Psyllid ID: psy2064
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 221 | ||||||
| 403182344 | 3468 | AAEL000246-PA [Aedes aegypti] | 0.742 | 0.047 | 0.573 | 9e-61 | |
| 157123386 | 3478 | cadherin [Aedes aegypti] | 0.742 | 0.047 | 0.573 | 1e-60 | |
| 170064482 | 3396 | neural-cadherin [Culex quinquefasciatus] | 0.742 | 0.048 | 0.560 | 2e-59 | |
| 198460509 | 3592 | GA11265 [Drosophila pseudoobscura pseudo | 0.742 | 0.045 | 0.556 | 8e-58 | |
| 195429581 | 3590 | GK19483 [Drosophila willistoni] gi|19415 | 0.742 | 0.045 | 0.556 | 1e-57 | |
| 195153499 | 2716 | GL17301 [Drosophila persimilis] gi|19411 | 0.742 | 0.060 | 0.556 | 1e-57 | |
| 194757998 | 3584 | GF13772 [Drosophila ananassae] gi|190622 | 0.742 | 0.045 | 0.556 | 2e-57 | |
| 195582246 | 3463 | GD10750 [Drosophila simulans] gi|1941929 | 0.742 | 0.047 | 0.551 | 4e-57 | |
| 194884197 | 3582 | GG20142 [Drosophila erecta] gi|190659369 | 0.742 | 0.045 | 0.551 | 4e-57 | |
| 6049492 | 3579 | starry night protein [Drosophila melanog | 0.742 | 0.045 | 0.551 | 4e-57 |
| >gi|403182344|gb|EAT48765.2| AAEL000246-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 239 bits (609), Expect = 9e-61, Method: Compositional matrix adjust.
Identities = 128/223 (57%), Positives = 145/223 (65%), Gaps = 59/223 (26%)
Query: 1 MLFNSITVRLDDMTKEAFLSPLLNFFMDGLAAIIPCPRENIYLFSIQDDTDVTSRILNVS 60
MLFNS+T+RLD+MT+EAFLSPLLNFF+DGLAAIIPCP+ENIYLFSIQDDTDV+SRILNVS
Sbjct: 1320 MLFNSVTIRLDEMTEEAFLSPLLNFFLDGLAAIIPCPKENIYLFSIQDDTDVSSRILNVS 1379
Query: 61 FSARASDGTF---YPPQFLQERVYLNRGILARLATVQERVYLNRGILARLATVQSATLSI 117
FSAR D F Y PQ+LQERVYL NR ILARLATVQ
Sbjct: 1380 FSARRPDVAFEEYYSPQYLQERVYL-----------------NRAILARLATVQ------ 1416
Query: 118 DECDTELVVRHGSTLGTFCANTSSYVLDSKEVEVLPFDDNLCVQEPCLNYEQCVTVLKFG 177
VLPFDDNLCV+EPCLNYEQC++VLKFG
Sbjct: 1417 ---------------------------------VLPFDDNLCVREPCLNYEQCISVLKFG 1443
Query: 178 NASGFVASDSVLFRPIYPVSTFACVHPDKFYDGLDSILTTSNV 220
NASGF+ SD+VLFRPIYPV+TFAC P+ F + L + V
Sbjct: 1444 NASGFIHSDTVLFRPIYPVNTFACKCPEGFTGSKEHYLCDTEV 1486
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157123386|ref|XP_001660147.1| cadherin [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170064482|ref|XP_001867543.1| neural-cadherin [Culex quinquefasciatus] gi|167881873|gb|EDS45256.1| neural-cadherin [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|198460509|ref|XP_001361746.2| GA11265 [Drosophila pseudoobscura pseudoobscura] gi|198137039|gb|EAL26325.2| GA11265 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195429581|ref|XP_002062836.1| GK19483 [Drosophila willistoni] gi|194158921|gb|EDW73822.1| GK19483 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195153499|ref|XP_002017663.1| GL17301 [Drosophila persimilis] gi|194113459|gb|EDW35502.1| GL17301 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|194757998|ref|XP_001961249.1| GF13772 [Drosophila ananassae] gi|190622547|gb|EDV38071.1| GF13772 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195582246|ref|XP_002080939.1| GD10750 [Drosophila simulans] gi|194192948|gb|EDX06524.1| GD10750 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|194884197|ref|XP_001976182.1| GG20142 [Drosophila erecta] gi|190659369|gb|EDV56582.1| GG20142 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|6049492|gb|AAF02618.1|AF172329_1 starry night protein [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 221 | ||||||
| UNIPROTKB|H0Y7R9 | 772 | CELSR1 "Cadherin EGF LAG seven | 0.416 | 0.119 | 0.494 | 9.4e-36 | |
| FB|FBgn0024836 | 3579 | stan "starry night" [Drosophil | 0.746 | 0.046 | 0.510 | 2.2e-35 | |
| UNIPROTKB|C9JDM9 | 1397 | CELSR1 "Cadherin EGF LAG seven | 0.416 | 0.065 | 0.494 | 5.4e-35 | |
| UNIPROTKB|J9P5A2 | 2668 | CELSR1 "Uncharacterized protei | 0.416 | 0.034 | 0.494 | 9.8e-35 | |
| ZFIN|ZDB-GENE-030616-78 | 2699 | celsr1a "cadherin EGF LAG seve | 0.416 | 0.034 | 0.484 | 1e-34 | |
| UNIPROTKB|F1PLY1 | 2725 | CELSR1 "Uncharacterized protei | 0.416 | 0.033 | 0.494 | 1e-34 | |
| MGI|MGI:1100883 | 3034 | Celsr1 "cadherin, EGF LAG seve | 0.411 | 0.029 | 0.510 | 1.7e-34 | |
| UNIPROTKB|Q9NYQ6 | 3014 | CELSR1 "Cadherin EGF LAG seven | 0.416 | 0.030 | 0.494 | 3.4e-34 | |
| UNIPROTKB|F1MAS4 | 3064 | F1MAS4 "Uncharacterized protei | 0.411 | 0.029 | 0.5 | 4.5e-34 | |
| MGI|MGI:1858236 | 3301 | Celsr3 "cadherin, EGF LAG seve | 0.398 | 0.026 | 0.463 | 9.7e-31 |
| UNIPROTKB|H0Y7R9 CELSR1 "Cadherin EGF LAG seven-pass G-type receptor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 246 (91.7 bits), Expect = 9.4e-36, Sum P(2) = 9.4e-36
Identities = 47/95 (49%), Positives = 74/95 (77%)
Query: 1 MLFNSITVRLDDMTKEAFLSPLLNFFMDGLAAIIPCPRENIYLFSIQDDTDVTSRILNVS 60
ML NSITVRL++M++E FLSPLL F++G+AA++ ++++++F++Q+DTDV+S ILNV+
Sbjct: 577 MLTNSITVRLENMSQEKFLSPLLALFVEGVAAVLSTTKDDVFVFNVQNDTDVSSNILNVT 636
Query: 61 FSARASDGT---FYPPQFLQERVYLNRGILARLAT 92
FSA G F+P + LQE++YLNR +L ++T
Sbjct: 637 FSALLPGGVRGQFFPSEDLQEQIYLNRTLLTTIST 671
|
|
