidase 99.59
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.58
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 99.58
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 99.58
PRK11197381 lldD L-lactate dehydrogenase; Provisional 99.57
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 99.56
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 99.56
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 99.56
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 99.53
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 99.53
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 99.52
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 99.51
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 99.5
KOG1346|consensus659 99.49
KOG0538|consensus363 99.49
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 99.45
PRK10605362 N-ethylmaleimide reductase; Provisional 99.42
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 99.41
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.4
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 99.38
KOG2334|consensus 477 99.37
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 99.35
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 99.34
PLN02411391 12-oxophytodienoate reductase 99.33
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.28
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 99.23
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 99.22
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 99.18
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.18
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 99.12
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 99.08
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.07
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.03
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.02
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 99.02
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 99.01
KOG1799|consensus 471 99.0
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 98.99
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 98.98
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 98.96
KOG1399|consensus448 98.96
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 98.96
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 98.94
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 98.93
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.91
PRK14024241 phosphoribosyl isomerase A; Provisional 98.91
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 98.88
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 98.87
PLN02591250 tryptophan synthase 98.85
PLN02826409 dihydroorotate dehydrogenase 98.85
PLN02274505 inosine-5'-monophosphate dehydrogenase 98.84
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.82
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 98.82
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 98.81
PRK00507221 deoxyribose-phosphate aldolase; Provisional 98.8
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 98.79
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.79
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 98.77
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.76
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 98.75
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.72
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 98.71
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 98.71
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.7
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 98.69
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.69
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 98.68
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 98.67
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 98.66
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 98.66
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 98.66
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 98.64
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.64
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 98.64
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 98.64
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 98.63
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 98.63
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 98.61
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 98.61
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 98.6
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 98.59
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 98.59
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 98.58
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 98.58
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 98.57
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.56
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 98.55
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 98.55
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 98.54
KOG3851|consensus446 98.53
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 98.51
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 98.48
PF01645368 Glu_synthase: Conserved region in glutamate syntha 98.46
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 98.44
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.43
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 98.42
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 98.42
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.42
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.42
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 98.4
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 98.4
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.38
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 98.33
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.32
KOG2755|consensus334 98.31
PRK00208250 thiG thiazole synthase; Reviewed 98.3
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 98.3
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 98.28
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 98.24
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 98.23
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.21
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 98.2
KOG0134|consensus400 98.19
cd04742418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 98.18
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 98.18
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 98.17
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 98.17
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 98.16
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 98.16
PRK07695201 transcriptional regulator TenI; Provisional 98.15
KOG2550|consensus503 98.15
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 98.14
TIGR02814444 pfaD_fam PfaD family protein. The protein PfaD is 98.14
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 98.1
cd02812219 PcrB_like PcrB_like proteins. One member of this f 98.1
PLN02334229 ribulose-phosphate 3-epimerase 98.09
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 98.07
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 98.05
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 98.05
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.04
KOG1606|consensus296 98.03
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 98.02
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 98.02
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.0
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 98.0
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.98
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.98
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 97.97
KOG1436|consensus398 97.96
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 97.96
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 97.95
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 97.95
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 97.93
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 97.88
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.87
PRK07226267 fructose-bisphosphate aldolase; Provisional 97.85
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 97.84
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 97.84
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.82
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.8
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 97.8
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.78
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 97.78
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.77
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.77
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.76
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 97.76
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 97.75
PRK14024241 phosphoribosyl isomerase A; Provisional 97.75
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.74
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.74
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 97.71
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 97.68
PRK05581220 ribulose-phosphate 3-epimerase; Validated 97.67
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 97.66
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 97.65
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 97.65
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.64
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 97.63
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 97.62
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 97.62
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 97.61
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.61
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.6
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 97.6
PRK08005210 epimerase; Validated 97.59
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.59
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.57
PRK04302223 triosephosphate isomerase; Provisional 97.56
COG2081408 Predicted flavoproteins [General function predicti 97.53
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.52
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 97.5
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 97.49
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 97.48
PLN02617538 imidazole glycerol phosphate synthase hisHF 97.48
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.47
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 97.46
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 97.44
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 97.44
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.44
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.42
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 97.41
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.41
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.41
PLN02661357 Putative thiazole synthesis 97.41
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 97.41
PLN02617538 imidazole glycerol phosphate synthase hisHF 97.39
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.37
PRK05283257 deoxyribose-phosphate aldolase; Provisional 97.36
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 97.35
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 97.34
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.32
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.31
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.29
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 97.26
PRK08091228 ribulose-phosphate 3-epimerase; Validated 97.25
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 97.23
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.2
PRK14057254 epimerase; Provisional 97.2
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 97.2
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.17
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.16
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 97.13
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 97.09
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.08
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 97.07
PRK13512438 coenzyme A disulfide reductase; Provisional 97.06
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 97.04
KOG3111|consensus224 97.04
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.03
PRK12779944 putative bifunctional glutamate synthase subunit b 97.02
PRK07236386 hypothetical protein; Provisional 96.99
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 96.99
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 96.97
PRK06806281 fructose-bisphosphate aldolase; Provisional 96.96
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.95
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 96.93
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 96.91
PLN02460338 indole-3-glycerol-phosphate synthase 96.91
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 96.91
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 96.89
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.89
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 96.88
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 96.85
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.83
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 96.83
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 96.81
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.8
PRK08999312 hypothetical protein; Provisional 96.8
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 96.79
PLN02172461 flavin-containing monooxygenase FMO GS-OX 96.76
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 96.76
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 96.75
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.75
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.74
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 96.73
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.7
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 96.7
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 96.67
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.67
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.66
PRK08244493 hypothetical protein; Provisional 96.63
PRK06184502 hypothetical protein; Provisional 96.63
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 96.62
PRK06847375 hypothetical protein; Provisional 96.61
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 96.59
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.59
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 96.56
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 96.55
PRK10157428 putative oxidoreductase FixC; Provisional 96.53
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 96.52
TIGR02374785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.52
PTZ00318424 NADH dehydrogenase-like protein; Provisional 96.51
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.51
PRK14989 847 nitrite reductase subunit NirD; Provisional 96.5
PRK06834488 hypothetical protein; Provisional 96.47
PRK10015429 oxidoreductase; Provisional 96.47
PRK06481506 fumarate reductase flavoprotein subunit; Validated 96.46
PRK06185407 hypothetical protein; Provisional 96.45
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.43
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 96.42
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 96.42
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 96.42
PRK10262321 thioredoxin reductase; Provisional 96.41
PRK12831464 putative oxidoreductase; Provisional 96.41
PLN02463447 lycopene beta cyclase 96.4
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 96.38
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.36
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 96.36
PRK07315293 fructose-bisphosphate aldolase; Provisional 96.35
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 96.35
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 96.34
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 96.34
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 96.32
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 96.28
PRK08274466 tricarballylate dehydrogenase; Validated 96.27
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 96.26
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 96.26
PRK06801286 hypothetical protein; Provisional 96.24
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.23
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.22
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 96.21
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 96.2
PRK05868372 hypothetical protein; Validated 96.19
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 96.17
PRK12814652 putative NADPH-dependent glutamate synthase small 96.17
PRK08227264 autoinducer 2 aldolase; Validated 96.16
COG4529474 Uncharacterized protein conserved in bacteria [Fun 96.13
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.13
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 96.12
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 96.11
PLN02852491 ferredoxin-NADP+ reductase 96.09
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 96.09
PRK06126545 hypothetical protein; Provisional 96.08
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 96.08
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 96.08
PRK07588391 hypothetical protein; Provisional 96.07
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 96.07
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 96.07
PRK06475400 salicylate hydroxylase; Provisional 96.06
PRK08163396 salicylate hydroxylase; Provisional 96.06
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 96.05
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 96.04
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 96.03
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.02
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 95.99
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 95.97
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 95.96
PRK07845466 flavoprotein disulfide reductase; Reviewed 95.95
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 95.92
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.91
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 95.91
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 95.89
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 95.85
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 95.84
PRK09126392 hypothetical protein; Provisional 95.82
PRK07190487 hypothetical protein; Provisional 95.81
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 95.8
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 95.79
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 95.77
PRK12771564 putative glutamate synthase (NADPH) small subunit; 95.77
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 95.77
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 95.76
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 95.76
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 95.76
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 95.74
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 95.74
PRK06753373 hypothetical protein; Provisional 95.73
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 95.72
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 95.7
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 95.7
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 95.67
PRK08013400 oxidoreductase; Provisional 95.65
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 95.65
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 95.62
PRK07121492 hypothetical protein; Validated 95.61
PRK05976472 dihydrolipoamide dehydrogenase; Validated 95.61
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 95.6
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 95.59
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 95.58
PRK13984604 putative oxidoreductase; Provisional 95.58
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 95.58
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 95.57
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 95.57
KOG4175|consensus268 95.56
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 95.56
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 95.55
PRK08132547 FAD-dependent oxidoreductase; Provisional 95.55
PRK02227238 hypothetical protein; Provisional 95.54
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 95.54
KOG1399|consensus448 95.53
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 95.53
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 95.53
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 95.52
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 95.5
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 95.5
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 95.5
PRK11445351 putative oxidoreductase; Provisional 95.44
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.44
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 95.42
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 95.42
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 95.38
>KOG1799|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.5e-63  Score=503.81  Aligned_cols=454  Identities=30%  Similarity=0.473  Sum_probs=398.4

Q ss_pred             ccCCceEEEECCEEEEccccCcCChhHHhhcCCcccCCCCCeeeCCCCCCCCCCCeEEeccCCCCchhHHHHHHHHHHHH
Q psy16199        236 EDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAA  315 (842)
Q Consensus       236 ~~~g~~~~i~~D~Vi~a~G~~~~~~~l~~~l~gl~~~~~G~i~vd~~~~~Ts~~gVfa~GD~~~~~~~~~~A~~~G~~aA  315 (842)
                      .++|+..-..+|+++.+.|-. ..+.+.    .+.++     .||.-..+++-..|||.||+.. ..+....+++| .++
T Consensus         4 ~~d~~~~~~~~~~~~t~~g~~-~~tai~----p~~l~-----~v~s~a~~~s~~~i~A~gdi~s-aeS~l~~~~~G-~s~   71 (471)
T KOG1799|consen    4 KSDGTPWPAVGIAKRTTYGGV-SGTAIR----PIALR-----AVTSIARALSGFPILATGDIDS-AESGLQFLHSG-ASV   71 (471)
T ss_pred             ccCCceeeEeeeEEEeecccc-chhhcc----chhHH-----HHHHHhhccCCceeeccCCcch-hhhcCcccccc-HHH
Confidence            345666778899999999954 222221    23333     3555567888999999999973 45667788999 899


Q ss_pred             HHHHHHHHhcCCCCCCCCCCCCceeeccccccceeeecccccCCCcccccCCCCCcHHHHHHhhhcCCceEEEEeeccCC
Q psy16199        316 WHIHKYIQEKNNLTVPDKPCLPKFMSHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQK  395 (842)
Q Consensus       316 ~~I~~~L~~~~~~~~~~~~~~p~~~t~i~~~~L~~~~~G~~~~nP~~~As~p~~~~~~~~~~a~~~G~g~vv~kt~~~~~  395 (842)
                      +++++++|.++ ......+++|.+++.++.++..++++|.++.|||..+|+|++.+++.+++|++.|||++.+||..++.
T Consensus        72 l~v~saiqs~~-~~v~e~~~~~k~~~~l~~ie~~vd~~G~k~~npf~~~s~Pp~t~~~lm~raf~~gwg~l~~kt~~ld~  150 (471)
T KOG1799|consen   72 LQVCSAIQSQD-FTVIEDYTGLKALLYLKSIEELVDWDGQKPANPFHQKSKPPPTIAELMDRAFPSGWGYLEQKTKILDE  150 (471)
T ss_pred             HHHHHHHhcCC-CcccccccchhhhcchhhhhhhccccCccCCCccccCCCCCCccHHHHHhhhhcccchhheeeeecch
Confidence            99999999865 44555668999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccccCcceecccccccccCCCCcceeeeEeecccchhhHHhhhhcCCCCcchhhhHHHHHHhhccccccCCcccccCC
Q psy16199        396 DMVTNVSPRIVKGTTSRHLYGPEQGSFLNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNG  475 (842)
Q Consensus       396 ~~~~~~~p~~~~~~~~~~~~~~~~~~~~n~e~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~g  475 (842)
                      +.+.|++||++++.+++..|+|.+..+.|+|+|||+++|+||   ..              +.++|              
T Consensus       151 ~kV~nv~prvar~~t~~~~~~p~~~i~~nielIsdr~~e~~L---~~--------------f~eLk--------------  199 (471)
T KOG1799|consen  151 NKVRNVEPRVARSPTKRSCFIPKRPIPTNIELISDRKAEQYL---GT--------------FGELK--------------  199 (471)
T ss_pred             hhheecccceeeccCCCCccccCCCccchhhhhccchHHHHH---HH--------------HHHhc--------------
Confidence            999999999999999999999999999999999999999999   65              66776              


Q ss_pred             CCCCCCCChhHHHHhhhhhhCccccccccCccCCCcceeEeeccCCccccCCccccCCCccchhhhhcCccccccccccc
Q psy16199        476 LPKRQINTPVETILSVKDVIGQAVQRVTNYTELDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDE  555 (842)
Q Consensus       476 ~dk~~~~~~~~~~~~l~~~~G~~~g~vt~~~~~~n~~~~~~~~~~~~~in~~~c~~Gfn~~G~dai~~~~~~~~~~~~~~  555 (842)
                         +                                        +                       .|.         
T Consensus       200 ---~----------------------------------------~-----------------------~p~---------  204 (471)
T KOG1799|consen  200 ---N----------------------------------------V-----------------------EPV---------  204 (471)
T ss_pred             ---c----------------------------------------c-----------------------CCc---------
Confidence               3                                        2                       333         


Q ss_pred             cccccccccceEEEeccCCCHhHHHHHHHHHhhcCcCEEEEeccCCCCCCCCCCcccCCCCHHHHHHHHHHHHhhCCccE
Q psy16199        556 CTGCTLCLSILIASIMCTYNKDDWLELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPF  635 (842)
Q Consensus       556 ~~~~~~~~~pvi~si~~g~~~e~~~~~a~~~~~agaD~ielN~scP~~~~~~~~G~~~~~~~~~~~~ii~~v~~~~~~Pv  635 (842)
                              +.+|+|+||-++..+|.+++.+.+++|+|.+|+||||||.|.++++|.+++|+|..+.|++.||+..+.+|+
T Consensus       205 --------~imIas~Mciynk~~w~el~d~~eqag~d~lE~nlscphgm~ergmgla~gq~p~v~~EvC~Wi~A~~~Ip~  276 (471)
T KOG1799|consen  205 --------VIMIASEMCIYNKKCWMELNDSGEQAGQDDLETNLSCPHGMCERGMGLALGQCPIVDCEVCGWINAKATIPM  276 (471)
T ss_pred             --------eeeehHHHHHhhhhhHHHHhhhHHhhcccchhccCCCCCCCccccccceeccChhhhHHHhhhhhhcccccc
Confidence                    678999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecCChhcHHHHHHHHHHCCCCEEEEecCCCccccCCCCCCCCCcccCCCccccCCCCCCccccchHHHHHHHHhhCC
Q psy16199        636 FVKLTPNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFP  715 (842)
Q Consensus       636 ~vKl~p~~~~~~~~a~~~~~~G~d~i~v~nt~~~~~~~~~~~~~~p~~~~~~~~~~gG~sG~~~~p~al~~v~~i~~~~~  715 (842)
                      +-|++||+++..++|+.+...|+.||.++||+.+.|++|.+ +.||....++++.+||||+.+++|+|+..|..|++.+.
T Consensus       277 ~~kmTPNitd~revar~~~~~g~~GiaA~NTi~SvM~i~~~-~~~P~~~~~~~sT~GG~S~~AvRPIAl~~V~~IA~~m~  355 (471)
T KOG1799|consen  277 VSKMTPNITDKREVARSVNPVGCEGIAAINTIMSVMGIDMK-TLRPEPCVEGYSTPGGYSYKAVRPIALAKVMNIAKMMK  355 (471)
T ss_pred             ccccCCCcccccccchhcCcccccchhhHhHHHHHhccccc-ccCCCcccccccCCCCccccccchHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999 77888888999999999999999999999999999997


Q ss_pred             CCcEEEecCcCCHHHHHHHHHhCCCEEEEehhhhccCchhHHHHHHHHHHHHHhcCC-CccccCCCCCCCccccCCCCCC
Q psy16199        716 NFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYITGLQTLLYLKST-QLKGWDGQSPPTPVHQKGKPAY  794 (842)
Q Consensus       716 ~ipIi~~GGI~t~~da~~~l~~GA~~Vqv~ta~l~~gp~~~~~i~~~l~~~m~~~g~-~i~~~~~~~~~~~~~~~g~~~~  794 (842)
                      ++||.+.|||.|++|+.+||++|++.|||||+++.+|+..++.+..+|+++|++.|+ +|++|+|+++     +.+.   
T Consensus       356 ~F~l~~~GGvEt~~~~~~Fil~Gs~~vQVCt~V~~~~~~~V~~~Ca~LK~~m~~~~~~ti~~~~G~SL-----~~~~---  427 (471)
T KOG1799|consen  356 EFSLSGIGGVETGYDAAEFILLGSNTVQVCTGVMMHGYGHVKTLCAELKDFMKQHNFSTIEEFRGHSL-----QYFT---  427 (471)
T ss_pred             cCccccccCcccccchhhHhhcCCcHhhhhhHHHhcCcchHHHHHHHHHHHHHHcCchhhhhccCcch-----hhhh---
Confidence            899999999999999999999999999999999999999999999999999999999 9999999853     2221   


Q ss_pred             cchhhccCCCCCchhhHHHHHHHHHHHHhhcccCCCccccC
Q psy16199        795 QFRDKEGKAIPNFGEYKKIRENLITELNLKKLNSDGVSLQN  835 (842)
Q Consensus       795 ~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  835 (842)
                             .+.+.+..+++.+++..++++..   ...+.|.+
T Consensus       428 -------~~~~~~~r~ke~~Eq~~A~K~~~---~~~~D~~~  458 (471)
T KOG1799|consen  428 -------THTDLVKRQKEAVEQRKAEKRGL---KSDKDWTG  458 (471)
T ss_pred             -------ccchHHHHHHHHHHHHHHHhhcc---cccccccC
Confidence                   23445666677776666655444   44445543