| FB|FBgn0024836 stan "starry night" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JDM9 CELSR1 "Cadherin EGF LAG seven-pass G-type receptor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P5A2 CELSR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030616-78 celsr1a "cadherin EGF LAG seven-pass G-type receptor 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PLY1 CELSR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1100883 Celsr1 "cadherin, EGF LAG seven-pass G-type receptor 1 (flamingo homolog, Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NYQ6 CELSR1 "Cadherin EGF LAG seven-pass G-type receptor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MAS4 F1MAS4 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858236 Celsr3 "cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 221 | |||
| KOG4289|consensus | 2531 | 99.97 | ||
| KOG1219|consensus | 4289 | 99.89 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 98.71 | |
| KOG1219|consensus | 4289 | 98.52 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 98.04 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.94 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 97.75 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 97.56 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 97.25 | |
| KOG4289|consensus | 2531 | 97.1 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 97.03 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 96.89 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 95.99 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 95.75 | |
| KOG3516|consensus | 1306 | 94.29 | ||
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 93.3 | |
| KOG3514|consensus | 1591 | 93.28 | ||
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 92.92 | |
| KOG3516|consensus | 1306 | 92.91 | ||
| KOG1217|consensus | 487 | 90.73 | ||
| PF11548 | 91 | Receptor_IA-2: Protein-tyrosine phosphatase recept | 89.56 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 89.26 | |
| PF09064 | 34 | Tme5_EGF_like: Thrombomodulin like fifth domain, E | 88.62 | |
| PF00954 | 110 | S_locus_glycop: S-locus glycoprotein family; Inter | 87.89 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 83.02 | |
| PF01683 | 52 | EB: EB module; InterPro: IPR006149 The EB domain h | 80.39 | |
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 80.01 |
| >KOG4289|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.1e-31 Score=268.90 Aligned_cols=157 Identities=49% Similarity=0.875 Sum_probs=142.3
Q ss_pred CCcceEEEEecCCChhhhhHHHHHHHHHHHHhhCCCCCCcEEEEEeeecCCCCCCeeEEEEEEEc-CCCCcCChHHHHHH
Q psy2064 1 MLFNSITVRLDDMTKEAFLSPLLNFFMDGLAAIIPCPRENIYLFSIQDDTDVTSRILNVSFSARA-SDGTFYPPQFLQER 79 (221)
Q Consensus 1 ml~nSvtiR~~~~t~EeFl~~~~~~f~~~La~~l~~~~~~V~IfSvq~~~~~~~~~lDV~fav~~-s~~~y~~p~~l~~~ 79 (221)
||.||+|+||++|++|+||++.+.+|++++|.++++++++|+||.||+++++.+ .|+|.|++++ ..++|++.|.|+++
T Consensus 1084 ~Lt~S~TlrLe~Ms~e~FlsPLl~rF~eavaa~l~t~p~dv~vfnvq~dtD~~~-ilNvs~s~~~rgvrgw~~sE~lqE~ 1162 (2531)
T KOG4289|consen 1084 MLTNSITLRLENMSQERFLSPLLGRFREAVAAVLATPPDDVFVFNVQNDTDVVG-ILNVSFSALGRGVRGWFPSEDLQEQ 1162 (2531)
T ss_pred HhccceEeEhhhcCHhHhhhHHHHHHHHHHHHHhcCCcccEEEEeccccCCcce-EEEEEEeccCCcccccccHHHHHHH
Confidence 799999999999999999999999999999999999999999999999887655 9999999986 23479999999999
Q ss_pred HHHhHHHHHhhhhhhHHHhhhhhhhhhhhcceeeeeeccccccceeeecCCccceeeecccceeecCcceeecCCCCCCC
Q psy2064 80 VYLNRGILARLATVQERVYLNRGILARLATVQSATLSIDECDTELVVRHGSTLGTFCANTSSYVLDSKEVEVLPFDDNLC 159 (221)
Q Consensus 80 l~~~r~~L~~~~~~~~~~~~~~~~~e~~lg~~i~~v~~deC~~~~~~~~~s~~~~~~~~~~s~v~~~~~~~v~p~~~~~C 159 (221)
||. |+.++.+ .|+||.+|.|
T Consensus 1163 iy~----L~~~sll--------------------------------------------------------~VlpfdDniC 1182 (2531)
T KOG4289|consen 1163 IYL----LTAISLL--------------------------------------------------------RVLPFDDNIC 1182 (2531)
T ss_pred HHH----HHHhhhe--------------------------------------------------------eeeeccCchh
Confidence 987 4332222 6788999999
Q ss_pred CCCCCCCCcEEccceeccCCCccccccceeeeccCCCCcceeeCCCCCCCCCcc--cc-ccc
Q psy2064 160 VQEPCLNYEQCVTVLKFGNASGFVASDSVLFRPIYPVSTFACVHPDKFYDGLDS--IL-TTS 218 (221)
Q Consensus 160 ~~~PC~ngg~Cv~~~~~~~~~~~~~s~~~~f~~~~~~~~y~C~CP~Gf~G~~~~--~~-~~~ 218 (221)
.++||.|++.|++++||..+.+|++|+++|||||+|+++++|+||+||||.+|+ |+ |-+
T Consensus 1183 lrEPCenymkCvsvlrFdssapf~~s~s~lfRpi~pvnglrCrCPpGFTgd~CeTeiDlCYs 1244 (2531)
T KOG4289|consen 1183 LREPCENYMKCVSVLRFDSSAPFLASDSVLFRPIHPVNGLRCRCPPGFTGDYCETEIDLCYS 1244 (2531)
T ss_pred hcchhHHHHhhhhheeecccCccccccceeeeeccccCceeEeCCCCCCcccccchhHhhhc
Confidence 999999999999999999999999999999999999999999999999999998 54 543
|
|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF11548 Receptor_IA-2: Protein-tyrosine phosphatase receptor IA-2; InterPro: IPR021613 IA-2 is a protein-tyrosine phosphatase receptor that upon exocytosis, the cytoplasmic domain is cleaved and moves to the nucleus where it enhances transcription of the insulin gene | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet | Back alignment and domain information |