>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>KOG1436|consensus Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>KOG2335|consensus Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>KOG2333|consensus Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>KOG0538|consensus Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>KOG2334|consensus Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>KOG1799|consensus Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0134|consensus Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>KOG1606|consensus Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>KOG1436|consensus Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3111|consensus Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG4175|consensus Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query842
1h7w_A1025 Dihydropyrimidine Dehydrogenase (Dpd) From Pig Leng 1e-143
1h7w_A 1025 Dihydropyrimidine Dehydrogenase (Dpd) From Pig Leng 1e-104
1h7x_A1025 Dihydropyrimidine Dehydrogenase (Dpd) From Pig, Ter 1e-142
1h7x_A 1025 Dihydropyrimidine Dehydrogenase (Dpd) From Pig, Ter 1e-103
1ep1_A311 Crystal Structure Of Lactococcus Lactis Dihydroorot 4e-20
2vdc_G456 The 9.5 A Resolution Structure Of Glutamate Synthas 2e-12
2djl_A314 Crystal Structure Of Trypanosoma Cruzi Dihydroorota 4e-08
2e68_A314 Crystal Structure Of Trypanosoma Cruzi Dihydroorota 5e-08
3c3n_A312 Crystal Structure Of Dihydroorotate Dehydrogenase F 5e-08
1f76_A336 Escherichia Coli Dihydroorotate Dehydrogenase Lengt 3e-07
1jub_A311 The K136e Mutant Of Lactococcus Lactis Dihydroorota 5e-07
2b4g_A317 Dihydroorotate Dehydrogenase Length = 317 6e-07
1dor_A311 Dihydroorotate Dehydrogenase A From Lactococcus Lac 2e-06
1jqv_A311 The K213e Mutant Of Lactococcus Lactis Dihydroorota 2e-06
1jrc_A311 The N67a Mutant Of Lactococcus Lactis Dihydroorotat 2e-06
1uum_A372 Rat Dihydroorotate Dehydrogenase (Dhod)in Complex W 2e-06
1jqx_A311 The R57a Mutant Of Lactococcus Lactis Dihydroorotat 2e-06
1jrb_A311 The P56a Mutant Of Lactococcus Lactis Dihydroorotat 2e-06
2b0m_A393 Human Dihydroorotate Dehydrogenase Bound To A Novel 4e-05
3kvj_A390 Crystal Structure Of Human Dihydroorotate Dehydroge 4e-05
2wv8_A365 Complex Of Human Dihydroorotate Dehydrogenase With 4e-05
1d3g_A367 Human Dihydroorotate Dehydrogenase Complexed With B 5e-05
2fpt_A395 Dual Binding Mode Of A Novel Series Of Dhodh Inhibi 5e-05
3mhu_A346 Crystal Structure Of Dihydroorotate Dehydrogenase F 6e-05
3gye_A354 Didydroorotate Dehydrogenase From Leishmania Major 6e-05
3u2o_A395 Dihydroorotate Dehydrogenase (Dhodh) Crystal Struct 6e-05
3c61_A314 Crystal Structure Of Dihydroorotate Dehydrogenase F 2e-04
3tro_A354 Crystal Structure Of Leishmania Major Dihydroorotat 3e-04
3tjx_A354 Crystal Structure Of Leishmania Major Dihydroorotat 3e-04
3oix_A345 Crystal Structure Of The Putative Dihydroorotate De 7e-04
>pdb|1H7W|A Chain A, Dihydropyrimidine Dehydrogenase (Dpd) From Pig Length = 1025 Back     alignment and structure 
Iteration: 1

 Score =  504 bits (1297), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 251/393 (63%), Positives = 301/393 (76%), Gaps = 2/393 (0%)
Query: 41  SSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPN 100
           +SEIPQ+RLP+D VNFE+EL+KDLGVKI C +SLS  +IT+  L+++GY A FIGIG P 
Sbjct: 228 TSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSENEITLNTLKEEGYKAAFIGIGLPE 287
Query: 101 ANVIPIFQGLTEEMGFYTSKTFLPRVATXXXXXXXXXXXXXXXPILKGTVIVLGAGDTAF 160
                IFQGLT++ GFYTSK FLP VA                P ++G VIVLGAGDTAF
Sbjct: 288 PKTDDIFQGLTQDQGFYTSKDFLPLVA--KSSKAGMCACHSPLPSIRGAVIVLGAGDTAF 345
Query: 161 DCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAG 220
           DCATSALRCGA +V +VFRKG  NIRAVPEEV+LA EEKCEFLPF+SP +V VK  +I  
Sbjct: 346 DCATSALRCGARRVFLVFRKGFVNIRAVPEEVELAKEEKCEFLPFLSPRKVIVKGGRIVA 405
Query: 221 MQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVN 280
           +QF RTEQ+E G+W EDE+Q + LKA+ +ISAFGS L D  V EA+ P+K +++  PEV+
Sbjct: 406 VQFVRTEQDETGKWNEDEDQIVHLKADVVISAFGSVLRDPKVKEALSPIKFNRWDLPEVD 465
Query: 281 YTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFM 340
             TM TS P VF GGD   +++TTVESVNDGK A+W+IHKYIQ +   +V  KP LP F 
Sbjct: 466 PETMQTSEPWVFAGGDIVGMANTTVESVNDGKQASWYIHKYIQAQYGASVSAKPELPLFY 525
Query: 341 SHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTN 400
           + +DLVDISVE+ GLKF NPFGLASA PTT+SSM+RRAFE GWGFA+TKTFSL KD+VTN
Sbjct: 526 TPVDLVDISVEMAGLKFINPFGLASAAPTTSSSMIRRAFEAGWGFALTKTFSLDKDIVTN 585
Query: 401 VSPRIVKGTTSRHLYGPEQGSFLNIELISEKTA 433
           VSPRIV+GTTS  +YGP Q SFLNIELISEKTA
Sbjct: 586 VSPRIVRGTTSGPMYGPGQSSFLNIELISEKTA 618
>pdb|1H7W|A Chain A, Dihydropyrimidine Dehydrogenase (Dpd) From Pig Length = 1025 Back     alignment and structure
>pdb|1H7X|A Chain A, Dihydropyrimidine Dehydrogenase (Dpd) From Pig, Ternary Complex Of A Mutant Enzyme (C671a), Nadph And 5- Fluorouracil Length = 1025 Back     alignment and structure
>pdb|1H7X|A Chain A, Dihydropyrimidine Dehydrogenase (Dpd) From Pig, Ternary Complex Of A Mutant Enzyme (C671a), Nadph And 5- Fluorouracil Length = 1025 Back     alignment and structure
>pdb|1EP1|A Chain A, Crystal Structure Of Lactococcus Lactis Dihydroorotate Dehydrogenase B Length = 311 Back     alignment and structure
>pdb|2VDC|G Chain G, The 9.5 A Resolution Structure Of Glutamate Synthase From Cryo-Electron Microscopy And Its Oligomerization Behavior In Solution: Functional Implications. Length = 456 Back     alignment and structure
>pdb|2DJL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydroorotate Dehydrogenase In Complex With Succinate Length = 314 Back     alignment and structure
>pdb|2E68|A Chain A, Crystal Structure Of Trypanosoma Cruzi Dihydroorotate Dehydrogenase In Complex With Dihydroorotate Length = 314 Back     alignment and structure
>pdb|3C3N|A Chain A, Crystal Structure Of Dihydroorotate Dehydrogenase From Trypanosoma Cruzi Strain Y Length = 312 Back     alignment and structure
>pdb|1F76|A Chain A, Escherichia Coli Dihydroorotate Dehydrogenase Length = 336 Back     alignment and structure
>pdb|1JUB|A Chain A, The K136e Mutant Of Lactococcus Lactis Dihydroorotate Dehydrogenase A Length = 311 Back     alignment and structure
>pdb|2B4G|A Chain A, Dihydroorotate Dehydrogenase Length = 317 Back     alignment and structure
>pdb|1DOR|A Chain A, Dihydroorotate Dehydrogenase A From Lactococcus Lactis Length = 311 Back     alignment and structure
>pdb|1JQV|A Chain A, The K213e Mutant Of Lactococcus Lactis Dihydroorotate Dehydrogenase A Length = 311 Back     alignment and structure
>pdb|1JRC|A Chain A, The N67a Mutant Of Lactococcus Lactis Dihydroorotate Dehydrogenase A Length = 311 Back     alignment and structure
>pdb|1UUM|A Chain A, Rat Dihydroorotate Dehydrogenase (Dhod)in Complex With Atovaquone Length = 372 Back     alignment and structure
>pdb|1JQX|A Chain A, The R57a Mutant Of Lactococcus Lactis Dihydroorotate Dehydrogenase A Length = 311 Back     alignment and structure
>pdb|1JRB|A Chain A, The P56a Mutant Of Lactococcus Lactis Dihydroorotate Dehydrogenase A Length = 311 Back     alignment and structure
>pdb|2B0M|A Chain A, Human Dihydroorotate Dehydrogenase Bound To A Novel Inhibitor Length = 393 Back     alignment and structure
>pdb|3KVJ|A Chain A, Crystal Structure Of Human Dihydroorotate Dehydrogenase (Dhodh) With Amino-Benzoic Acid Inhibitor 105 At 1.94a Resolution Length = 390 Back     alignment and structure
>pdb|2WV8|A Chain A, Complex Of Human Dihydroorotate Dehydrogenase With The Inhibitor 221290 Length = 365 Back     alignment and structure
>pdb|1D3G|A Chain A, Human Dihydroorotate Dehydrogenase Complexed With Brequinar Analog Length = 367 Back     alignment and structure
>pdb|2FPT|A Chain A, Dual Binding Mode Of A Novel Series Of Dhodh Inhibitors Length = 395 Back     alignment and structure
>pdb|3MHU|A Chain A, Crystal Structure Of Dihydroorotate Dehydrogenase From Leishmania Major In Complex With 5-Nitroorotic Acid Length = 346 Back     alignment and structure
>pdb|3GYE|A Chain A, Didydroorotate Dehydrogenase From Leishmania Major Length = 354 Back     alignment and structure
>pdb|3U2O|A Chain A, Dihydroorotate Dehydrogenase (Dhodh) Crystal Structure In Complex With Small Molecule Inhibitor Length = 395 Back     alignment and structure
>pdb|3C61|A Chain A, Crystal Structure Of Dihydroorotate Dehydrogenase From Leishmania Donovani Length = 314 Back     alignment and structure
>pdb|3TRO|A Chain A, Crystal Structure Of Leishmania Major Dihydroorotate Dehydrogenase Mutant D171a Length = 354 Back     alignment and structure
>pdb|3TJX|A Chain A, Crystal Structure Of Leishmania Major Dihydroorotate Dehydrogenase Mutant H174a Length = 354 Back     alignment and structure
>pdb|3OIX|A Chain A, Crystal Structure Of The Putative Dihydroorotate Dehydrogenase From Streptococcus Mutans Length = 345 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query842
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 1e-160
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 1e-134
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 2e-31
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 3e-73
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 4e-18
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 8e-44
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 8e-07
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 1e-42
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 7e-06
3gz3_A354 Dihydroorotate dehydrogenase, putative; dhodh, oxi 6e-41
3gz3_A354 Dihydroorotate dehydrogenase, putative; dhodh, oxi 5e-06
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 1e-36
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 7e-13
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 7e-33
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 3e-15
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 3e-14
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 1e-13
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 1e-12
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 1e-10
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 3e-10
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 3e-09
4fk1_A304 Putative thioredoxin reductase; structural genomic 3e-06
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 2e-05
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 3e-05
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 4e-05
1q16_B512 Respiratory nitrate reductase 1 beta chain; membra 5e-05
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 5e-05
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 6e-05
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 1e-04
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 2e-04
1kqf_B294 FDH-N beta S, formate dehydrogenase, nitrate-induc 3e-04
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 3e-04
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 4e-04
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 5e-04
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 6e-04
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
 Score =  493 bits (1272), Expect = e-160
 Identities = 257/393 (65%), Positives = 308/393 (78%), Gaps = 2/393 (0%)

Query: 41  SSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPN 100
           +SEIPQ+RLP+D VNFE+EL+KDLGVKI C +SLS  +IT+  L+++GY A FIGIG P 
Sbjct: 228 TSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSENEITLNTLKEEGYKAAFIGIGLPE 287

Query: 101 ANVIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAF 160
                IFQGLT++ GFYTSK FLP VA SSK G+C       LP ++G VIVLGAGDTAF
Sbjct: 288 PKTDDIFQGLTQDQGFYTSKDFLPLVAKSSKAGMCA--CHSPLPSIRGAVIVLGAGDTAF 345

Query: 161 DCATSALRCGANKVLVVFRKGCTNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAG 220
           DCATSALRCGA +V +VFRKG  NIRAVPEEV+LA EEKCEFLPF+SP +V VK  +I  
Sbjct: 346 DCATSALRCGARRVFLVFRKGFVNIRAVPEEVELAKEEKCEFLPFLSPRKVIVKGGRIVA 405

Query: 221 MQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDNDVLEAIKPVKLDKYGYPEVN 280
           +QF RTEQ+E G+W EDE+Q + LKA+ +ISAFGS L D  V EA+ P+K +++  PEV+
Sbjct: 406 VQFVRTEQDETGKWNEDEDQIVHLKADVVISAFGSVLRDPKVKEALSPIKFNRWDLPEVD 465

Query: 281 YTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFM 340
             TM TS P VF GGD   +++TTVESVNDGK A+W+IHKYIQ +   +V  KP LP F 
Sbjct: 466 PETMQTSEPWVFAGGDIVGMANTTVESVNDGKQASWYIHKYIQAQYGASVSAKPELPLFY 525

Query: 341 SHIDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTN 400
           + +DLVDISVE+ GLKF NPFGLASA PTT+SSM+RRAFE GWGFA+TKTFSL KD+VTN
Sbjct: 526 TPVDLVDISVEMAGLKFINPFGLASAAPTTSSSMIRRAFEAGWGFALTKTFSLDKDIVTN 585