|---|
| >PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 221 | |||
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.93 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.92 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.73 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.68 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.67 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.62 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 98.51 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 98.43 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.43 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 98.32 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 98.31 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.99 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.96 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.95 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 97.91 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 97.89 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 97.85 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.81 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.77 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.74 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 97.73 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 97.72 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 97.65 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.62 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 97.62 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 97.59 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.59 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 97.55 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 97.5 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 97.49 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 97.43 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 97.41 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 97.24 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.14 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.07 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 96.96 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 96.93 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 96.93 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 96.9 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 96.88 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 96.86 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 96.81 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 96.65 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.48 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 96.27 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 96.17 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 96.13 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 96.11 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 96.11 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 96.11 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 95.99 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 95.65 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 95.61 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 95.59 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 95.58 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 95.5 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 95.06 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 94.95 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 94.94 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 94.84 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 94.83 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 94.65 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 94.63 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 94.35 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 94.12 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 93.9 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 93.9 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 93.87 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 93.79 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 93.39 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 93.19 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 92.8 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 92.8 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 92.45 | |
| 4hti_A | 99 | Receptor-type tyrosine-protein phosphatase N2; pho | 92.38 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 92.01 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 91.72 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 91.26 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 91.25 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 90.98 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 90.69 | |
| 2qt7_A | 91 | Receptor-type tyrosine-protein phosphatase-like N; | 90.23 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 89.25 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 89.0 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 87.7 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 84.97 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 84.83 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 82.24 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 81.92 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 81.83 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 81.03 |
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
Probab=98.93 E-value=8.6e-10 Score=69.35 Aligned_cols=38 Identities=26% Similarity=0.576 Sum_probs=33.0
Q ss_pred CCCCCCCCCCCCCcEEccceeccCCCccccccceeeeccCCCCcceeeCCCCCCCCCccc
Q psy2064 155 DDNLCVQEPCLNYEQCVTVLKFGNASGFVASDSVLFRPIYPVSTFACVHPDKFYDGLDSI 214 (221)
Q Consensus 155 ~~~~C~~~PC~ngg~Cv~~~~~~~~~~~~~s~~~~f~~~~~~~~y~C~CP~Gf~G~~~~~ 214 (221)
+.+.|..+||.|+|+|+.. ..+|.|.||+||+|++|++
T Consensus 2 d~d~C~~~pC~ngg~C~~~----------------------~~~~~C~C~~G~~G~~Ce~ 39 (39)
T 1edm_B 2 DGDQCESNPCLNGGSCKDD----------------------INSYECWCPFGFEGKNCEL 39 (39)
T ss_dssp CCCTTTTCCCCTTCEEEEE----------------------TTEEEEECCTTCCSTTSCC
T ss_pred ccccCCCCCCCCCCEeEcC----------------------CCceEeECCCCCcCCccCC
Confidence 3478999999999999875 3589999999999999864
|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >4hti_A Receptor-type tyrosine-protein phosphatase N2; phogrin, IA-2BETA, protein-tyrosine phosphatase, transmembra protein, diabetes, autoimmunity; 1.95A {Homo sapiens} PDB: 4htj_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >2qt7_A Receptor-type tyrosine-protein phosphatase-like N; IA-2, ICA-512, protein-tyrosine phosphatase, transmembrane protein, diabetes, autoimmunity; 1.30A {Homo sapiens} PDB: 3n01_A 3np5_A 3ng8_A 3n4w_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 221 | |||
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.23 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 99.21 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 99.19 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 99.16 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 99.08 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 99.08 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.96 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.96 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.95 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.95 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.92 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.76 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 98.73 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 98.62 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 98.62 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 98.49 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 97.93 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 97.9 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 97.86 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 97.24 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.18 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.04 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.85 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.21 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 95.97 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.8 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.77 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.07 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 94.92 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 94.73 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 94.4 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 93.87 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 93.79 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 93.65 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 93.23 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 81.85 |
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Neurogenic locus notch homolog protein 1, Notch1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.23 E-value=2.3e-12 Score=81.11 Aligned_cols=38 Identities=26% Similarity=0.558 Sum_probs=34.6
Q ss_pred CCCCCCCCCCCcEEccceeccCCCccccccceeeeccCCCCcceeeCCCCCCCCCccccc
Q psy2064 157 NLCVQEPCLNYEQCVTVLKFGNASGFVASDSVLFRPIYPVSTFACVHPDKFYDGLDSILT 216 (221)
Q Consensus 157 ~~C~~~PC~ngg~Cv~~~~~~~~~~~~~s~~~~f~~~~~~~~y~C~CP~Gf~G~~~~~~~ 216 (221)
+.|.++||.|+|+|++. ..+|+|+||+||+|++|+++|
T Consensus 2 d~C~~~PC~n~g~C~~~----------------------~~~y~C~C~~G~~G~~Ce~dT 39 (39)
T d2vj3a2 2 NECVSNPCQNDATCLDQ----------------------IGEFQCICMPGYEGVHCEVNT 39 (39)
T ss_dssp CTTTTCCCCSSCEEEEC----------------------SSCEEEECCTTEESSSSCEEC
T ss_pred cCCcCCCCCCCCEEECC----------------------CCCEEEeCCCCCccCcCeeCc
Confidence 78999999999999975 468999999999999999875
|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|