Query: 401 VSPRIVKGTTSRHLYGPEQGSFLNIELISEKTA 433
           VSPRIV+GTTS  +YGP Q SFLNIELISEKTA
Sbjct: 586 VSPRIVRGTTSGPMYGPGQSSFLNIELISEKTA 618
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Length = 311 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Length = 311 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Length = 311 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Length = 311 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Length = 314 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Length = 314 Back     alignment and structure
>3gz3_A Dihydroorotate dehydrogenase, putative; dhodh, oxidoreductase; HET: FMN ORO; 1.90A {Leishmania major} PDB: 3gye_A* Length = 354 Back     alignment and structure
>3gz3_A Dihydroorotate dehydrogenase, putative; dhodh, oxidoreductase; HET: FMN ORO; 1.90A {Leishmania major} PDB: 3gye_A* Length = 354 Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Length = 345 Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Length = 345 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Length = 367 Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Length = 443 Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Length = 336 Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Length = 415 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Length = 80 Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Length = 227 Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Length = 512 Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Length = 352 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Length = 294 Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Length = 274 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Length = 349 Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query842
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 100.0
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 100.0
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 100.0
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 100.0
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 100.0
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 100.0
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 100.0
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 100.0
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 100.0
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 100.0
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 100.0
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.96
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.95
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.95
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.94
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.94
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.94
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.94
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.94
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.94
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.94
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.94
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.93
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.93
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.93
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.93
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.93
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.93
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.93
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.93
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.93
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.92
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.92
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.92
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.92
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.92
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.92
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.92
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.92
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.92
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.92
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.92
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.92
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.92
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.92
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.92
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.92
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.92
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.92
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.92
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.92
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.92
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.92
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.92
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.92
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.92
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.92
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.92
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.92
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.91
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.91
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.91
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.91
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.91
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.91
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.91
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.91
4dna_A463 Probable glutathione reductase; structural genomic 99.91
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.9
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.9
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.9
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.9
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.9
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.9
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.9
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.89
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.89
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 99.89
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.89
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 99.89
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.88
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.88
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.88
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.87
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.87
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.87
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 99.86
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.86
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.85
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.85
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.84
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.84
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.82
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 99.81
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.81
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.81
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.81
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.8
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 99.8
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 99.8
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.8
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 99.75
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.75
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 99.75
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.75
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 99.74
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.74
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 99.74
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 99.73
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 99.72
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.72
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 99.71
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 99.71
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 99.7
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 99.7
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 99.69
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 99.68
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 99.68
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 99.68
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 99.68
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 99.68
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.66
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 99.65
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 99.64
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 99.64
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 99.64
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 99.62
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.6
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 99.54
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.54
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 99.47
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.47
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.45
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 99.44
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.43
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 99.39
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 99.37
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.36
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 99.35
2cul_A232 Glucose-inhibited division protein A-related PROT 99.33
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 99.3
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 99.27
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 99.27
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 99.26
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 99.26
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.23
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 99.22
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 99.22
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.22
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 99.22
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 99.21
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 99.19
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 99.17
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 99.17
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.16
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 99.13
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 99.13
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 99.11
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 99.1
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 99.09
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.06
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 99.05
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 99.03
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 99.01
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 99.0
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 98.99
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 98.98
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 98.96
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.95
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.95
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 98.94
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 98.93
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 98.92
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 98.89
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 98.89
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.88
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.88
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 98.86
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 98.86
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.86
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 98.83
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 98.83
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 98.82
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.81
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 98.8
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.79
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 98.78
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 98.77
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.76
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 98.74
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 98.73
1ujp_A271 Tryptophan synthase alpha chain; riken structural 98.71
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.71
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 98.69
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 98.67
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 98.58
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.57
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 98.56
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 98.56
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 98.55
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 98.51
1viz_A240 PCRB protein homolog; structural genomics, unknown 98.51
3tha_A252 Tryptophan synthase alpha chain; structural genomi 98.5
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 98.5
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 98.48
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 98.47
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 98.43
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 98.42
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 98.41
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.4
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 98.39
3oa3_A288 Aldolase; structural genomics, seattle structural 98.34
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 98.33
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 98.33
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 98.31
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.31
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 98.3
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 98.29
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.25
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 98.22
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 98.18
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 98.17
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 98.17
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 98.16
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 98.15
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 98.13
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.11
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 98.07
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 98.05
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 98.03
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 98.02
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.01
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 97.99
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 97.99
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 97.99
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.98
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 97.97
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 97.96
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 97.96
2bry_A497 NEDD9 interacting protein with calponin homology a 97.95
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 97.92
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 97.91
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 97.91
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 97.87
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 97.87
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 97.87
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 97.86
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 97.82
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 97.76
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 97.75
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 97.75
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 97.75
2qgy_A391 Enolase from the environmental genome shotgun sequ 97.75
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 97.72
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 97.7
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 97.7
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 97.7
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 97.7
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 97.69
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 97.67
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.64
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 97.63
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 97.62
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 97.62
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 97.61
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 97.61
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 97.6
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 97.6
2gl5_A410 Putative dehydratase protein; structural genomics, 97.6
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 97.58
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.58
3eez_A378 Putative mandelate racemase/muconate lactonizing e 97.57
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 97.56
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 97.56
2oz8_A389 MLL7089 protein; structural genomics, unknown func 97.55
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 97.55
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 97.54
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 97.51
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 97.51
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 97.51
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 97.5
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 97.48
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 97.47
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 97.47
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 97.45
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 97.44
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 97.43
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.43
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 97.42
2o56_A407 Putative mandelate racemase; dehydratase, structur 97.42
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 97.41
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 97.41
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.4
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.4
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.4
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.4
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 97.39
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 97.38
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 97.38
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.38
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 97.37
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 97.37
1tzz_A392 Hypothetical protein L1841; structural genomics, m 97.37
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 97.36
2poz_A392 Putative dehydratase; octamer, structural genomics 97.35
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 97.34
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.33
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 97.32
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 97.3
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 97.3
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.3
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.29
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 97.28
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 97.28
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.27
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.25
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 97.23
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.22
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.22
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 97.21
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 97.21
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 97.2
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 97.2
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.19
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.16
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.14
3atr_A453 Conserved archaeal protein; saturating double bond 97.13
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.12
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.12
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 97.11
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 97.11
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.11
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.1
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.1
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.09
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 97.09
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.08
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.08
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.07
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.07
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.07
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.07
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 97.06
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 97.06
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.05
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.05
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 97.05
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 97.03
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 97.03
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.02
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.01
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.0
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 96.99
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.99
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 96.98
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 96.98
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.98
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 96.97
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 96.96
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 96.94
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.92
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 96.92
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 96.92
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 96.9
3dme_A369 Conserved exported protein; structural genomics, P 96.88
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 96.87
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 96.86
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.85
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 96.85
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 96.85
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 96.84
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 96.84
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 96.83
3kts_A192 Glycerol uptake operon antiterminator regulatory; 96.83
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 96.83
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.81
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 96.81
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 96.8
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 96.8
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 96.8
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 96.76
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.76
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.76
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 96.76
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 96.74
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 96.74
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 96.74
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 96.74
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 96.73
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 96.71
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 96.69
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 96.68
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 96.68
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 96.68
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 96.67
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 96.65
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 96.65
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.64
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 96.64
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 96.61
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 96.61
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 96.6
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.6
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.59
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 96.58
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.56
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 96.54
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 96.53
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 96.53
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 96.52
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 96.51
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 96.5
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 96.49
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 96.49
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 96.47
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 96.46
3r9u_A315 Thioredoxin reductase; structural genomics, center 96.45
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 96.45
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.45
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 96.43
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.4
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 96.39
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 96.37
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 96.37
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 96.37
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 96.36
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 96.36
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 96.35
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 96.32
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.31
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 96.3
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.29
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 96.29
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.28
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 96.27
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 96.26
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 96.25
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 96.24
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.23
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.21
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 96.2
3r0u_A379 Enzyme of enolase superfamily; structural genomics 96.17
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 96.16
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 96.16
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 96.14
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 96.14
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 96.14
4hb9_A412 Similarities with probable monooxygenase; flavin, 96.12
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 96.12
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 96.12
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 96.1
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 96.06
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 96.04
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 96.04
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 96.03
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 96.02
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 96.01
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 96.01
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 96.01
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 95.99
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 95.99
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 95.98
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 95.98
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 95.97
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 95.97
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 95.97
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 95.96
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 95.96
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 95.95
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 95.95
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 95.94
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 95.92
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 95.9
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 95.9
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.89
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 95.89
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 95.88
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 95.85
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 95.83
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 95.83
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 95.8
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 95.79
3g8r_A350 Probable spore coat polysaccharide biosynthesis P; 95.74
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 95.73
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 95.67
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 95.67
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 95.66
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 95.66
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 95.64
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 95.62
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 95.62
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 95.62
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 95.6
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 95.57
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 95.56
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 95.56
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 95.54
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 95.51
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 95.5
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-86  Score=826.30  Aligned_cols=683  Identities=64%  Similarity=1.062  Sum_probs=601.2

Q ss_pred             ec-ceeEeecC-CCCccccccCCCCCCCHHHHHHHHHHHHhcCcEEEeceeeccccceeccccccCCCEEEEccCCCCCC
Q psy16199         25 SK-DLPDIERP-VAALPDSSEIPQYRLPFDAVNFEVELVKDLGVKIECERSLSTRDITIEKLRKDGYTAIFIGIGKPNAN  102 (842)
Q Consensus        25 g~-~V~l~Ek~-~~GG~~~~~iP~~~~~~~~v~~~~~~l~~~gV~i~~~~~v~~~~v~~~~~~~~~yd~lVlAtGs~~~~  102 (842)
                      || +|+|||+. .+||++.+++|.++++.+++++..+++++.||+|++++.++.++++++++....||+||||||+..|+
T Consensus       210 G~~~Vtv~E~~~~~GG~~~~~ip~~~~~~~~~~~~~~~~~~~gv~~~~~~~v~~~~v~~~~~~~~~~d~vvlAtGa~~p~  289 (1025)
T 1gte_A          210 GYSDITIFEKQEYVGGLSTSEIPQFRLPYDVVNFEIELMKDLGVKIICGKSLSENEITLNTLKEEGYKAAFIGIGLPEPK  289 (1025)
T ss_dssp             TCCCEEEEESSSSCSTHHHHTSCTTTSCHHHHHHHHHHHHTTTCEEEESCCBSTTSBCHHHHHHTTCCEEEECCCCCEEC
T ss_pred             CCCcEEEEeCCCCCCccccccCCcccCCHHHHHHHHHHHHHCCcEEEcccEeccceEEhhhcCccCCCEEEEecCCCCCC
Confidence            88 79999997 89999999999999999999999999999999999999887446777766667899999999995477


Q ss_pred             CCCCCCCCccccCceehhcchHHHhhcccCCccCCCCCCCCCCCCCcEEEEcCChhHHHHHHHHHHcCCcEEEEEEeecC
Q psy16199        103 VIPIFQGLTEEMGFYTSKTFLPRVATSSKKGLCGGCKKESLPILKGTVIVLGAGDTAFDCATSALRCGANKVLVVFRKGC  182 (842)
Q Consensus       103 ~~~i~~G~~~~~gv~~~~~~l~~~~~~~~~~~c~~c~~~~~~~~~~kVvVIGgG~~g~e~A~~l~~~G~~~Vtlv~r~~~  182 (842)
                      .+++++|+.+.++++++.+||+.+++..+..+| .|+. .....+++|+|||||++|+|+|..+.+.|+++||+++|++.
T Consensus       290 ~l~~~~G~~~~~gv~~a~~~L~~~~~~~~~~~~-~~~~-~~~~~~~~VvVIGgG~~g~e~A~~~~~~G~~~Vtvv~r~~~  367 (1025)
T 1gte_A          290 TDDIFQGLTQDQGFYTSKDFLPLVAKSSKAGMC-ACHS-PLPSIRGAVIVLGAGDTAFDCATSALRCGARRVFLVFRKGF  367 (1025)
T ss_dssp             CCGGGTTCCTTTTEEEHHHHHHHHHHHHCBTTB-SCCC-CCCCCCSEEEEECSSHHHHHHHHHHHHTTCSEEEEECSSCG
T ss_pred             CCCCCCCCCCCCCEEEhHHHHHHHHhhcccccc-cccc-cccccCCcEEEECCChHHHHHHHHHHHcCCCEEEEEEecCh
Confidence            777655665567899999999887765444455 4443 12334567999999999999999999999877999999986


Q ss_pred             ccccCCHHHHHHHHhcCcEEecCCCceEEEccCCcEEEEEEEeecccCCCCeeccCCceEEEECCEEEEccccCcCChhH
Q psy16199        183 TNIRAVPEEVQLAWEEKCEFLPFMSPVQVDVKDNKIAGMQFNRTEQNEKGEWVEDEEQRIKLKANYIISAFGSTLLDNDV  262 (842)
Q Consensus       183 ~~~~~~~~~~~~~~~~gV~i~~~~~v~~v~~~~~~v~~V~~~~~~~~~~G~~~~~~g~~~~i~~D~Vi~a~G~~~~~~~l  262 (842)
                      ..++..+++++.+.++||++++++.++++..+++++++|++.+.+.+++|+++..+|++.++++|.||+|+|++|++..|
T Consensus       368 ~~~~~~~~e~~~~~~~Gv~~~~~~~~~~i~~~~g~v~~v~~~~~~~~~~g~~~~~~g~~~~i~aD~Vi~A~G~~~~~~~l  447 (1025)
T 1gte_A          368 VNIRAVPEEVELAKEEKCEFLPFLSPRKVIVKGGRIVAVQFVRTEQDETGKWNEDEDQIVHLKADVVISAFGSVLRDPKV  447 (1025)
T ss_dssp             GGCCSCHHHHHHHHHTTCEEECSEEEEEEEEETTEEEEEEEEEEEECTTSCEEEEEEEEEEEECSEEEECSCEECCCHHH
T ss_pred             hhCCCCHHHHHHHHHcCCEEEeCCCceEEEccCCeEEEEEEEEeEEcCCCCcccCCCceEEEECCEEEECCCCCCCchhh
Confidence            67888888888889999999999999999755788988988876667788877667777789999999999998677888


Q ss_pred             HhhcCCcccCCCCCeeeCCCCCCCCCCCeEEeccCCCCchhHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCCCceeec
Q psy16199        263 LEAIKPVKLDKYGYPEVNYTTMATSVPGVFCGGDTANLSDTTVESVNDGKTAAWHIHKYIQEKNNLTVPDKPCLPKFMSH  342 (842)
Q Consensus       263 ~~~l~gl~~~~~G~i~vd~~~~~Ts~~gVfa~GD~~~~~~~~~~A~~~G~~aA~~I~~~L~~~~~~~~~~~~~~p~~~t~  342 (842)
                      ...+.|++++++|+|.||+++++|+.|+|||+||++.++.+++.|+.||+.||.+|+++|+...+..+...+..|++|++
T Consensus       448 ~~~~~gl~~~~~G~I~vd~~~~~Ts~~~VfA~GD~~~~~~~~~~A~~~G~~aA~~i~~~L~~~~~~~~~~~~~~p~~~~e  527 (1025)
T 1gte_A          448 KEALSPIKFNRWDLPEVDPETMQTSEPWVFAGGDIVGMANTTVESVNDGKQASWYIHKYIQAQYGASVSAKPELPLFYTP  527 (1025)
T ss_dssp             HHHTTTSCBCTTSSBCCCTTTCBCSSTTEEECSGGGCSCCCHHHHHHHHHHHHHHHHHHHHHHTTCCCCSSCCBCCCCCG
T ss_pred             hhcccCceECCCCCEEECCCCCccCCCCEEEeCCCCCCchHHHHHHHHHHHHHHHHHHHHHhccCCCcccCcCccccccc
Confidence            87755899999999999966899999999999999988889999999999999999999986545555556788999999


Q ss_pred             cccccceeeecccccCCCcccccCCCCCcHHHHHHhhhcCCceEEEEeeccCCCcccccCcceecccccccccCCCCcce
Q psy16199        343 IDLVDISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPEQGSF  422 (842)
Q Consensus       343 i~~~~L~~~~~G~~~~nP~~~As~p~~~~~~~~~~a~~~G~g~vv~kt~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~  422 (842)
                      +++++++++++|++|.||+++|++++..+.+.+.++...|+|++++||++.++..++|++||+.+.+.+++.+||...+|
T Consensus       528 v~~v~ls~~~~G~~~~nPv~lAa~~~~~~~~~~~~~~~~g~G~vv~~t~~~~~~~~gn~~pr~~~~~~~g~~~~~~~~~~  607 (1025)
T 1gte_A          528 VDLVDISVEMAGLKFINPFGLASAAPTTSSSMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIVRGTTSGPMYGPGQSSF  607 (1025)
T ss_dssp             GGGCCCCEEETTEEESSSEEECSSGGGSSHHHHHHHHHHTCSEEECCCBCCGGGCCCCCSSCEEECCTTCSCCSSCCSCE
T ss_pred             cccccceeeeccccccCcccccCCCCCCCHHHHHHHHHCCcCeEEeceecccccccCCCCccEEeccccccccCCchhhe
Confidence            99999999999999999999999999999999999999999999999999887766899999998766778899988899


Q ss_pred             eeeEeecccchhhHHhhhhcCCCCcchhhhHHHHHHhhccccccCCcccccCCCCCCCCCChhHHHHhhhhhhCcccccc
Q psy16199        423 LNIELISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPKRQINTPVETILSVKDVIGQAVQRV  502 (842)
Q Consensus       423 ~n~e~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~g~dk~~~~~~~~~~~~l~~~~G~~~g~v  502 (842)
                      +|.|.+++..++.|.   ..              +..++                 .                       
T Consensus       608 ~n~e~~~~~~~~~~~---~~--------------i~~~~-----------------~-----------------------  630 (1025)
T 1gte_A          608 LNIELISEKTAAYWC---QS--------------VTELK-----------------A-----------------------  630 (1025)
T ss_dssp             EECCCSCSSCHHHHH---HH--------------HHHHH-----------------H-----------------------
T ss_pred             eeeccccchhHHHHH---HH--------------HHHHH-----------------h-----------------------
Confidence            999999999999887   43              33333                 1                       


Q ss_pred             ccCccCCCcceeEeeccCCccccCCccccCCCccchhhhhcCccccccccccccccccccccceEEEeccCCCHhHHHHH
Q psy16199        503 TNYTELDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLEL  582 (842)
Q Consensus       503 t~~~~~~n~~~~~~~~~~~~~in~~~c~~Gfn~~G~dai~~~~~~~~~~~~~~~~~~~~~~~pvi~si~~g~~~e~~~~~  582 (842)
                                       .                       .++                 .|+|+|++++.++++|.++
T Consensus       631 -----------------~-----------------------~~~-----------------~~~i~~i~~g~~~~~~~~~  653 (1025)
T 1gte_A          631 -----------------D-----------------------FPD-----------------NIVIASIMCSYNKNDWMEL  653 (1025)
T ss_dssp             -----------------H-----------------------CTT-----------------SEEEEEECCCSCHHHHHHH
T ss_pred             -----------------c-----------------------CCC-----------------CCeEEEecCCCCHHHHHHH
Confidence                             0                       111                 6899999888899999999


Q ss_pred             HHHHhhcCcCEEEEeccCCCCCCCCCCcccCCCCHHHHHHHHHHHHhhCCccEEEEecCChhcHHHHHHHHHHCCCCEEE
Q psy16199        583 SKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVS  662 (842)
Q Consensus       583 a~~~~~agaD~ielN~scP~~~~~~~~G~~~~~~~~~~~~ii~~v~~~~~~Pv~vKl~p~~~~~~~~a~~~~~~G~d~i~  662 (842)
                      +++++++|+|+||||++||+.+..+++|++++++++.+.++++++++.+++||+||++++++++.++|+.++++|+|+|+
T Consensus       654 a~~~~~~g~d~iein~~~P~~~~~~~~G~~~~~~~~~~~~iv~~v~~~~~~Pv~vK~~~~~~~~~~~a~~~~~~G~d~i~  733 (1025)
T 1gte_A          654 SRKAEASGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKLTPNVTDIVSIARAAKEGGADGVT  733 (1025)
T ss_dssp             HHHHHHTTCSEEEEECCCBCCCC-----SBGGGCHHHHHHHHHHHHHHCSSCEEEEECSCSSCHHHHHHHHHHHTCSEEE
T ss_pred             HHHHHhcCCCEEEEECCCCCCCCCCCcccccccCHHHHHHHHHHHHHhhCCceEEEeCCChHHHHHHHHHHHHcCCCEEE
Confidence            99999999999999999999888899999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCCccccCCCCCCCCCcccCCCccccCCCCCCccccchHHHHHHHHhhCCCCcEEEecCcCCHHHHHHHHHhCCCEE
Q psy16199        663 AINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAV  742 (842)
Q Consensus       663 v~nt~~~~~~~~~~~~~~p~~~~~~~~~~gG~sG~~~~p~al~~v~~i~~~~~~ipIi~~GGI~t~~da~~~l~~GA~~V  742 (842)
                      ++||+.+.+.++++.+++|.++.|+++..||+||++++|+++++++++++.++++|||++|||.|++|+.++|++||++|
T Consensus       734 v~Nt~~~~~~~~~~~~~~~~~~~~gr~~~gg~sg~~~~~~~~~~v~~v~~~~~~ipvi~~GGI~s~~da~~~l~~Ga~~v  813 (1025)
T 1gte_A          734 ATNTVSGLMGLKADGTPWPAVGAGKRTTYGGVSGTAIRPIALRAVTTIARALPGFPILATGGIDSAESGLQFLHSGASVL  813 (1025)
T ss_dssp             ECCCEEECCCBCTTSCBSSCBTTTTBBCCEEEESGGGHHHHHHHHHHHHHHSTTCCEEEESSCCSHHHHHHHHHTTCSEE
T ss_pred             EeccccccccccccccccccccccccccCCCCCcccchhHHHHHHHHHHHHcCCCCEEEecCcCCHHHHHHHHHcCCCEE
Confidence            99999999989988778888876778889999999999999999999999987799999999999999999999999999


Q ss_pred             EEehhhhccCchhHHHHHHHHHHHHHhcCC-CccccCCCCCCCccccCCCCCCcchhhccCCCCCchhhHHHHHHHHHHH
Q psy16199        743 QICSAVQNQDFTVVDDYITGLQTLLYLKST-QLKGWDGQSPPTPVHQKGKPAYQFRDKEGKAIPNFGEYKKIRENLITEL  821 (842)
Q Consensus       743 qv~ta~l~~gp~~~~~i~~~l~~~m~~~g~-~i~~~~~~~~~~~~~~~g~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~  821 (842)
                      ||+|++++++|.++.++.++|+.+|.+.|+ +++++.++..+...|.++++..++.+++|..++++.+|...|+..++.+
T Consensus       814 ~vg~~~l~~~~~~~~~~~~~l~~~l~~~G~~~i~~l~g~~~~~~~h~~~~pv~s~~~~~g~~~p~~~~~~~~r~~~~~~~  893 (1025)
T 1gte_A          814 QVCSAVQNQDFTVIQDYCTGLKALLYLKSIEELQGWDGQSPGTESHQKGKPVPRIAELMGKKLPNFGPYLEQRKKIIAEE  893 (1025)
T ss_dssp             EESHHHHTSCTTHHHHHHHHHHHHHHHTTCGGGTTSBTTBCCCCCEETTEECCCCTTTTTSCCCSSHHHHHHHHHHHHHH
T ss_pred             EEeeccccCCccHHHHHHHHHHHHHHHcCCCCHHHHhCCCcccccccccCcccchhhccCcccchhHHHHHHHHHHHHHH
Confidence            999999988899999999999999999999 9999999988889999999999999999999999999999887776654


Q ss_pred             Hh
Q psy16199        822 NL  823 (842)
Q Consensus       822 ~~  823 (842)
                      ..
T Consensus       894 ~~  895 (1025)
T 1gte_A          894 KM  895 (1025)
T ss_dssp             HH
T ss_pred             Hh
Confidence            44
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 842
d1gtea2312 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenas 2e-46
d1gtea2312 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenas 5e-21
d1gtea3153 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas 3e-34
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 3e-23
d1gtea5173 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogen 8e-23
d1gtea5 173 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogen 3e-14
d2b4ga1312 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Tr 4e-21
d2b4ga1312 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Tr 6e-15
d1juba_311 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactoco 1e-19
d1juba_311 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactoco 9e-14
d1f76a_336 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escheri 3e-18
d1f76a_336 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escheri 9e-04
d1tv5a1409 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase { 7e-18
d1tv5a1409 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase { 2e-09
d1ep3a_311 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactoco 2e-17
d1ep3a_311 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactoco 2e-12
d1d3ga_367 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human ( 1e-16
d1d3ga_367 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human ( 3e-07
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 2e-13
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 5e-12
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-09
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 4e-09
d1vcfa1310 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-i 4e-07
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 7e-07
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 2e-06
d2fdna_55 d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici 2e-06
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 3e-06
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 3e-06
d1blua_80 d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [T 2e-05
d1hfel285 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subun 2e-05
d2c42a5117 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoredu 5e-05
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 6e-05
d1ps9a2162 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t 9e-05
d1dura_55 d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus as 9e-05
d1jb0c_80 d.58.1.2 (C:) Photosystem I iron-sulfur protein Ps 1e-04
d1p0ka_329 c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomera 2e-04
d1xera_103 d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. 2e-04
d1rgva_80 d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [Ta 5e-04
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 5e-04
d1jnrb_149 d.58.1.5 (B:) Adenylylsulfate reductase B subunit 0.001
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 0.001
d1fxra_64 d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacte 0.001
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 0.002
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 0.003
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Dihydropyrimidine dehydrogenase, domain 4
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  166 bits (421), Expect = 2e-46
 Identities = 146/250 (58%), Positives = 175/250 (70%), Gaps = 9/250 (3%)

Query: 521 DMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWL 580
               +        ++             +A   D     +         IMC+YNK+DW+
Sbjct: 69  GPGQSSFLNIELISEKTAAYWCQSVTELKADFPDNIVIAS---------IMCSYNKNDWM 119

Query: 581 ELSKKTEKAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLT 640
           ELS+K E +GADALELNLSCPHGMGERGMGLACGQDPE+VRNI  WVR +V+IPFF KLT
Sbjct: 120 ELSRKAEASGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKLT 179

Query: 641 PNITNITDIAKAAYEGKADGVSAINTVSGLMSLSADGNPWPAVGTKKLTTYGGVSGNATR 700
           PN+T+I  IA+AA EG ADGV+A NTVSGLM L ADG PWPAVG  K TTYGGVSG A R
Sbjct: 180 PNVTDIVSIARAAKEGGADGVTATNTVSGLMGLKADGTPWPAVGAGKRTTYGGVSGTAIR 239

Query: 701 PMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSAVQNQDFTVVDDYI 760
           P+ L+AV++IA+  P FPIL  GGIDSA+  LQF+ +GA  +Q+CSAVQNQDFTV+ DY 
Sbjct: 240 PIALRAVTTIARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQDYC 299

Query: 761 TGLQTLLYLK 770
           TGL+ LLYLK
Sbjct: 300 TGLKALLYLK 309
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Length = 312 Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 312 Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 312 Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Length = 311 Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Length = 311 Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 336 Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 336 Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Length = 409 Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Length = 409 Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 311 Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 311 Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 367 Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 367 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Length = 55 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Length = 80 Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Length = 85 Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Length = 117 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Length = 55 Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Length = 80 Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Length = 329 Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Length = 103 Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Length = 80 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 149 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Length = 64 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query842
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 100.0
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 100.0
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 100.0
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 100.0
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 100.0
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 100.0
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 100.0
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 99.9
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 99.77
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.7
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.66
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 99.64
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 99.64
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.63
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.6
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.59
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.58
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 99.58
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.56
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.55
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.55
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 99.54
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.52
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.51
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 99.49
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.46
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 99.46
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.45
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.45
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.44
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.43
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.43
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.41
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.41
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 99.39
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.39
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.38
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.36
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.34
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 99.34
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.34
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.32
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 99.32
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.32
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.32
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 99.31
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.29
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.29
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.27
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.27
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.26
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.25
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.25
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.24
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 99.23
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.22
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.22
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.22
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.21
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.2
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.19
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.19
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.18
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.16
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 99.12
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.09
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 99.08
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.07
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 99.05
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 99.04
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.04
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.98
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.9
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.88
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 98.85
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 98.85
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 98.85
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.78
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 98.78
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.78
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.75
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 98.75
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 98.7
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 98.68
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.68
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 98.66
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.62
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 98.62
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 98.6
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 98.55
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.55
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.48
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.46
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.45
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 98.44
d1ofda2809 Alpha subunit of glutamate synthase, central and F 98.4
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.39
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 98.39
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.38
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 98.35
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.29
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.26
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.21
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 98.13
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 98.11
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 98.07
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.07
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 97.98
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 97.98
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 97.96
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 97.95
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 97.93
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.92
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 97.91
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 97.91
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 97.91
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 97.91
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.87
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 97.85
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 97.83
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 97.8
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.75
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.7
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 97.67
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 97.65
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 97.64
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 97.59
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.59
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.58
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.58
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.58
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.57
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 97.53
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.51
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 97.51
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 97.5
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.48
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 97.45
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.44
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 97.39
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 97.38
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 97.37
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 97.36
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.3
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 97.29
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 97.28
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.27
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 97.26
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 97.25
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 97.24
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 97.24
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.23
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 97.18
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.17
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 97.15
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 97.13
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 97.1
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.08
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 97.06
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 96.97
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 96.94
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 96.93
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 96.93
d1gtea5 173 Dihydropyrimidine dehydrogenase, C-terminal domain 96.89
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 96.89
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 96.89
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 96.83
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 96.83
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 96.82
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 96.81
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 96.71
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 96.68
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.66
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.65
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 96.51
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.5
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.26
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 96.14
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.11
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 96.11
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 96.06
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 96.04
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 95.97
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 95.78
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 95.74
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 95.64
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 95.62
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 95.5
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 95.49
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 95.49
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.38
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 95.28
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.28
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 95.24
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.21
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 95.2
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.15
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 95.14
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.09
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 95.04
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.98
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 94.98
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.9
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 94.84
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.81
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.77
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 94.69
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 94.61
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 94.54
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 94.4
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.36
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.27
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 94.26
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 94.2
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 94.19
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 94.18
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 94.08
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 94.0
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 93.99
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 93.86
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 93.86
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 93.8
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 93.73
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.7
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 93.53
d3bofa1260 Cobalamin-dependent methionine synthase MetH, C-te 93.52
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 93.5
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 93.47
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 93.41
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 93.38
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.3
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 93.2
d1geha1307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 92.99
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 92.97
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.84
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 92.84
d1wdda1325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 92.79
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 92.69
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 92.62
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 92.59
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 92.58
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 92.47
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 92.42
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.35
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 92.23
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 92.16
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 91.95
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 91.93
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 91.93
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 91.88
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 91.86
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.85
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 91.82
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 91.77
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 91.75
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 91.67
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 91.5
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.36
d1f6ya_262 Methyltetrahydrofolate: corrinoid/iron-sulfur prot 91.27
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 91.01
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 90.99
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 90.92
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 90.88
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 90.87
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 90.66
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.56
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 90.52
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 90.52
d2d69a1291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 90.47
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 90.36
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 90.35
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 90.32
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 90.3
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 90.29
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 90.27
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 90.03
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 89.95
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 89.84
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 89.82
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.79
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 89.73
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 89.72
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.71
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 89.53
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 89.43
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 89.1
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 88.99
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 88.98
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 88.97
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 88.79
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 88.63
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 88.35
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 88.23
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 88.12
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 87.65
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 87.58
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 87.52
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 87.18
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 87.14
d1qkka_140 Transcriptional regulatory protein DctD, receiver 86.94
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 86.92
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 86.87
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 86.78
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 86.62
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 86.24
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 86.18
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 86.15
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 86.14
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 86.11
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 85.9
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 85.56
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 85.51
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 85.11
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 85.04
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 84.99
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 84.92
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 84.89
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 84.59
d1nvma2289 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d 84.19
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 84.18
d1mb3a_123 Cell division response regulator DivK {Caulobacter 84.17
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 84.12
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 84.06
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 84.04
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 83.84
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 83.71
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 83.32
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 83.29
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 83.21
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 83.14
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 83.04
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 82.27
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 82.06
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 81.87
d1rqba2303 Transcarboxylase 5S subunit, N-terminal domain {Pr 81.87
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 81.31
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 81.16
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 80.94
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 80.31
d1id1a_153 Rck domain from putative potassium channel Kch {Es 80.26
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 80.09
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Dihydropyrimidine dehydrogenase, domain 4
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=2.8e-49  Score=428.39  Aligned_cols=311  Identities=72%  Similarity=1.178  Sum_probs=279.2

Q ss_pred             ceeeecccccCCCcccccCCCCCcHHHHHHhhhcCCceEEEEeeccCCCcccccCcceecccccccccCCCCcceeeeEe
Q psy16199        348 ISVEICGLKFPNPFGLASAPPTTASSMVRRAFENGWGFAVTKTFSLQKDMVTNVSPRIVKGTTSRHLYGPEQGSFLNIEL  427 (842)
Q Consensus       348 L~~~~~G~~~~nP~~~As~p~~~~~~~~~~a~~~G~g~vv~kt~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~n~e~  427 (842)
                      |+++++|++|+||+++||++++.+.+.++.+.+.|||++|+||++.++...+|++||+.+.......+.+...+++|.+.
T Consensus         1 Lsv~~~Gl~l~nPi~~Asg~~~~~~~~~~~~~~~G~G~vv~ktvt~~~~~~~n~~pr~~~~~~~~~~~~~~~~~~~n~~g   80 (312)
T d1gtea2           1 ISVEMAGLKFINPFGLASAAPTTSSSMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIVRGTTSGPMYGPGQSSFLNIEL   80 (312)
T ss_dssp             CCEEETTEEESSSEEECSSGGGSSHHHHHHHHHHTCSEEECCCBCCGGGCCCCCSSCEEECCTTCSCCSSCCSCEEECCC
T ss_pred             CcEEECCEEcCCCcEECCcCCCCCHHHHHHHHHcCCcEEEEeeecCCccccCCCCCcEEeccCCcccccccccccccccc
Confidence            57899999999999999999999999999999999999999999987666789999999887778888888899999999


Q ss_pred             ecccchhhHHhhhhcCCCCcchhhhHHHHHHhhccccccCCcccccCCCCCCCCCChhHHHHhhhhhhCccccccccCcc
Q psy16199        428 ISEKTAFIFFFLFQAIPNFGEYKKIRENLITELNLKKLNSDGVSLQNGLPKRQINTPVETILSVKDVIGQAVQRVTNYTE  507 (842)
Q Consensus       428 ~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~g~dk~~~~~~~~~~~~l~~~~G~~~g~vt~~~~  507 (842)
                      ++.+..++|+   +.              +..++                 .                            
T Consensus        81 ~~~~g~~~~~---~~--------------i~~~~-----------------~----------------------------   98 (312)
T d1gtea2          81 ISEKTAAYWC---QS--------------VTELK-----------------A----------------------------   98 (312)
T ss_dssp             SCSSCHHHHH---HH--------------HHHHH-----------------H----------------------------
T ss_pred             ccccchhhhh---hh--------------hcccc-----------------c----------------------------
Confidence            9999999998   54              44443                 1                            


Q ss_pred             CCCcceeEeeccCCccccCCccccCCCccchhhhhcCccccccccccccccccccccceEEEeccCCCHhHHHHHHHHHh
Q psy16199        508 LDNKKQVVALINDDMCINCGKCYMACNDSGYQAITFHPETHQAHVTDECTGCTLCLSILIASIMCTYNKDDWLELSKKTE  587 (842)
Q Consensus       508 ~~n~~~~~~~~~~~~~in~~~c~~Gfn~~G~dai~~~~~~~~~~~~~~~~~~~~~~~pvi~si~~g~~~e~~~~~a~~~~  587 (842)
                                  .                       ++.                 .++++++..+.+.++|.++++.++
T Consensus        99 ------------~-----------------------~~~-----------------~~~~~~~~~~~~~~d~~~~a~~~~  126 (312)
T d1gtea2          99 ------------D-----------------------FPD-----------------NIVIASIMCSYNKNDWMELSRKAE  126 (312)
T ss_dssp             ------------H-----------------------CTT-----------------SEEEEEECCCSCHHHHHHHHHHHH
T ss_pred             ------------c-----------------------ccc-----------------cccccccccccchhHHHHHHHHhc
Confidence                        0                       111                 466777767889999999999999


Q ss_pred             hcCcCEEEEeccCCCCCCCCCCcccCCCCHHHHHHHHHHHHhhCCccEEEEecCChhcHHHHHHHHHHCCCCEEEEecCC
Q psy16199        588 KAGADALELNLSCPHGMGERGMGLACGQDPEMVRNISLWVRSSVKIPFFVKLTPNITNITDIAKAAYEGKADGVSAINTV  667 (842)
Q Consensus       588 ~agaD~ielN~scP~~~~~~~~G~~~~~~~~~~~~ii~~v~~~~~~Pv~vKl~p~~~~~~~~a~~~~~~G~d~i~v~nt~  667 (842)
                      ++|||+||+|+||||+...+++|..++++++.+.++++++++.+++||++|++|++++..+++++++++|+++|+++||+
T Consensus       127 ~~gad~lelN~scPn~~~~~~~~~~~~~~~~~~~~i~~~v~~~~~~pv~vKl~~~~~~~~~i~~~~~~~g~~gi~~~n~~  206 (312)
T d1gtea2         127 ASGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKLTPNVTDIVSIARAAKEGGADGVTATNTV  206 (312)
T ss_dssp             HTTCSEEEEECCCBCCCC-----SBGGGCHHHHHHHHHHHHHHCSSCEEEEECSCSSCHHHHHHHHHHHTCSEEEECCCE
T ss_pred             cCCCCeEeeccCCCCcccccccchhhhhhHHHHHHHHHHHhhccCCceeecccccchhHHHHHHHHHHhcccceEEEeec
Confidence            99999999999999999888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCCCCCCCCCcccCCCccccCCCCCCccccchHHHHHHHHhhCCCCcEEEecCcCCHHHHHHHHHhCCCEEEEehh
Q psy16199        668 SGLMSLSADGNPWPAVGTKKLTTYGGVSGNATRPMGLKAVSSIAKMFPNFPILGIGGIDSADVALQFIQAGAHAVQICSA  747 (842)
Q Consensus       668 ~~~~~~~~~~~~~p~~~~~~~~~~gG~sG~~~~p~al~~v~~i~~~~~~ipIi~~GGI~t~~da~~~l~~GA~~Vqv~ta  747 (842)
                      .+...++.+..+.+.++...+...||+||++++|+++++|+++++.++++|||++|||.|++|+.++|++|||+|||||+
T Consensus       207 ~~~~~~~~~~~~~~~~~~~~~~~~gg~sG~~i~~~al~~v~~~~~~~~~ipIi~~GGI~~~~d~~~~l~aGA~~Vqv~ta  286 (312)
T d1gtea2         207 SGLMGLKADGTPWPAVGAGKRTTYGGVSGTAIRPIALRAVTTIARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSA  286 (312)
T ss_dssp             EECCCBCTTSCBSSCBTTTTBBCCEEEESGGGHHHHHHHHHHHHHHSTTCCEEEESSCCSHHHHHHHHHTTCSEEEESHH
T ss_pred             ccccccccccccccccccccccccccccCcCcchhhHHHHHHHHHHcCCCcEEEEcCCCCHHHHHHHHHcCCCeeEECHh
Confidence            98888888777777776666778999999999999999999999999789999999999999999999999999999999


Q ss_pred             hhccCchhHHHHHHHHHHHHHhcCC
Q psy16199        748 VQNQDFTVVDDYITGLQTLLYLKST  772 (842)
Q Consensus       748 ~l~~gp~~~~~i~~~l~~~m~~~g~  772 (842)
                      ++++||.++++|+++|++||+++|+
T Consensus       287 ~~~~G~~~i~~i~~~L~~~m~~~g~  311 (312)
T d1gtea2         287 VQNQDFTVIQDYCTGLKALLYLKSI  311 (312)
T ss_dssp             HHTSCTTHHHHHHHHHHHHHHHTTC
T ss_pred             hhccChHHHHHHHHHHHHHHHHcCC
Confidence            9999999999999999999999876
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure