Psyllid ID: psy2378

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950------
MNMINSKYNKRKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLKLDMMTKKNNSSFGTNFTVSIEAANGVTTGISASDRAHTIKVASSKKAKPSDIVQPGHIFPLQAKKGGVLIRGGHTEAGCDLTKLAGLTPSAVICEILNDDGTMARAQEKNILHISVPGALEIPLALKNIIQIKKFNVLIAIGVIIRGETYHFELIANETISNIMQISIKNNIPIINAILTTETIEQANSRILTKGEIIIFINHKNKSLVNLIKNKTPRHRAREFALQGIYQWLFNNMDVNLIETYIKEISNFYKVDKKYFYLILRGVINDINFLRYDLSLIIDRSINELSSIEYVVLLIGTYELKSHYKIPYKVIINEAIELVKSFGNIDEKKYLEALLIDVELSLPIILNRKIHTIFIGGGTPSLISDTGLDYLLKNIKKLLLFKKNISITLEANPSTFEIEKFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLDLIYALPNQTLSELMLDLNYAIQYSPPHLSLYSLTIEPNTYFFKYPPLSMPSNDENAVMQDKITSLLKNNYYKNYEISAYSKTGYESQHNLNYWKFGDYLGNSIAKSKKIEKKCLIFEFMLNALRLKDGFSPNLFFERTGINIKIIESKLKNAEKLGLLKRNNKNIKPTSFGRYFLNDLQQIFLNN
cccccccccccccEEccccccccHHHHHHHHHHcccccEEEcccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHccccccccccccccHHHccccccEEccccccHHHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHHHHccccEEEEEHHHHHHcccccccccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHcccccEEEEcHHHccccccHHHHHHHHHccccccccccHHHHHHccHHHHHHcccccccccccccccHHHHHHHHHHHHccccccHHHHHHccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHccccccccccccccccccccccccEEEEcccccccccHHHHcccccccEEEEEEcccccHHHHHHHHHccccccccccHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEHHHHHcccccEEEccEEEEEEEcccHHHHHHHHcccccHHHHHHHHHcHHHHHcccccHHHHHHHHHHHcccccccccEEEEEEHHHHcccccccccccEEEEcccccccccEEEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccHHHHHHHHHHHHHHcccccccEEEEccccccHHHHcccHHHHccccEEEEEEccccHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHHHHHHHcc
cccEcccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccHHHHHHHHHHHHHcccccEEcccccccccccccHHHHHHcccHcHHHHHHHHHHccEEEEEEEEEEEEEcccccccHHHHHcccccccccHHHHHHHHHHHHHHccHHHcccccEEEEEEHEccHHccccEEEEEcccccccHEEEEEHHHHcccHccHHHcccccccccccccccccccccccccEEEEEEEccccccccEEEEEEHHHccHHHHHHHHHHEccccEEEEcHHHHHHccccEccccccccccccEEccEEEcccccccccHHHHHHHHHHHHcccccHHHEEEEEEEEEEEccccHHHccccHHHHHHHHHHHcccccEEEEEEEEEcccHHHHHcHHHEEEEEEccHHHHHHHHHHHHHcccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHcEEEccEEEEEEEccccHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcHHHEEcccccccccHHHHHHHccccccEEEEEcccHHcccccccccHccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHccccEEEEEEEcccHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHccccccHHHHHHHHHHHHHcccccEEEEEEEEccccEEccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEccccEEEEcccccccccccccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHccccEEccccEEEcHHHHHHHHHHHHHHHcc
mnminskynkrkisiapmmnltDRHCRMFHRQITRYSWLYTEMFTTQAilgnkkhcldfnaeehpiafqvgdnepkKLAKSAKIIQKWgydeinlncgcpsnrvqngFFGAILMTKPLLVSDCIKAMRDSVEIDITVkhrigiddinsyDFVRDFVGTVSSAGCRTFIVHARNAFLKklnpkqnrkipilkynfvynlkkdfpeleIIINGGIKTKKEIDLHLNYIDGVMLGreayknpflmsnfdlnyysnlpqykiptridiinldsenrenegdiilssdfvtpnaINFMSKYARGLICMTLTEKHCIQLKLDMmtkknnssfgtnFTVSIEAangvttgisasdrahtikvasskkakpsdivqpghifplqakkggvlirgghteagcdltklagltpSAVICEILNDDGTMARAQEKNilhisvpgaleIPLALKNIIQIKKFNVLIAIGVIirgetyhfELIANETISNIMQISIKNNIPIINAILTTETIEQANSRILTKGEIIIFINHKNKSLVNLIKNKTPRHRAREFALQGIYQWLFNNMDVNLIETYIKEISNFYKVDKKYFYLILRGVINDINFLRYDLSLIIDRSINELSSIEYVVLLIGTYelkshykipYKVIINEAIELVKSFGNIDEKKYLEALLIDVELSLPIILNRKIHTIfigggtpslisdtGLDYLLKNIKKLLLFKKNisitleanpstfeiekFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLdliyalpnqTLSELMLDLNYaiqyspphlslysltiepntyffkypplsmpsndenaVMQDKITSLLknnyyknyeisaysktgyesqhNLNYWKFGDYLGNSIAKSKKIEKKCLIFEFMLNAlrlkdgfspnlffertgINIKIIESKLKNAEKLGLlkrnnknikptsfgrYFLNDLQQIFLNN
mnminskynkrkisiapmmnlTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIafqvgdnepkKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIditvkhrigiddinSYDFVRDFVGTVSSAGCRTFIVHARNaflkklnpkqnrkipiLKYNFVYNLKKDFPELEIIINggiktkkeiDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINLDSENRENEGDiilssdfvtpNAINFMSKYARGLICMTLTEKHCIQLKLDMMTKKNNSSFGTNFTVSIEAANGVttgisasdrAHTIKVAsskkakpsdivqpgHIFPLQAKKGGVLIRGGHTEAGCDLTKLAGLTPSAVICEILNDDGTMARAQEKNILHISVPGALEIPLALKNIIQIKKFNVLIAIGVIIRGETYHFELIANETISNIMQISIKNNIPIINAILTTETIEQANSRILTKGEIIIFINHKNKSLVNLIKNKTPRHRAREFALQGIYQWLFNNMDVNLIETYIKEISNFYKVDKKYFYLILRGVINDINFLRYDLSLIIDRSINELSSIEYVVLLIGTYELKSHYKIPYKVIINEAIELVKSFGNIDEKKYLEALLIDVELSLPIILNRKIHTIFIGGGTPSLISDTGLDYLLKNIKKLLLFKKNISITLEANPSTFEIEKFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLDLIYALPNQTLSELMLDLNYAIQYSPPHLSLYSLTIEPNTYFFKYPPLSMPSNDENAVMQDKITSLLKNNYYKNYEISAYSKTGYESQHNLNYWKFGDYLGNSIAKSKKIEKKCLIFEFMLNALRLKDGFSPNLFFERTGINIKIIESKLKNaeklgllkrnnknikptsfgryflNDLQQIFLNN
MNMINSKYNKRKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLKLDMMTKKNNSSFGTNFTVSIEAANGVTTGISASDRAHTIKVASSKKAKPSDIVQPGHIFPLQAKKGGVLIRGGHTEAGCDLTKLAGLTPSAVICEILNDDGTMARAQEKNILHISVPGALEIPLALKNIIQIKKFNVLIAIGVIIRGETYHFELIANETISNIMQISIKNNIPIINAILTTETIEQANSRILTKGEIIIFINHKNKSLVNLIKNKTPRHRAREFALQGIYQWLFNNMDVNLIETYIKEISNFYKVDKKYFYLILRGVINDINFLRYDLSLIIDRSINELSSIEYVVLLIGTYELKSHYKIPYKVIINEAIELVKSFGNIDEKKYLEALLIDVELSLPIILNRKIHTIFIGGGTPSLISDTGLDYllknikklllfkkniSITLEANPSTFEIEKFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLDLIYALPNQTLSELMLDLNYAIQYSPPHLSLYSLTIEPNTYFFKYPPLSMPSNDENAVMQDKITSLLKNNYYKNYEISAYSKTGYESQHNLNYWKFGDYLGNSIAKSKKIEKKCLIFEFMLNALRLKDGFSPNLFFERTGINIKIIESKLKNAEKLGLLKRNNKNIKPTSFGRYFLNDLQQIFLNN
************ISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLKLDMMTKKNNSSFGTNFTVSIEAANGVTTGI*********************IVQPGHIFPLQAKKGGVLIRGGHTEAGCDLTKLAGLTPSAVICEILNDDGTMARAQEKNILHISVPGALEIPLALKNIIQIKKFNVLIAIGVIIRGETYHFELIANETISNIMQISIKNNIPIINAILTTETIEQANSRILTKGEIIIFINHKNKSLVNLIKNKTPRHRAREFALQGIYQWLFNNMDVNLIETYIKEISNFYKVDKKYFYLILRGVINDINFLRYDLSLIIDRSINELSSIEYVVLLIGTYELKSHYKIPYKVIINEAIELVKSFGNIDEKKYLEALLIDVELSLPIILNRKIHTIFIGGGTPSLISDTGLDYLLKNIKKLLLFKKNISITLEANPSTFEIEKFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLDLIYALPNQTLSELMLDLNYAIQYSPPHLSLYSLTIEPNTYFFKYPPL*********VMQDKITSLLKNNYYKNYEISAYSKTGYESQHNLNYWKFGDYLGNSIAKSKKIEKKCLIFEFMLNALRLKDGFSPNLFFERTGINIKIIESKLKNAEKLGLLKRNNKNIKPTSFGRYFLNDLQQIFL**
*************SIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLK************GTNFTVSIEAANGVTTGISAS*******************VQPGHIFPLQAKKGGVLIRGGHTEAGCDLTKLAGLTPSAVICEILNDDGT*********LHISVPGALEIPLALKNIIQIKKFNVLIAIGVIIRGETYHFELIANETISNIMQISIKNNIPIINAILTTETIEQANSRILTKGEIIIFINHKNKSLVNLIKNKTPRHRAREFALQGIYQWLFNNMDVNLIETYIKEISNFYKVDKKYFYLILRGVINDINFLRYDLSLIIDRSINELSSIEYVVLLIGTYELKSHYKIPYKVIINEAIELV**FGNIDEKKYLEALLIDVELSLPIILNRKIHTIFIGGGTPSLISDTGLDYLLKNIKKLLLFKKNISITLEANPSTFEIEKFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLDLIYALPNQTLSELMLDLNYAIQYSPPHLSLYSLTIEPNTYFFKYPPLSMPSNDENAVMQDKITSLLKNNYYKNYEISAYSKTGYESQHNLNYWKFGDYLGNSIAKSKKIEKKCLIFEFMLNALRLKDGFSPNLFFERTGINIKIIESKLKNAEKLGLLKRNNKNIKPTSFGRYFLNDLQQIFLNN
MNMINSKYNKRKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLKLDMMTKKNNSSFGTNFTVSIEAANGVTTGISASDRAHTI***********DIVQPGHIFPLQAKKGGVLIRGGHTEAGCDLTKLAGLTPSAVICEILNDDGTMARAQEKNILHISVPGALEIPLALKNIIQIKKFNVLIAIGVIIRGETYHFELIANETISNIMQISIKNNIPIINAILTTETIEQANSRILTKGEIIIFINHKNKSLVNLIKNKTPRHRAREFALQGIYQWLFNNMDVNLIETYIKEISNFYKVDKKYFYLILRGVINDINFLRYDLSLIIDRSINELSSIEYVVLLIGTYELKSHYKIPYKVIINEAIELVKSFGNIDEKKYLEALLIDVELSLPIILNRKIHTIFIGGGTPSLISDTGLDYLLKNIKKLLLFKKNISITLEANPSTFEIEKFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLDLIYALPNQTLSELMLDLNYAIQYSPPHLSLYSLTIEPNTYFFKYPPLSMPSNDENAVMQDKITSLLKNNYYKNYEISAYSKTGYESQHNLNYWKFGDYLGNSIAKSKKIEKKCLIFEFMLNALRLKDGFSPNLFFERTGINIKIIESKLKNAEKLGLLKRNNKNIKPTSFGRYFLNDLQQIFLNN
***INSKYNKRKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLKLDMMTKKNNSSFGTNFTVSIEAANGVTTGISASDRAHTIKVASSKKAKPSDIVQPGHIFPLQAKKGGVLIRGGHTEAGCDLTKLAGLTPSAVICEILNDDGTMARAQEKNILHISVPGALEIPLALKNIIQIKKFNVLIAIGVIIRGETYHFELIANETISNIMQISIKNNIPIINAILTTETIEQANSRILTKGEIIIFINHKNKSLVNLIKNKTPRHRAREFALQGIYQWLFNNMDVNLIETYIKEISNFYKVDKKYFYLILRGVINDINFLRYDLSLIIDRSINELSSIEYVVLLIGTYELKSHYKIPYKVIINEAIELVKSFGNIDEKKYLEALLIDVELSLPIILNRKIHTIFIGGGTPSLISDTGLDYLLKNIKKLLLFKKNISITLEANPSTFEIEKFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLDLIYALPNQTLSELMLDLNYAIQYSPPHLSLYSLTIEPNTYFFKYPPLSMPSNDENAVMQDKITSLLKNNYYKNYEISAYSKTGYESQHNLNYWKFGDYLGNSIAKSKKIEKKCLIFEFMLNALRLKDGFSPNLFFERTGINIKIIESKLKNAEKLGLLKRNNKNIKPTSFGRYFLNDLQQIFLNN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNMINSKYNKRKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYYSNLPQYKIPTRIDIINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLKLDMMTKKNNSSFGTNFTVSIEAANGVTTGISASDRAHTIKVASSKKAKPSDIVQPGHIFPLQAKKGGVLIRGGHTEAGCDLTKLAGLTPSAVICEILNDDGTMARAQEKNILHISVPGALEIPLALKNIIQIKKFNVLIAIGVIIRGETYHFELIANETISNIMQISIKNNIPIINAILTTETIEQANSRILTKGEIIIFINHKNKSLVNLIKNKTPRHRAREFALQGIYQWLFNNMDVNLIETYIKEISNFYKVDKKYFYLILRGVINDINFLRYDLSLIIDRSINELSSIEYVVLLIGTYELKSHYKIPYKVIINEAIELVKSFGNIDEKKYLEALLIDVELSLPIILNRKIHTIFIGGGTPSLISDTGLDYLLKNIKKLLLFKKNISITLEANPSTFEIEKFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLDLIYALPNQTLSELMLDLNYAIQYSPPHLSLYSLTIEPNTYFFKYPPLSMPSNDENAVMQDKITSLLKNNYYKNYEISAYSKTGYESQHNLNYWKFGDYLGNSIAKSKKIEKKCLIFEFMLNALRLKDGFSPNLFFERTGINIKIIESKLKNAEKLGLLKRNNKNIKPTSFGRYFLNDLQQIFLNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query956 2.2.26 [Sep-21-2011]
Q88KX0336 tRNA-dihydrouridine synth yes N/A 0.253 0.720 0.551 2e-79
P72872334 Probable tRNA-dihydrourid N/A N/A 0.261 0.748 0.544 2e-79
Q87L85326 tRNA-dihydrouridine synth yes N/A 0.254 0.745 0.546 9e-79
Q9I048332 tRNA-dihydrouridine synth yes N/A 0.253 0.728 0.543 1e-78
Q9CL29327 tRNA-dihydrouridine synth yes N/A 0.25 0.730 0.556 4e-78
Q8CWK7326 tRNA-dihydrouridine synth yes N/A 0.264 0.776 0.523 2e-77
Q9KUX9327 tRNA-dihydrouridine synth yes N/A 0.245 0.718 0.546 2e-77
Q8ZJ14345 tRNA-dihydrouridine synth yes N/A 0.251 0.695 0.539 4e-77
Q8FB30331 tRNA-dihydrouridine synth yes N/A 0.253 0.731 0.555 4e-77
Q8ZKH4332 tRNA-dihydrouridine synth yes N/A 0.245 0.707 0.567 1e-76
>sp|Q88KX0|DUSA_PSEPK tRNA-dihydrouridine synthase A OS=Pseudomonas putida (strain KT2440) GN=dusA PE=3 SV=1 Back     alignment and function desciption
 Score =  298 bits (762), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 174/243 (71%), Gaps = 1/243 (0%)

Query: 11  RKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKH-CLDFNAEEHPIAFQ 69
           R+ S+APMM+ TDRHCR F R ++R + LYTEM TT A+L N  H  L  +A EHP+A Q
Sbjct: 18  RRFSVAPMMDWTDRHCRFFLRLLSRQTLLYTEMVTTGALLHNDAHRFLRHDASEHPLALQ 77

Query: 70  VGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRD 129
           +G + P  LA  A++ ++ GYDE+NLN GCPS+RVQN   GA LM  P LV+DC+KAMRD
Sbjct: 78  LGGSVPADLAACARLAEEAGYDEVNLNVGCPSDRVQNNMIGACLMAHPALVADCVKAMRD 137

Query: 130 SVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPI 189
           +V   +TVKHRIGI+  +SY  + DFVG V  AGCR+F VHAR A L+ L+PK+NR+IP 
Sbjct: 138 AVSTPVTVKHRIGINGRDSYAELSDFVGQVREAGCRSFTVHARIAILEGLSPKENREIPP 197

Query: 190 LKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNY 249
           L+Y+    LK+DFP+LEI++NGGIKT  E   HL   DGVMLGREAY NP+L++  D   
Sbjct: 198 LRYDIAAQLKRDFPDLEIVLNGGIKTLDECQAHLETFDGVMLGREAYHNPYLLAEVDQQL 257

Query: 250 YSN 252
           + +
Sbjct: 258 FGS 260
Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.
Pseudomonas putida (strain KT2440) (taxid: 160488)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|P72872|DUS2_SYNY3 Probable tRNA-dihydrouridine synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dus2 PE=3 SV=1 Back     alignment and function description
>sp|Q87L85|DUSA_VIBPA tRNA-dihydrouridine synthase A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|Q9I048|DUSA_PSEAE tRNA-dihydrouridine synthase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|Q9CL29|DUSA_PASMU tRNA-dihydrouridine synthase A OS=Pasteurella multocida (strain Pm70) GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|Q8CWK7|DUSA_VIBVU tRNA-dihydrouridine synthase A OS=Vibrio vulnificus (strain CMCP6) GN=dusA PE=3 SV=2 Back     alignment and function description
>sp|Q9KUX9|DUSA_VIBCH tRNA-dihydrouridine synthase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|Q8ZJ14|DUSA_YERPE tRNA-dihydrouridine synthase A OS=Yersinia pestis GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|Q8FB30|DUSA_ECOL6 tRNA-dihydrouridine synthase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|Q8ZKH4|DUSA_SALTY tRNA-dihydrouridine synthase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query956
152980796344 tRNA-dihydrouridine synthase A [Janthino 0.275 0.764 0.676 1e-108
134095593338 tRNA-dihydrouridine synthase A [Herminii 0.259 0.733 0.698 1e-105
300312882357 hypothetical protein Hsero_3587 [Herbasp 0.267 0.717 0.653 1e-103
409407337329 hypothetical protein GWL_29420 [Herbaspi 0.259 0.753 0.662 1e-103
398832210328 tRNA dihydrouridine synthase A [Herbaspi 0.258 0.753 0.661 1e-102
340788618338 tRNA-dihydrouridine synthase A [Collimon 0.262 0.742 0.674 1e-102
415944436323 tRNA-dihydrouridine synthase A [Herbaspi 0.260 0.770 0.664 1e-102
445495230341 tRNA-dihydrouridine synthase A [Janthino 0.253 0.709 0.670 1e-101
399017469322 tRNA dihydrouridine synthase A [Herbaspi 0.259 0.770 0.666 1e-100
83749666344 NIFR3-like protein [Ralstonia solanacear 0.274 0.761 0.603 6e-99
>gi|152980796|ref|YP_001354180.1| tRNA-dihydrouridine synthase A [Janthinobacterium sp. Marseille] gi|151280873|gb|ABR89283.1| tRNA-dihydrouridine synthase [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
 Score =  399 bits (1025), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/266 (67%), Positives = 211/266 (79%), Gaps = 3/266 (1%)

Query: 2   NMINSKYNKRKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAIL-GNKKHCLDFN 60
           N  N KY  R+IS+APMM+ TDRHCRMFHRQITR++WLYTEM TT A+L G+    LDFN
Sbjct: 7   NTANGKYQGRRISVAPMMDWTDRHCRMFHRQITRHTWLYTEMVTTGALLHGDVPRHLDFN 66

Query: 61  AEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLV 120
            EEHP+A Q+G +EP  LAKSAK+ ++WGYDE+NLNCGCPS RVQ G FGA LM +  LV
Sbjct: 67  EEEHPVALQLGGSEPADLAKSAKLGEQWGYDEVNLNCGCPSERVQKGAFGACLMNETGLV 126

Query: 121 SDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLN 180
           +DC+KAMRD+V ID+TVKHRIGIDDI SYDFVRDFVGT++ AGC TFIVHARNA LK L+
Sbjct: 127 ADCVKAMRDAVSIDVTVKHRIGIDDITSYDFVRDFVGTIADAGCNTFIVHARNAILKGLS 186

Query: 181 PKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPF 240
           PK+NR+IP L+Y F Y LKKDFP LEIIINGG KT  EID HL ++DGVMLGREAY NPF
Sbjct: 187 PKENREIPPLRYEFAYQLKKDFPALEIIINGGTKTVAEIDTHLQHVDGVMLGREAYHNPF 246

Query: 241 LMSNFDLNYYSNLPQYKIPTRIDIIN 266
           LMS FD  YY +    K  TR +++ 
Sbjct: 247 LMSTFDARYYGDDATSK--TRAEVVQ 270

Source: Janthinobacterium sp. Marseille

Species: Janthinobacterium sp. Marseille

Genus: Janthinobacterium

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|134095593|ref|YP_001100668.1| tRNA-dihydrouridine synthase A [Herminiimonas arsenicoxydans] gi|133739496|emb|CAL62547.1| tRNA-dihydrouridine synthase A [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|300312882|ref|YP_003776974.1| hypothetical protein Hsero_3587 [Herbaspirillum seropedicae SmR1] gi|300075667|gb|ADJ65066.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|409407337|ref|ZP_11255788.1| hypothetical protein GWL_29420 [Herbaspirillum sp. GW103] gi|386433088|gb|EIJ45914.1| hypothetical protein GWL_29420 [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|398832210|ref|ZP_10590374.1| tRNA dihydrouridine synthase A [Herbaspirillum sp. YR522] gi|398223747|gb|EJN10082.1| tRNA dihydrouridine synthase A [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|340788618|ref|YP_004754083.1| tRNA-dihydrouridine synthase A [Collimonas fungivorans Ter331] gi|340553885|gb|AEK63260.1| tRNA-dihydrouridine synthase A [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|415944436|ref|ZP_11556234.1| tRNA-dihydrouridine synthase A [Herbaspirillum frisingense GSF30] gi|407758516|gb|EKF68332.1| tRNA-dihydrouridine synthase A [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|445495230|ref|ZP_21462274.1| tRNA-dihydrouridine synthase A [Janthinobacterium sp. HH01] gi|444791391|gb|ELX12938.1| tRNA-dihydrouridine synthase A [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|399017469|ref|ZP_10719661.1| tRNA dihydrouridine synthase A [Herbaspirillum sp. CF444] gi|398103343|gb|EJL93514.1| tRNA dihydrouridine synthase A [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|83749666|ref|ZP_00946647.1| NIFR3-like protein [Ralstonia solanacearum UW551] gi|83723668|gb|EAP70865.1| NIFR3-like protein [Ralstonia solanacearum UW551] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query956
UNIPROTKB|P32695330 dusA "tRNA-dihydrouridine synt 0.252 0.730 0.549 2.9e-70
UNIPROTKB|Q9KUX9327 dusA "tRNA-dihydrouridine synt 0.245 0.718 0.546 1e-68
TIGR_CMR|VC_0379327 VC_0379 "TIM-barrel protein, y 0.245 0.718 0.546 1e-68
UNIPROTKB|Q83D40353 CBU_0904 "tRNA-dihydrouridine 0.246 0.668 0.569 9.2e-68
TIGR_CMR|CBU_0904353 CBU_0904 "TIM-barrel protein, 0.246 0.668 0.569 9.2e-68
UNIPROTKB|Q607T6360 MCA1669 "tRNA-dihydrouridine s 0.266 0.708 0.513 1.5e-67
UNIPROTKB|Q48A03335 CPS_0353 "tRNA-dihydrouridine 0.265 0.758 0.496 3.1e-67
TIGR_CMR|CPS_0353335 CPS_0353 "TIM-barrel protein, 0.265 0.758 0.496 3.1e-67
UNIPROTKB|Q884G7336 dusA "tRNA-dihydrouridine synt 0.254 0.723 0.536 1.3e-66
UNIPROTKB|Q8EAJ0335 dusA "tRNA-dihydrouridine synt 0.256 0.731 0.522 1.7e-66
UNIPROTKB|P32695 dusA "tRNA-dihydrouridine synthase A" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 693 (249.0 bits), Expect = 2.9e-70, Sum P(2) = 2.9e-70
 Identities = 133/242 (54%), Positives = 176/242 (72%)

Query:    12 KISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAILGNKKHCLDFNAEEHPIAFQVG 71
             + S+APM++ TDRHCR F R ++R + LYTEM TT AI+  K   L ++ EEHP+A Q+G
Sbjct:    12 RFSVAPMLDWTDRHCRYFLRLLSRNTLLYTEMVTTGAIIHGKGDYLAYSEEEHPVALQLG 71

Query:    72 DNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSV 131
              ++P  LA+ AK+ +  GYDEINLN GCPS+RVQNG FGA LM    LV+DC+KAMRD V
Sbjct:    72 GSDPAALAQCAKLAEARGYDEINLNVGCPSDRVQNGMFGACLMGNAQLVADCVKAMRDVV 131

Query:   132 EIDITVKHRIGIDDINSYDFVRDFVGTVSSAG-CRTFIVHARNAFLKKLNPKQNRKIPIL 190
              I +TVK RIGIDD +SY+F+ DF+ TVS  G C  FI+HAR A+L  L+PK+NR+IP L
Sbjct:   132 SIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGECEMFIIHARKAWLSGLSPKENREIPPL 191

Query:   191 KYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYY 250
              Y  VY LK+DFP L + INGGIK+ +E   HL ++DGVM+GREAY+NP +++  D   +
Sbjct:   192 DYPRVYQLKRDFPHLTMSINGGIKSLEEAKAHLQHMDGVMVGREAYQNPGILAAVDREIF 251

Query:   251 SN 252
              +
Sbjct:   252 GS 253
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0002943 "tRNA dihydrouridine synthesis" evidence=IEA;IMP
GO:0017150 "tRNA dihydrouridine synthase activity" evidence=IEA;IMP
GO:0055114 "oxidation-reduction process" evidence=IEA
UNIPROTKB|Q9KUX9 dusA "tRNA-dihydrouridine synthase A" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0379 VC_0379 "TIM-barrel protein, yjbN family" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q83D40 CBU_0904 "tRNA-dihydrouridine synthase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0904 CBU_0904 "TIM-barrel protein, yjbN family" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q607T6 MCA1669 "tRNA-dihydrouridine synthase" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q48A03 CPS_0353 "tRNA-dihydrouridine synthase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0353 CPS_0353 "TIM-barrel protein, yjbN family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q884G7 dusA "tRNA-dihydrouridine synthase A" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EAJ0 dusA "tRNA-dihydrouridine synthase A" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8ZKH4DUSA_SALTY1, ., -, ., -, ., -0.56770.24580.7078yesN/A
Q9KUX9DUSA_VIBCH1, ., -, ., -, ., -0.54660.24580.7186yesN/A
Q9CL29DUSA_PASMU1, ., -, ., -, ., -0.55640.250.7308yesN/A
P44794DUSA_HAEIN1, ., -, ., -, ., -0.53550.250.7308yesN/A
Q88KX0DUSA_PSEPK1, ., -, ., -, ., -0.55140.25310.7202yesN/A
Q87L85DUSA_VIBPA1, ., -, ., -, ., -0.54690.25410.7453yesN/A
Q8EAJ0DUSA_SHEON1, ., -, ., -, ., -0.52240.25620.7313yesN/A
Q884G7DUSA_PSESM1, ., -, ., -, ., -0.53460.25520.7261yesN/A
Q8ZJ14DUSA_YERPE1, ., -, ., -, ., -0.53940.25100.6956yesN/A
Q8D2W5RIBB_WIGBR4, ., 1, ., 9, 9, ., 1, 20.56600.16630.7464yesN/A
Q8FB30DUSA_ECOL61, ., -, ., -, ., -0.55550.25310.7311yesN/A
Q7VNV2DUSA_HAEDU1, ., -, ., -, ., -0.51130.27400.8111yesN/A
Q8CWK7DUSA_VIBVU1, ., -, ., -, ., -0.52340.26460.7760yesN/A
Q7UBC5DUSA_SHIFL1, ., -, ., -, ., -0.54950.25200.7303yesN/A
Q9I048DUSA_PSEAE1, ., -, ., -, ., -0.54320.25310.7289yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.1.99.120.737
3rd Layer1.3.990.691
3rd Layer4.1.990.691
4th Layer2.5.1.90.737
3rd Layer2.5.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query956
PRK11815333 PRK11815, PRK11815, tRNA-dihydrouridine synthase A 1e-158
PRK08898394 PRK08898, PRK08898, coproporphyrinogen III oxidase 1e-143
TIGR00742318 TIGR00742, yjbN, tRNA dihydrouridine synthase A 1e-111
PRK05660378 PRK05660, PRK05660, HemN family oxidoreductase; Pr 1e-110
PRK14019367 PRK14019, PRK14019, bifunctional 3,4-dihydroxy-2-b 1e-104
COG0635416 COG0635, HemN, Coproporphyrinogen III oxidase and 9e-87
pfam00926193 pfam00926, DHBP_synthase, 3,4-dihydroxy-2-butanone 7e-84
COG0108203 COG0108, RibB, 3,4-dihydroxy-2-butanone 4-phosphat 2e-81
cd02801231 cd02801, DUS_like_FMN, Dihydrouridine synthase-lik 5e-73
PRK03353217 PRK03353, ribB, 3,4-dihydroxy-2-butanone 4-phospha 2e-71
PRK09311402 PRK09311, PRK09311, bifunctional 3,4-dihydroxy-2-b 2e-71
PRK12485369 PRK12485, PRK12485, bifunctional 3,4-dihydroxy-2-b 3e-71
COG0042323 COG0042, COG0042, tRNA-dihydrouridine synthase [Tr 8e-70
TIGR00539360 TIGR00539, hemN_rel, putative oxygen-independent c 3e-69
pfam01207309 pfam01207, Dus, Dihydrouridine synthase (Dus) 3e-68
PRK09057380 PRK09057, PRK09057, coproporphyrinogen III oxidase 1e-65
PRK09319555 PRK09319, PRK09319, bifunctional 3,4-dihydroxy-2-b 3e-65
TIGR00506199 TIGR00506, ribB, 3,4-dihydroxy-2-butanone 4-phosph 5e-65
PRK08599377 PRK08599, PRK08599, coproporphyrinogen III oxidase 3e-64
PRK09314339 PRK09314, PRK09314, bifunctional 3,4-dihydroxy-2-b 2e-61
PRK01792214 PRK01792, ribB, 3,4-dihydroxy-2-butanone 4-phospha 2e-59
PRK05799374 PRK05799, PRK05799, coproporphyrinogen III oxidase 3e-57
PLN02831450 PLN02831, PLN02831, Bifunctional GTP cyclohydrolas 3e-57
PRK06582390 PRK06582, PRK06582, coproporphyrinogen III oxidase 9e-56
PRK00910218 PRK00910, ribB, 3,4-dihydroxy-2-butanone 4-phospha 1e-53
PRK06294370 PRK06294, PRK06294, coproporphyrinogen III oxidase 2e-51
PRK00014230 PRK00014, ribB, 3,4-dihydroxy-2-butanone 4-phospha 6e-51
PRK07379400 PRK07379, PRK07379, coproporphyrinogen III oxidase 2e-48
PRK08446350 PRK08446, PRK08446, coproporphyrinogen III oxidase 1e-46
PRK05628375 PRK05628, PRK05628, coproporphyrinogen III oxidase 2e-38
cd09209133 cd09209, Lumazine_synthase-I, lumazine synthase (6 2e-35
PRK00061154 PRK00061, ribH, 6,7-dimethyl-8-ribityllumazine syn 1e-33
smart00729216 smart00729, Elp3, Elongator protein 3, MiaB family 1e-32
pfam00885144 pfam00885, DMRL_synthase, 6,7-dimethyl-8-ribityllu 2e-32
TIGR00737319 TIGR00737, nifR3_yhdG, putative TIM-barrel protein 5e-32
TIGR01951129 TIGR01951, nusB, transcription antitermination fac 2e-31
COG0054152 COG0054, RibH, Riboflavin synthase beta-chain [Coe 3e-31
PRK00202137 PRK00202, nusB, transcription antitermination prot 9e-31
PRK05904353 PRK05904, PRK05904, coproporphyrinogen III oxidase 2e-28
PRK08207488 PRK08207, PRK08207, coproporphyrinogen III oxidase 1e-25
TIGR04107420 TIGR04107, rSAM_HutW, putative heme utilization ra 5e-24
TIGR00114138 TIGR00114, lumazine-synth, 6,7-dimethyl-8-ribityll 6e-24
COG0781151 COG0781, NusB, Transcription termination factor [T 1e-23
PRK08208430 PRK08208, PRK08208, coproporphyrinogen III oxidase 2e-22
PRK09058449 PRK09058, PRK09058, coproporphyrinogen III oxidase 2e-22
TIGR03994401 TIGR03994, rSAM_HemZ, coproporphyrinogen dehydroge 2e-22
TIGR00538455 TIGR00538, hemN, oxygen-independent coproporphyrin 2e-21
PRK09318387 PRK09318, PRK09318, bifunctional 3,4-dihydroxy-2-b 2e-21
PLN02404141 PLN02404, PLN02404, 6,7-dimethyl-8-ribityllumazine 2e-20
pfam01029126 pfam01029, NusB, NusB family 8e-20
cd08371129 cd08371, Lumazine_synthase-like, lumazine synthase 2e-19
PRK09249453 PRK09249, PRK09249, coproporphyrinogen III oxidase 5e-18
cd00619130 cd00619, Terminator_NusB, Transcription terminatio 9e-18
PRK08629433 PRK08629, PRK08629, coproporphyrinogen III oxidase 2e-15
PRK13347453 PRK13347, PRK13347, coproporphyrinogen III oxidase 7e-15
PRK05773219 PRK05773, PRK05773, 3,4-dihydroxy-2-butanone 4-pho 1e-14
pfam04055165 pfam04055, Radical_SAM, Radical SAM superfamily 3e-14
cd09211131 cd09211, Lumazine_synthase_archaeal, lumazine synt 8e-11
cd00447129 cd00447, NusB_Sun, RNA binding domain of NusB (N p 1e-10
PRK10550312 PRK10550, PRK10550, tRNA-dihydrouridine synthase C 4e-09
cd09208137 cd09208, Lumazine_synthase-II, lumazine synthase ( 6e-09
PRK10415321 PRK10415, PRK10415, tRNA-dihydrouridine synthase B 7e-09
PRK12419158 PRK12419, PRK12419, riboflavin synthase subunit be 1e-06
pfam0696966 pfam06969, HemN_C, HemN C-terminal domain 1e-05
COG1032490 COG1032, COG1032, Fe-S oxidoreductase [Energy prod 5e-05
>gnl|CDD|236991 PRK11815, PRK11815, tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information 
 Score =  468 bits (1208), Expect = e-158
 Identities = 149/266 (56%), Positives = 198/266 (74%), Gaps = 3/266 (1%)

Query: 1   MNMINSKYNKRKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAIL-GNKKHCLDF 59
           M    SK   R+ S+APMM+ TDRHCR FHR ++R++ LYTEM TT AI+ G+++  L F
Sbjct: 1   MPEKMSKLPSRRFSVAPMMDWTDRHCRYFHRLLSRHALLYTEMVTTGAIIHGDRERLLAF 60

Query: 60  NAEEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLL 119
           + EEHP+A Q+G ++P  LA++AK+ + WGYDEINLN GCPS+RVQNG FGA LM +P L
Sbjct: 61  DPEEHPVALQLGGSDPADLAEAAKLAEDWGYDEINLNVGCPSDRVQNGRFGACLMAEPEL 120

Query: 120 VSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKL 179
           V+DC+KAM+D+V I +TVKHRIGIDD +SY+F+ DFV TV+ AGC TFIVHAR A+LK L
Sbjct: 121 VADCVKAMKDAVSIPVTVKHRIGIDDQDSYEFLCDFVDTVAEAGCDTFIVHARKAWLKGL 180

Query: 180 NPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNP 239
           +PK+NR+IP L Y+ VY LK+DFP L I INGGIKT +E   HL ++DGVM+GR AY NP
Sbjct: 181 SPKENREIPPLDYDRVYRLKRDFPHLTIEINGGIKTLEEAKEHLQHVDGVMIGRAAYHNP 240

Query: 240 FLMSNFDLNYYSNLPQYKIPTRIDII 265
           +L++  D   +         +R +++
Sbjct: 241 YLLAEVDRELFGEPA--PPLSRSEVL 264

Length = 333
>gnl|CDD|236346 PRK08898, PRK08898, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|129825 TIGR00742, yjbN, tRNA dihydrouridine synthase A Back     alignment and domain information
>gnl|CDD|235550 PRK05660, PRK05660, HemN family oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|237587 PRK14019, PRK14019, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223708 COG0635, HemN, Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|216197 pfam00926, DHBP_synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase Back     alignment and domain information
>gnl|CDD|223186 COG0108, RibB, 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|239200 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>gnl|CDD|235119 PRK03353, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|181774 PRK09311, PRK09311, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>gnl|CDD|171535 PRK12485, PRK12485, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223120 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129630 TIGR00539, hemN_rel, putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>gnl|CDD|216365 pfam01207, Dus, Dihydrouridine synthase (Dus) Back     alignment and domain information
>gnl|CDD|181629 PRK09057, PRK09057, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236465 PRK09319, PRK09319, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|232999 TIGR00506, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase Back     alignment and domain information
>gnl|CDD|236309 PRK08599, PRK08599, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181775 PRK09314, PRK09314, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>gnl|CDD|167278 PRK01792, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|180263 PRK05799, PRK05799, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|215445 PLN02831, PLN02831, Bifunctional GTP cyclohydrolase II/ 3,4-dihydroxy-2-butanone-4-phosphate synthase Back     alignment and domain information
>gnl|CDD|180630 PRK06582, PRK06582, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|179162 PRK00910, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|180518 PRK06294, PRK06294, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|134031 PRK00014, ribB, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|236007 PRK07379, PRK07379, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181428 PRK08446, PRK08446, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180172 PRK05628, PRK05628, coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>gnl|CDD|187742 cd09209, Lumazine_synthase-I, lumazine synthase (6,7-dimethyl-8-ribityllumazine synthase, LS), catalyzes the penultimate step in the biosynthesis of riboflavin (vitamin B2); type-I Back     alignment and domain information
>gnl|CDD|234606 PRK00061, ribH, 6,7-dimethyl-8-ribityllumazine synthase; Provisional Back     alignment and domain information
>gnl|CDD|214792 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>gnl|CDD|201491 pfam00885, DMRL_synthase, 6,7-dimethyl-8-ribityllumazine synthase Back     alignment and domain information
>gnl|CDD|129820 TIGR00737, nifR3_yhdG, putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>gnl|CDD|233652 TIGR01951, nusB, transcription antitermination factor NusB Back     alignment and domain information
>gnl|CDD|223132 COG0054, RibH, Riboflavin synthase beta-chain [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|234686 PRK00202, nusB, transcription antitermination protein NusB; Reviewed Back     alignment and domain information
>gnl|CDD|235641 PRK05904, PRK05904, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236187 PRK08207, PRK08207, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|234473 TIGR04107, rSAM_HutW, putative heme utilization radical SAM enzyme HutW Back     alignment and domain information
>gnl|CDD|211550 TIGR00114, lumazine-synth, 6,7-dimethyl-8-ribityllumazine synthase Back     alignment and domain information
>gnl|CDD|223852 COG0781, NusB, Transcription termination factor [Transcription] Back     alignment and domain information
>gnl|CDD|181292 PRK08208, PRK08208, coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>gnl|CDD|236368 PRK09058, PRK09058, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|234435 TIGR03994, rSAM_HemZ, coproporphyrinogen dehydrogenase HemZ Back     alignment and domain information
>gnl|CDD|129629 TIGR00538, hemN, oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>gnl|CDD|236464 PRK09318, PRK09318, bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>gnl|CDD|178026 PLN02404, PLN02404, 6,7-dimethyl-8-ribityllumazine synthase Back     alignment and domain information
>gnl|CDD|216253 pfam01029, NusB, NusB family Back     alignment and domain information
>gnl|CDD|187740 cd08371, Lumazine_synthase-like, lumazine synthase and riboflavin synthase; involved in the riboflavin (vitamin B2) biosynthetic pathway Back     alignment and domain information
>gnl|CDD|236430 PRK09249, PRK09249, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|238342 cd00619, Terminator_NusB, Transcription termination factor NusB (N protein-Utilization Substance B) Back     alignment and domain information
>gnl|CDD|181509 PRK08629, PRK08629, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|237356 PRK13347, PRK13347, coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>gnl|CDD|235601 PRK05773, PRK05773, 3,4-dihydroxy-2-butanone 4-phosphate synthase; Validated Back     alignment and domain information
>gnl|CDD|217866 pfam04055, Radical_SAM, Radical SAM superfamily Back     alignment and domain information
>gnl|CDD|187744 cd09211, Lumazine_synthase_archaeal, lumazine synthase (6,7-dimethyl-8-ribityllumazine synthase, LS); catalyzes the penultimate step in the biosynthesis of riboflavin (vitamin B2) Back     alignment and domain information
>gnl|CDD|238253 cd00447, NusB_Sun, RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins Back     alignment and domain information
>gnl|CDD|236713 PRK10550, PRK10550, tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>gnl|CDD|187741 cd09208, Lumazine_synthase-II, lumazine synthase (6,7-dimethyl-8-ribityllumazine synthase, LS), catalyzes the penultimate step in the biosynthesis of riboflavin (vitamin B2); type-II Back     alignment and domain information
>gnl|CDD|182440 PRK10415, PRK10415, tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|237096 PRK12419, PRK12419, riboflavin synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|203555 pfam06969, HemN_C, HemN C-terminal domain Back     alignment and domain information
>gnl|CDD|223963 COG1032, COG1032, Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 956
PRK06582390 coproporphyrinogen III oxidase; Provisional 100.0
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 100.0
PRK07379400 coproporphyrinogen III oxidase; Provisional 100.0
PRK09057380 coproporphyrinogen III oxidase; Provisional 100.0
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe 100.0
PRK08898394 coproporphyrinogen III oxidase; Provisional 100.0
PRK05660378 HemN family oxidoreductase; Provisional 100.0
PRK06294370 coproporphyrinogen III oxidase; Provisional 100.0
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 100.0
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 100.0
PRK09058449 coproporphyrinogen III oxidase; Provisional 100.0
PRK05904353 coproporphyrinogen III oxidase; Provisional 100.0
PRK05628375 coproporphyrinogen III oxidase; Validated 100.0
PRK05799374 coproporphyrinogen III oxidase; Provisional 100.0
PRK08446350 coproporphyrinogen III oxidase; Provisional 100.0
PRK08599377 coproporphyrinogen III oxidase; Provisional 100.0
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 100.0
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 100.0
TIGR00539360 hemN_rel putative oxygen-independent coproporphyri 100.0
PRK08208430 coproporphyrinogen III oxidase; Validated 100.0
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 100.0
COG0108203 RibB 3,4-dihydroxy-2-butanone 4-phosphate synthase 100.0
PRK13347453 coproporphyrinogen III oxidase; Provisional 100.0
PRK08629433 coproporphyrinogen III oxidase; Provisional 100.0
PRK09249453 coproporphyrinogen III oxidase; Provisional 100.0
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 100.0
TIGR00538455 hemN oxygen-independent coproporphyrinogen III oxi 100.0
KOG2335|consensus358 100.0
PRK00910218 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase 100.0
PRK01792214 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase 100.0
PRK00014230 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase 100.0
PF00926194 DHBP_synthase: 3,4-dihydroxy-2-butanone 4-phosphat 100.0
TIGR00506199 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase 100.0
PRK09314339 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate 100.0
PRK12485369 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate 100.0
PRK08207488 coproporphyrinogen III oxidase; Provisional 100.0
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 100.0
PRK03353217 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase 100.0
PRK09319555 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate 100.0
PRK05773219 3,4-dihydroxy-2-butanone 4-phosphate synthase; Val 100.0
KOG2333|consensus614 100.0
PRK09311402 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate 100.0
PLN02831450 Bifunctional GTP cyclohydrolase II/ 3,4-dihydroxy- 100.0
PRK14019367 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate 100.0
PRK09318387 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate 100.0
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 100.0
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 100.0
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 100.0
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 100.0
PLN02404141 6,7-dimethyl-8-ribityllumazine synthase 99.98
PRK13523337 NADPH dehydrogenase NamA; Provisional 99.98
COG0054152 RibH Riboflavin synthase beta-chain [Coenzyme meta 99.97
TIGR00114138 lumazine-synth 6,7-dimethyl-8-ribityllumazine synt 99.97
PRK12419158 riboflavin synthase subunit beta; Provisional 99.97
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 99.97
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 99.97
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 99.97
KOG3243|consensus158 99.97
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 99.97
PRK00061154 ribH 6,7-dimethyl-8-ribityllumazine synthase; Prov 99.97
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 99.96
KOG2334|consensus477 99.96
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 99.96
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 99.96
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 99.96
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 99.96
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 99.96
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 99.96
PF00885144 DMRL_synthase: 6,7-dimethyl-8-ribityllumazine synt 99.96
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 99.95
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 99.95
TIGR01506151 ribC_arch riboflavin synthase. This archaeal prote 99.95
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 99.95
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 99.94
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 99.94
PRK10605362 N-ethylmaleimide reductase; Provisional 99.94
PLN02411391 12-oxophytodienoate reductase 99.94
TIGR01212302 radical SAM protein, TIGR01212 family. This unchar 99.93
KOG1284|consensus357 99.93
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 99.93
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 99.92
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 99.92
TIGR02026497 BchE magnesium-protoporphyrin IX monomethyl ester 99.92
PRK14335455 (dimethylallyl)adenosine tRNA methylthiotransferas 99.91
TIGR01579414 MiaB-like-C MiaB-like tRNA modifying enzyme. This 99.91
PRK14332449 (dimethylallyl)adenosine tRNA methylthiotransferas 99.9
PRK14327509 (dimethylallyl)adenosine tRNA methylthiotransferas 99.9
PRK14340445 (dimethylallyl)adenosine tRNA methylthiotransferas 99.9
PRK14331437 (dimethylallyl)adenosine tRNA methylthiotransferas 99.9
PRK14329467 (dimethylallyl)adenosine tRNA methylthiotransferas 99.9
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 99.9
PRK14330434 (dimethylallyl)adenosine tRNA methylthiotransferas 99.9
COG0621437 MiaB 2-methylthioadenine synthetase [Translation, 99.9
PRK14325444 (dimethylallyl)adenosine tRNA methylthiotransferas 99.9
PRK14334440 (dimethylallyl)adenosine tRNA methylthiotransferas 99.9
PRK14339420 (dimethylallyl)adenosine tRNA methylthiotransferas 99.89
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 99.89
PRK14333448 (dimethylallyl)adenosine tRNA methylthiotransferas 99.89
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 99.89
PRK14326502 (dimethylallyl)adenosine tRNA methylthiotransferas 99.89
PRK14336418 (dimethylallyl)adenosine tRNA methylthiotransferas 99.89
TIGR01574438 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-3 99.89
TIGR00089429 RNA modification enzyme, MiaB family. This subfami 99.89
PRK08815375 GTP cyclohydrolase; Provisional 99.88
PRK14337446 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM 99.88
PRK14328439 (dimethylallyl)adenosine tRNA methylthiotransferas 99.88
TIGR01125430 MiaB-like tRNA modifying enzyme YliG, TIGR01125. T 99.87
PRK14338459 (dimethylallyl)adenosine tRNA methylthiotransferas 99.87
TIGR01578420 MiaB-like-B MiaB-like tRNA modifying enzyme, archa 99.86
TIGR01210313 conserved hypothetical protein TIGR01210. This fam 99.86
PRK07094323 biotin synthase; Provisional 99.85
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 99.84
PRK14862440 rimO ribosomal protein S12 methylthiotransferase; 99.84
COG1243515 ELP3 Histone acetyltransferase [Transcription / Ch 99.83
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 99.82
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 99.82
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 99.81
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 99.81
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 99.79
COG1242312 Predicted Fe-S oxidoreductase [General function pr 99.79
PRK00202137 nusB transcription antitermination protein NusB; R 99.79
COG0781151 NusB Transcription termination factor [Transcripti 99.78
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 99.78
smart00729216 Elp3 Elongator protein 3, MiaB family, Radical SAM 99.77
PRK06455155 riboflavin synthase; Provisional 99.77
PF01029134 NusB: NusB family; InterPro: IPR006027 This domain 99.77
PRK10901427 16S rRNA methyltransferase B; Provisional 99.76
TIGR01951129 nusB transcription antitermination factor NusB. A 99.76
cd00619130 Terminator_NusB Transcription termination factor N 99.75
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 99.75
PRK14901434 16S rRNA methyltransferase B; Provisional 99.73
PRK14904445 16S rRNA methyltransferase B; Provisional 99.71
cd00620126 Methyltransferase_Sun N-terminal RNA binding domai 99.71
PRK14902444 16S rRNA methyltransferase B; Provisional 99.7
PLN02826409 dihydroorotate dehydrogenase 99.69
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 99.68
PRK06256336 biotin synthase; Validated 99.67
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.64
PRK00955620 hypothetical protein; Provisional 99.64
PRK14903431 16S rRNA methyltransferase B; Provisional 99.62
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 99.62
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 99.61
COG1032490 Fe-S oxidoreductase [Energy production and convers 99.59
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 99.59
PRK01254707 hypothetical protein; Provisional 99.57
cd01335204 Radical_SAM Radical SAM superfamily. Enzymes of th 99.56
TIGR03551343 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav 99.55
PRK05481289 lipoyl synthase; Provisional 99.55
cd00447129 NusB_Sun RNA binding domain of NusB (N protein-Uti 99.55
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 99.54
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 99.54
PRK12928290 lipoyl synthase; Provisional 99.52
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.51
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 99.48
TIGR00423309 radical SAM domain protein, CofH subfamily. This p 99.48
PRK06245336 cofG FO synthase subunit 1; Reviewed 99.47
TIGR03699340 mena_SCO4550 menaquinone biosynthesis protein, SCO 99.47
TIGR00510302 lipA lipoate synthase. The family shows strong seq 99.46
PRK08445348 hypothetical protein; Provisional 99.45
TIGR02351366 thiH thiazole biosynthesis protein ThiH. Members t 99.45
PRK06267350 hypothetical protein; Provisional 99.44
TIGR03700351 mena_SCO4494 putative menaquinone biosynthesis pro 99.43
PLN02389379 biotin synthase 99.41
PRK08508279 biotin synthase; Provisional 99.41
PRK14024241 phosphoribosyl isomerase A; Provisional 99.41
PF04055166 Radical_SAM: Radical SAM superfamily; InterPro: IP 99.4
PRK09634207 nusB transcription antitermination protein NusB; P 99.4
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.38
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 99.37
KOG0134|consensus400 99.36
KOG2492|consensus552 99.34
TIGR03550322 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflav 99.33
PRK15108345 biotin synthase; Provisional 99.33
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 99.3
PLN02428349 lipoic acid synthase 99.28
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 99.27
PRK09613469 thiH thiamine biosynthesis protein ThiH; Reviewed 99.26
KOG4355|consensus547 99.21
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 99.16
COG1031560 Uncharacterized Fe-S oxidoreductase [Energy produc 99.16
PRK07360371 FO synthase subunit 2; Reviewed 99.15
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 99.15
PRK05926370 hypothetical protein; Provisional 99.14
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.14
TIGR03822321 AblA_like_2 lysine-2,3-aminomutase-related protein 99.14
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 99.13
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 99.13
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 99.1
PRK08444353 hypothetical protein; Provisional 99.1
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.08
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 99.07
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 99.07
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 99.02
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 99.01
PRK05927350 hypothetical protein; Provisional 99.0
COG1244358 Predicted Fe-S oxidoreductase [General function pr 98.98
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 98.98
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.97
KOG1436|consensus398 98.96
PRK13361329 molybdenum cofactor biosynthesis protein A; Provis 98.94
PRK00164331 moaA molybdenum cofactor biosynthesis protein A; R 98.86
PRK09234843 fbiC FO synthase; Reviewed 98.84
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 98.79
TIGR02666334 moaA molybdenum cofactor biosynthesis protein A, b 98.77
PF0696966 HemN_C: HemN C-terminal domain; InterPro: IPR01072 98.76
TIGR02668302 moaA_archaeal probable molybdenum cofactor biosynt 98.76
PTZ00413398 lipoate synthase; Provisional 98.73
PLN02535364 glycolate oxidase 98.73
KOG2535|consensus554 98.73
PRK05301378 pyrroloquinoline quinone biosynthesis protein PqqE 98.72
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.7
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 98.69
KOG1799|consensus471 98.69
TIGR02493235 PFLA pyruvate formate-lyase 1-activating enzyme. A 98.69
COG1856275 Uncharacterized homolog of biotin synthetase [Func 98.69
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 98.67
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 98.65
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 98.65
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 98.65
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 98.64
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.64
TIGR02109358 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E. 98.64
PLN02951373 Molybderin biosynthesis protein CNX2 98.62
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 98.6
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 98.6
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 98.59
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 98.58
PLN02979366 glycolate oxidase 98.58
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 98.58
PRK11197381 lldD L-lactate dehydrogenase; Provisional 98.55
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 98.55
TIGR01290442 nifB nitrogenase cofactor biosynthesis protein Nif 98.54
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 98.53
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 98.5
PRK09234 843 fbiC FO synthase; Reviewed 98.49
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 98.47
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 98.45
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 98.44
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 98.44
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.43
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 98.43
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.41
COG2100414 Predicted Fe-S oxidoreductase [General function pr 98.37
PRK11145246 pflA pyruvate formate lyase-activating enzyme 1; P 98.37
COG2896322 MoaA Molybdenum cofactor biosynthesis enzyme [Coen 98.36
TIGR02495191 NrdG2 anaerobic ribonucleoside-triphosphate reduct 98.36
PRK14460354 ribosomal RNA large subunit methyltransferase N; P 98.36
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 98.35
PRK00208250 thiG thiazole synthase; Reviewed 98.33
TIGR03470318 HpnH hopanoid biosynthesis associated radical SAM 98.28
TIGR00238331 KamA family protein. Note that the E. coli homolog 98.26
TIGR03820417 lys_2_3_AblA lysine-2,3-aminomutase. This model de 98.24
PRK13762322 tRNA-modifying enzyme; Provisional 98.23
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 98.22
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 98.22
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 98.21
cd04742418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 98.2
TIGR03278404 methan_mark_10 putative methanogenesis marker prot 98.17
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 98.15
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 98.15
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.15
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.15
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 98.15
PRK14456368 ribosomal RNA large subunit methyltransferase N; P 98.15
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 98.14
KOG1606|consensus296 98.13
PRK14455356 ribosomal RNA large subunit methyltransferase N; P 98.13
PRK14463349 ribosomal RNA large subunit methyltransferase N; P 98.12
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.12
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 98.12
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 98.11
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 98.08
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 98.08
COG1060370 ThiH Thiamine biosynthesis enzyme ThiH and related 98.05
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 98.05
COG0641378 AslB Arylsulfatase regulator (Fe-S oxidoreductase) 98.02
PRK13745412 anaerobic sulfatase-maturase; Provisional 98.02
COG2516339 Biotin synthase-related enzyme [General function p 98.02
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 98.01
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 98.0
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 97.98
TIGR02814444 pfaD_fam PfaD family protein. The protein PfaD is 97.98
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 97.97
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 97.97
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 97.96
TIGR03821321 AblA_like_1 lysine-2,3-aminomutase-related protein 97.95
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 97.94
PRK14469343 ribosomal RNA large subunit methyltransferase N; P 97.93
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.93
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.92
COG0535347 Predicted Fe-S oxidoreductases [General function p 97.91
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 97.91
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.9
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 97.89
PRK13758370 anaerobic sulfatase-maturase; Provisional 97.88
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 97.87
PRK14468343 ribosomal RNA large subunit methyltransferase N; P 97.86
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 97.85
PRK14457345 ribosomal RNA large subunit methyltransferase N; P 97.85
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 97.83
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 97.82
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 97.82
PRK14466345 ribosomal RNA large subunit methyltransferase N; P 97.81
PRK00507221 deoxyribose-phosphate aldolase; Provisional 97.81
PRK14470336 ribosomal RNA large subunit methyltransferase N; P 97.79
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.79
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.78
PRK14467348 ribosomal RNA large subunit methyltransferase N; P 97.77
PLN02274505 inosine-5'-monophosphate dehydrogenase 97.77
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.76
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 97.75
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.75
TIGR00048355 radical SAM enzyme, Cfr family. A Staphylococcus s 97.73
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 97.72
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 97.72
KOG0538|consensus363 97.71
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 97.71
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 97.71
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 97.7
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 97.7
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 97.68
PRK07695201 transcriptional regulator TenI; Provisional 97.66
COG4277404 Predicted DNA-binding protein with the Helix-hairp 97.64
PLN02591250 tryptophan synthase 97.63
COG1625414 Fe-S oxidoreductase, related to NifB/MoaA family [ 97.62
PLN02617538 imidazole glycerol phosphate synthase hisHF 97.62
cd02812219 PcrB_like PcrB_like proteins. One member of this f 97.61
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.61
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 97.6
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 97.59
COG0731296 Fe-S oxidoreductases [Energy production and conver 97.59
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 97.57
PF01645368 Glu_synthase: Conserved region in glutamate syntha 97.57
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 97.55
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 97.51
PRK14024241 phosphoribosyl isomerase A; Provisional 97.5
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 97.49
PRK14459373 ribosomal RNA large subunit methyltransferase N; P 97.48
PRK05581220 ribulose-phosphate 3-epimerase; Validated 97.46
PRK14454342 ribosomal RNA large subunit methyltransferase N; P 97.45
PLN02334229 ribulose-phosphate 3-epimerase 97.45
PRK07226267 fructose-bisphosphate aldolase; Provisional 97.45
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 97.44
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.44
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 97.44
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.43
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 97.42
PRK14462356 ribosomal RNA large subunit methyltransferase N; P 97.41
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 97.4
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.4
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 97.37
COG1533297 SplB DNA repair photolyase [DNA replication, recom 97.35
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.34
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 97.33
TIGR02494295 PFLE_PFLC glycyl-radical enzyme activating protein 97.29
PRK14465342 ribosomal RNA large subunit methyltransferase N; P 97.29
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 97.19
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 97.17
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.16
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.16
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.15
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 97.15
PRK06806281 fructose-bisphosphate aldolase; Provisional 97.14
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 97.13
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 97.12
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 97.1
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.06
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 97.05
PRK05283257 deoxyribose-phosphate aldolase; Provisional 97.05
PRK08005210 epimerase; Validated 97.04
PRK14453347 chloramphenicol/florfenicol resistance protein; Pr 97.03
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.02
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 97.01
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 97.0
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 96.99
PRK11194372 ribosomal RNA large subunit methyltransferase N; P 96.97
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 96.97
PRK117501485 gltB glutamate synthase subunit alpha; Provisional 96.96
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 96.94
PRK07028430 bifunctional hexulose-6-phosphate synthase/ribonuc 96.93
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 96.93
COG1509369 KamA Lysine 2,3-aminomutase [Amino acid transport 96.91
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily o 96.87
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 96.85
KOG2900|consensus380 96.83
PRK04302223 triosephosphate isomerase; Provisional 96.8
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.8
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.77
COG1731154 Archaeal riboflavin synthase [Coenzyme metabolism] 96.76
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 96.74
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 96.7
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 96.7
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 96.68
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 96.65
KOG2550|consensus503 96.65
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.62
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 96.59
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 96.58
PF01680208 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p 96.58
PRK08227264 autoinducer 2 aldolase; Validated 96.56
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 96.56
PLN02424332 ketopantoate hydroxymethyltransferase 96.55
PLN02274505 inosine-5'-monophosphate dehydrogenase 96.54
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 96.53
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 96.53
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 96.52
KOG2334|consensus477 96.49
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.45
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 96.43
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 96.41
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 96.37
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 96.32
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Pos 96.31
PRK14464344 ribosomal RNA large subunit methyltransferase N; P 96.31
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacteri 96.27
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 96.27
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 96.27
PRK10076213 pyruvate formate lyase II activase; Provisional 96.26
PRK14461371 ribosomal RNA large subunit methyltransferase N; P 96.25
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 96.22
COG0820349 Predicted Fe-S-cluster redox enzyme [General funct 96.22
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 96.21
PLN02617538 imidazole glycerol phosphate synthase hisHF 96.21
COG2108353 Uncharacterized conserved protein related to pyruv 96.15
PRK06801286 hypothetical protein; Provisional 96.07
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 96.06
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 95.98
cd03324415 rTSbeta_L-fuconate_dehydratase Human rTS beta is e 95.98
PRK07315293 fructose-bisphosphate aldolase; Provisional 95.94
PLN02460338 indole-3-glycerol-phosphate synthase 95.91
PRK13802695 bifunctional indole-3-glycerol phosphate synthase/ 95.89
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 95.88
TIGR03365238 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosyn 95.86
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 95.85
cd03325352 D-galactonate_dehydratase D-galactonate dehydratas 95.82
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 95.8
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily o 95.77
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 95.76
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 95.74
COG4948372 L-alanine-DL-glutamate epimerase and related enzym 95.7
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 95.59
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 95.55
cd03326385 MR_like_1 Mandelate racemase (MR)-like subfamily o 95.48
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 95.47
PRK14017382 galactonate dehydratase; Provisional 95.47
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 95.43
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 95.42
cd03322361 rpsA The starvation sensing protein RpsA from E.co 95.36
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 95.31
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 95.31
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 95.28
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 95.26
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 95.18
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 95.18
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 95.17
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 95.16
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 95.15
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 95.14
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 95.13
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 95.11
PRK08091228 ribulose-phosphate 3-epimerase; Validated 95.06
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 95.05
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 95.0
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 94.99
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 94.99
PRK15072404 bifunctional D-altronate/D-mannonate dehydratase; 94.87
PRK08185283 hypothetical protein; Provisional 94.83
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.82
TIGR02534368 mucon_cyclo muconate and chloromuconate cycloisome 94.76
cd03320263 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes 94.75
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 94.75
cd03317354 NAAAR N-acylamino acid racemase (NAAAR), an octame 94.65
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 94.61
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 94.59
TIGR01928324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 94.59
cd03323395 D-glucarate_dehydratase D-Glucarate dehydratase (G 94.59
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 94.59
cd03318365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 94.56
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 94.54
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.53
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 94.43
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 94.41
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 94.39
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 94.36
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 94.28
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 94.27
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 94.22
PRK07709285 fructose-bisphosphate aldolase; Provisional 94.08
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 94.07
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 94.01
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 93.97
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 93.95
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 93.92
PRK07084321 fructose-bisphosphate aldolase; Provisional 93.91
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 93.82
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 93.81
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 93.8
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 93.77
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 93.75
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.7e-58  Score=524.71  Aligned_cols=333  Identities=34%  Similarity=0.550  Sum_probs=303.7

Q ss_pred             CCCCCcceeeeeeecccccCC-cchHHHHHHHHHHHhhhcccccccceeEEEecCCCCCCCCHHHHHHHHHHHHHHcccC
Q psy2378         622 YKIPYKVIINEAIELVKSFGN-IDEKKYLEALLIDVELSLPIILNRKIHTIFIGGGTPSLISDTGLDYLLKNIKKLLLFK  700 (956)
Q Consensus       622 ~~~P~c~~~Ce~C~l~k~~~~-~~~~~~v~~vl~eI~~~~~~~~~~~i~~i~fgggtPs~L~~~~l~~ll~~i~~~~~~~  700 (956)
                      .++|||..+|.||++.+.... .....|++++.+||+...+.+....+++||||||||+.++++.++++++.+++.+.+.
T Consensus        16 iHiPFC~~~C~yC~f~~~~~~~~~~~~Y~~aL~~Ei~~~~~~~~~~~i~tiy~GGGTPs~l~~~~l~~ll~~i~~~~~~~   95 (390)
T PRK06582         16 IHWPFCLSKCPYCDFNSHVASTIDHNQWLKSYEKEIEYFKDIIQNKYIKSIFFGGGTPSLMNPVIVEGIINKISNLAIID   95 (390)
T ss_pred             EEeCCCcCcCCCCCCeeccCCCCCHHHHHHHHHHHHHHHHHHccCCceeEEEECCCccccCCHHHHHHHHHHHHHhCCCC
Confidence            689999999999998765332 2357899999999987655444457999999999999999999999999999988888


Q ss_pred             CCceeEEEeCCCCCCHHHHHHHHHcCCCeEEecCCCCCHHHHHHhCCCCCHHHHHHHHHHHHhcCCeeEEEEeecCCCCC
Q psy2378         701 KNISITLEANPSTFEIEKFHSYSIIGINRLSIGIQSFNNKYLNILGRTHDSKQAKYAIEIAKQYFNNFNLDLIYALPNQT  780 (956)
Q Consensus       701 ~~~eitle~np~~it~e~L~~L~~~Gv~risiGvQS~~d~~L~~~~R~~~~~~~~~ai~~l~~~~~~i~~dlI~GlPgqT  780 (956)
                      +..++|+|+||++++++.++.|+++|+||||||||||||++|+.+||.|+.+++.++++.+++.+.++++|||+|+||||
T Consensus        96 ~~~eitiE~nP~~~~~e~l~~l~~~GvnRiSiGvQS~~d~~L~~lgR~h~~~~~~~ai~~~~~~~~~v~~DlI~GlPgqt  175 (390)
T PRK06582         96 NQTEITLETNPTSFETEKFKAFKLAGINRVSIGVQSLKEDDLKKLGRTHDCMQAIKTIEAANTIFPRVSFDLIYARSGQT  175 (390)
T ss_pred             CCCEEEEEeCCCcCCHHHHHHHHHCCCCEEEEECCcCCHHHHHHcCCCCCHHHHHHHHHHHHHhCCcEEEEeecCCCCCC
Confidence            88899999999999999999999999999999999999999999999999999999999999998899999999999999


Q ss_pred             HHHHHHHHHHHHccCCCeEEEEeeeccCCcccccC---CCCCCCCHHHHHHHHHHHHHHHHhcCchhHHHHhhcCCCCcc
Q psy2378         781 LSELMLDLNYAIQYSPPHLSLYSLTIEPNTYFFKY---PPLSMPSNDENAVMQDKITSLLKNNYYKNYEISAYSKTGYES  857 (956)
Q Consensus       781 ~e~~~~tl~~~~~l~~~~i~~y~l~~~pgT~l~~~---~~~~~~~~~~~~~~~~~~~~~l~~~g~~~yeis~far~g~~s  857 (956)
                      .++|++|++.+.+++|+||++|+|+++|||+++++   ++..+|++++..+||..+.+.|.++||.+||+|||+|||++|
T Consensus       176 ~e~~~~~l~~~~~l~p~his~y~L~i~~gT~l~~~~~~g~~~~p~~~~~~~~~~~~~~~L~~~Gy~~yeis~fa~~g~~~  255 (390)
T PRK06582        176 LKDWQEELKQAMQLATSHISLYQLTIEKGTPFYKLFKEGNLILPHSDAAAEMYEWTNHYLESKKYFRYEISNYAKIGQEC  255 (390)
T ss_pred             HHHHHHHHHHHHhcCCCEEEEecCEEccCChHHHHHhcCCCCCCChHHHHHHHHHHHHHHHHcCCceeeceeeeCCChhh
Confidence            99999999999999999999999999999999875   456788999999999999999999999999999999999999


Q ss_pred             cchhccccCCceeeccccchhhh------------------------------------chhhHHHHHHHHhhhhccCCC
Q psy2378         858 QHNLNYWKFGDYLGNSIAKSKKI------------------------------------EKKCLIFEFMLNALRLKDGFS  901 (956)
Q Consensus       858 ~hn~~yw~~~~ylg~g~~~~~~~------------------------------------~~~~~~~e~~~~~lr~~~gi~  901 (956)
                      +||..||+..+|+|+|++|.+.+                                    +..+...|.++++||+.+|++
T Consensus       256 ~hn~~yw~~~~~lg~G~gA~s~~~~~~~~~~r~~~~~~~~~Y~~~~~~~~~p~~~~~~l~~~e~~~e~i~l~LR~~~Gl~  335 (390)
T PRK06582        256 LHNLTYWNYNSYLGIGPGAHSRIIESSSSVSAIMMWHKPEKWLDAVKTKNVGIQTNTKLTHQEIIEEILMMGLRLSKGIN  335 (390)
T ss_pred             hhHHHHhcCCcEEEECCCeeecccCCCCCceeEEecCCHHHHHHHHHcCCCCcceeeeCCHHHHHHHHHHHHHHhhCCCC
Confidence            99999999999999998764321                                    234567799999999999999


Q ss_pred             hhhHHHHhCCCHHH-H-HHHHHHHHHCCCeEEcCCEEeeCchhhchHHHHHHHhhc
Q psy2378         902 PNLFFERTGINIKI-I-ESKLKNAEKLGLLKRNNKNIKPTSFGRYFLNDLQQIFLN  955 (956)
Q Consensus       902 ~~~~~~~~g~~~~~-~-~~~l~~l~~~Gl~~~~~~~~~lT~~G~~~~~~i~~~f~~  955 (956)
                      ++.|.++||.++.. + .+.++.|+++||++. +++++||++|++++|.|+..|+.
T Consensus       336 ~~~~~~~~g~~~~~~~~~~~l~~l~~~gll~~-~~~l~lT~~G~~~~d~i~~~~~~  390 (390)
T PRK06582        336 ISTLEQKLNTKLENILDMNNLKHYQALDLIRL-DENIYLTDKGLMLHSYIVPRLII  390 (390)
T ss_pred             HHHHHHHHCcCHHHhhhHHHHHHHHHCCCEEE-CCEEEECcchhHHHHHHHHHHhC
Confidence            99999999998764 4 478999999999998 58899999999999999999973

>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>COG0108 RibB 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08629 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>KOG2335|consensus Back     alignment and domain information
>PRK00910 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>PRK01792 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>PRK00014 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>PF00926 DHBP_synthase: 3,4-dihydroxy-2-butanone 4-phosphate synthase; InterPro: IPR000422 3,4-dihydroxy-2-butanone 4-phosphate synthase (4 Back     alignment and domain information
>TIGR00506 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase Back     alignment and domain information
>PRK09314 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>PRK12485 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein; Provisional Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK03353 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional Back     alignment and domain information
>PRK09319 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK05773 3,4-dihydroxy-2-butanone 4-phosphate synthase; Validated Back     alignment and domain information
>KOG2333|consensus Back     alignment and domain information
>PRK09311 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>PLN02831 Bifunctional GTP cyclohydrolase II/ 3,4-dihydroxy-2-butanone-4-phosphate synthase Back     alignment and domain information
>PRK14019 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein; Provisional Back     alignment and domain information
>PRK09318 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>PLN02404 6,7-dimethyl-8-ribityllumazine synthase Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>COG0054 RibH Riboflavin synthase beta-chain [Coenzyme metabolism] Back     alignment and domain information
>TIGR00114 lumazine-synth 6,7-dimethyl-8-ribityllumazine synthase Back     alignment and domain information
>PRK12419 riboflavin synthase subunit beta; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>KOG3243|consensus Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK00061 ribH 6,7-dimethyl-8-ribityllumazine synthase; Provisional Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>KOG2334|consensus Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PF00885 DMRL_synthase: 6,7-dimethyl-8-ribityllumazine synthase; InterPro: IPR002180 6,7-dimethyl-8-ribityllumazine synthase (riboflavin synthase) catalyses the biosynthesis of riboflavin according to the reaction: 2 6,7-dimethyl-8-(1-D-ribityl)lumazine = riboflavin + 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR01506 ribC_arch riboflavin synthase Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>TIGR01212 radical SAM protein, TIGR01212 family Back     alignment and domain information
>KOG1284|consensus Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase Back     alignment and domain information
>PRK14335 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme Back     alignment and domain information
>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14329 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PRK14330 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14325 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14334 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14339 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK14326 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>PRK14336 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01574 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB Back     alignment and domain information
>TIGR00089 RNA modification enzyme, MiaB family Back     alignment and domain information
>PRK08815 GTP cyclohydrolase; Provisional Back     alignment and domain information
>PRK14337 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>PRK14328 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125 Back     alignment and domain information
>PRK14338 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional Back     alignment and domain information
>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type Back     alignment and domain information
>TIGR01210 conserved hypothetical protein TIGR01210 Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK14862 rimO ribosomal protein S12 methylthiotransferase; Provisional Back     alignment and domain information
>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>COG1242 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK00202 nusB transcription antitermination protein NusB; Reviewed Back     alignment and domain information
>COG0781 NusB Transcription termination factor [Transcription] Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM Back     alignment and domain information
>PRK06455 riboflavin synthase; Provisional Back     alignment and domain information
>PF01029 NusB: NusB family; InterPro: IPR006027 This domain is found in a number of functionally different proteins: NusB a prokaryotic transcription factor involved in antitermination TIM44, the mitochondrial inner membrane translocase subunit RsmB, the 16S rRNA m5C967 methyltransferase NusB is a prokaryotic transcription factor involved in antitermination processes, during which it interacts with the boxA portion of the mRNA nut site Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR01951 nusB transcription antitermination factor NusB Back     alignment and domain information
>cd00619 Terminator_NusB Transcription termination factor NusB (N protein-Utilization Substance B) Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>cd00620 Methyltransferase_Sun N-terminal RNA binding domain of the methyltransferase Sun Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK00955 hypothetical protein; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG1032 Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK01254 hypothetical protein; Provisional Back     alignment and domain information
>cd01335 Radical_SAM Radical SAM superfamily Back     alignment and domain information
>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit Back     alignment and domain information
>PRK05481 lipoyl synthase; Provisional Back     alignment and domain information
>cd00447 NusB_Sun RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK12928 lipoyl synthase; Provisional Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>TIGR00423 radical SAM domain protein, CofH subfamily Back     alignment and domain information
>PRK06245 cofG FO synthase subunit 1; Reviewed Back     alignment and domain information
>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family Back     alignment and domain information
>TIGR00510 lipA lipoate synthase Back     alignment and domain information
>PRK08445 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation Back     alignment and domain information
>PRK09634 nusB transcription antitermination protein NusB; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>KOG0134|consensus Back     alignment and domain information
>KOG2492|consensus Back     alignment and domain information
>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>KOG4355|consensus Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK05926 hypothetical protein; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK05927 hypothetical protein; Provisional Back     alignment and domain information
>COG1244 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>KOG1436|consensus Back     alignment and domain information
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional Back     alignment and domain information
>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial Back     alignment and domain information
>PF06969 HemN_C: HemN C-terminal domain; InterPro: IPR010723 Proteins containing this domain are all oxygen-independent coproporphyrinogen-III oxidases (HemN) Back     alignment and domain information
>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>KOG2535|consensus Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>KOG1799|consensus Back     alignment and domain information
>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E Back     alignment and domain information
>PLN02951 Molybderin biosynthesis protein CNX2 Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PRK09234 fbiC FO synthase; Reviewed Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>COG2100 Predicted Fe-S oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional Back     alignment and domain information
>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein Back     alignment and domain information
>PRK14460 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH Back     alignment and domain information
>TIGR00238 KamA family protein Back     alignment and domain information
>TIGR03820 lys_2_3_AblA lysine-2,3-aminomutase Back     alignment and domain information
>PRK13762 tRNA-modifying enzyme; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10 Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK14456 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>KOG1606|consensus Back     alignment and domain information
>PRK14455 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK14463 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only] Back     alignment and domain information
>PRK13745 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>COG2516 Biotin synthase-related enzyme [General function prediction only] Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK14469 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>COG0535 Predicted Fe-S oxidoreductases [General function prediction only] Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13758 anaerobic sulfatase-maturase; Provisional Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PRK14468 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14457 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK14466 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK14470 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK14467 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR00048 radical SAM enzyme, Cfr family Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>KOG0538|consensus Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only] Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>COG1625 Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion] Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG0731 Fe-S oxidoreductases [Energy production and conversion] Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK14459 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK14454 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK14462 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information
>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>PRK14465 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK14453 chloramphenicol/florfenicol resistance protein; Provisional Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11194 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>KOG2900|consensus Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG1731 Archaeal riboflavin synthase [Coenzyme metabolism] Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>KOG2550|consensus Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01680 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p is a highly conserved protein involved in growth arrest in Saccharomyces cerevisiae (Baker's yeast) [] Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>KOG2334|consensus Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14464 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only] Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>COG4948 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd03326 MR_like_1 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1 Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK15072 bifunctional D-altronate/D-mannonate dehydratase; Provisional Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases Back     alignment and domain information
>cd03320 OSBS o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd03317 NAAAR N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd03323 D-glucarate_dehydratase D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query956
3b0p_A350 Trna-Dihydrouridine Synthase From Thermus Thermophi 2e-61
3b0v_C363 Trna-Dihydrouridine Synthase From Thermus Thermophi 6e-58
1g57_A217 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 6e-47
1iez_A217 Solution Structure Of 3,4-Dihydroxy-2-Butanone 4-Ph 6e-47
3lqu_A217 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 7e-47
3h07_A220 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 2e-42
3mk5_A212 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 2e-37
3mgz_A206 Crystal Structure Of Dhbps Domain Of Bi-Functional 2e-37
1tks_A204 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 1e-34
1k49_A233 Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Pho 1e-31
1pvw_A227 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From 1e-17
1pvy_A227 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From 1e-16
1vsw_A153 Crystal Structure Of Lumazine Synthase From Bacillu 3e-15
1rvv_A154 SynthaseRIBOFLAVIN SYNTHASE COMPLEX OF BACILLUS SUB 4e-14
3d3b_A141 Structural And Functional Analysis Of The E. Coli N 4e-14
1ey1_A139 Solution Structure Of Escherichia Coli Nusb Length 5e-14
3imq_A141 Crystal Structure Of The Nusb101-S10(Delta Loop) Co 2e-13
1olt_A457 Coproporphyrinogen Iii Oxidase (Hemn) From Escheric 2e-13
3mk3_A156 Crystal Structure Of Lumazine Synthase From Salmone 1e-12
1hqk_A154 Crystal Structure Analysis Of Lumazine Synthase Fro 1e-11
4gef_A179 Product Complex Of Lumazine Synthase From Candida G 1e-11
2o6h_A157 Lumazine Synthase Ribh1 From Brucella Melitensis (g 4e-11
2f59_A157 Lumazine Synthase Ribh1 From Brucella Abortus (gene 4e-11
2jfb_A164 3d Structure Of Lumazine Synthase From Candida Albi 5e-11
1ejb_A168 Lumazine Synthase From Saccharomyces Cerevisiae Len 2e-10
1kz6_A159 Mutant Enzyme W63y/l119f Lumazine Synthase From S.p 2e-09
1kz9_A159 Mutant Enzyme L119f Lumazine Synthase From S.pombe 2e-09
1kz4_A159 Mutant Enzyme W63y Lumazine Synthase From S.pombe L 2e-09
1c41_A200 Crystal Structures Of A Pentameric Fungal And An Ic 2e-09
1kz1_A159 Mutant Enzyme W27g Lumazine Synthase From S.pombe L 2e-09
1kyv_A159 Lumazine Synthase From S.pombe Bound To Riboflavin 2e-09
2a57_A159 Structure Of 6,7-dimthyl-8-ribityllumazine Synthase 2e-09
1w19_A160 Lumazine Synthase From Mycobacterium Tuberculosis B 5e-09
1vhn_A318 Crystal Structure Of A Putative Flavin Oxidoreducta 1e-06
1c2y_A156 Crystal Structures Of A Pentameric Fungal And An Ic 2e-06
1t13_A158 Crystal Structure Of Lumazine Synthase From Brucell 2e-06
1di0_A158 Crystal Structure Of Lumazine Synthase From Brucell 3e-06
2obx_A157 Lumazine Synthase Ribh2 From Mesorhizobium Loti (ge 3e-06
1tzt_A142 T. Maritima Nusb, P21 Length = 142 3e-06
>pdb|3B0P|A Chain A, Trna-Dihydrouridine Synthase From Thermus Thermophilus Length = 350 Back     alignment and structure 
Iteration: 1

 Score =  234 bits (596), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/254 (43%), Positives = 170/254 (66%), Gaps = 5/254 (1%)
Query: 12  KISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAIL-GNKKHCLDFNAEEHPIAFQV 70
           ++S+APM++ TDRH R   RQ++    LYTEM   QA+L GN++  L F  EEHPIA Q+
Sbjct: 5   RLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQL 64
Query: 71  GDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDS 130
             ++PK LA++A+I + +GYDEINLN GCPS + Q G +GA L+     V + +KAM ++
Sbjct: 65  AGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEA 124
Query: 131 VEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNPKQNRKIPIL 190
           V + +TVK R+G++   +Y  +   V  ++ AG + F+VHAR+A L  L+ K NR+IP L
Sbjct: 125 VRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALL-ALSTKANREIPPL 183
Query: 191 KYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDLNYY 250
           ++++V+ LK DFP+L  + NGGI++ +E   HL  +DGVMLGR  Y++PF++   D   +
Sbjct: 184 RHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADRRVF 243
Query: 251 SNLPQYKIPTRIDI 264
             LP+   P+R+++
Sbjct: 244 -GLPRR--PSRLEV 254
>pdb|3B0V|C Chain C, Trna-Dihydrouridine Synthase From Thermus Thermophilus In Complex With Trna Length = 363 Back     alignment and structure
>pdb|1G57|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Length = 217 Back     alignment and structure
>pdb|1IEZ|A Chain A, Solution Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Of Riboflavin Biosynthesis Length = 217 Back     alignment and structure
>pdb|3LQU|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Complexed With Ribulose-5 Phosphate Length = 217 Back     alignment and structure
>pdb|3H07|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From Yersinia Pestis Co92 Length = 220 Back     alignment and structure
>pdb|3MK5|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Domain From Mycobacterium Tuberculosis With Sulfate And Zinc At Ph 4.00 Length = 212 Back     alignment and structure
>pdb|3MGZ|A Chain A, Crystal Structure Of Dhbps Domain Of Bi-Functional DhbpsGTP Cyclohydrolase Ii From Mycobacterium Tuberculosis At Ph 4.0 Length = 206 Back     alignment and structure
>pdb|1TKS|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase Of Candida Albicans Length = 204 Back     alignment and structure
>pdb|1K49|A Chain A, Crystal Structure Of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase (Cation Free Form) Length = 233 Back     alignment and structure
>pdb|1PVW|A Chain A, 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From M. Jannaschii Length = 227 Back     alignment and structure
>pdb|1PVY|A Chain A, 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase From M. Jannaschii In Complex With Ribulose 5-Phosphate Length = 227 Back     alignment and structure
>pdb|1VSW|A Chain A, Crystal Structure Of Lumazine Synthase From Bacillus Anthracis Length = 153 Back     alignment and structure
>pdb|1RVV|A Chain A, SynthaseRIBOFLAVIN SYNTHASE COMPLEX OF BACILLUS SUBTILIS Length = 154 Back     alignment and structure
>pdb|3D3B|A Chain A, Structural And Functional Analysis Of The E. Coli Nusb-s10 Transcription Antitermination Complex. Length = 141 Back     alignment and structure
>pdb|1EY1|A Chain A, Solution Structure Of Escherichia Coli Nusb Length = 139 Back     alignment and structure
>pdb|3IMQ|A Chain A, Crystal Structure Of The Nusb101-S10(Delta Loop) Complex Length = 141 Back     alignment and structure
>pdb|1OLT|A Chain A, Coproporphyrinogen Iii Oxidase (Hemn) From Escherichia Coli Is A Radical Sam Enzyme Length = 457 Back     alignment and structure
>pdb|3MK3|A Chain A, Crystal Structure Of Lumazine Synthase From Salmonella Typhimurium Lt2 Length = 156 Back     alignment and structure
>pdb|1HQK|A Chain A, Crystal Structure Analysis Of Lumazine Synthase From Aquifex Aeolicus Length = 154 Back     alignment and structure
>pdb|4GEF|A Chain A, Product Complex Of Lumazine Synthase From Candida Glabrata Length = 179 Back     alignment and structure
>pdb|2O6H|A Chain A, Lumazine Synthase Ribh1 From Brucella Melitensis (gene Bmei1187, Swiss-prot Entry Q8ygh2) Complexed With Inhibitor 5-nitro-6-(d- Ribitylamino)-2,4(1h,3h) Pyrimidinedione Length = 157 Back     alignment and structure
>pdb|2F59|A Chain A, Lumazine Synthase Ribh1 From Brucella Abortus (gene Bruab1_0785, Swiss-prot Entry Q57dy1) Complexed With Inhibitor 5-nitro-6-(d- Ribitylamino)-2,4(1h,3h) Pyrimidinedione Length = 157 Back     alignment and structure
>pdb|2JFB|A Chain A, 3d Structure Of Lumazine Synthase From Candida Albicans Length = 164 Back     alignment and structure
>pdb|1EJB|A Chain A, Lumazine Synthase From Saccharomyces Cerevisiae Length = 168 Back     alignment and structure
>pdb|1KZ6|A Chain A, Mutant Enzyme W63y/l119f Lumazine Synthase From S.pombe Length = 159 Back     alignment and structure
>pdb|1KZ9|A Chain A, Mutant Enzyme L119f Lumazine Synthase From S.pombe Length = 159 Back     alignment and structure
>pdb|1KZ4|A Chain A, Mutant Enzyme W63y Lumazine Synthase From S.pombe Length = 159 Back     alignment and structure
>pdb|1C41|A Chain A, Crystal Structures Of A Pentameric Fungal And An Icosahedral Plant Lumazine Synthase Reveals The Structural Basis For Differences In Assembly Length = 200 Back     alignment and structure
>pdb|1KZ1|A Chain A, Mutant Enzyme W27g Lumazine Synthase From S.pombe Length = 159 Back     alignment and structure
>pdb|1KYV|A Chain A, Lumazine Synthase From S.pombe Bound To Riboflavin Length = 159 Back     alignment and structure
>pdb|2A57|A Chain A, Structure Of 6,7-dimthyl-8-ribityllumazine Synthase From Schizosaccharomyces Pombe Mutant W27y With Bound Ligand 6- Carboxyethyl-7-oxo-8-ribityllumazine Length = 159 Back     alignment and structure
>pdb|1W19|A Chain A, Lumazine Synthase From Mycobacterium Tuberculosis Bound To 3-(1,3,7-Trihydro-9-D-Ribityl-2,6,8-Purinetrione-7-Yl) Propane 1-Phosphate Length = 160 Back     alignment and structure
>pdb|1VHN|A Chain A, Crystal Structure Of A Putative Flavin Oxidoreductase With Flavin Length = 318 Back     alignment and structure
>pdb|1C2Y|A Chain A, Crystal Structures Of A Pentameric Fungal And An Icosahedral Plant Lumazine Synthase Reveals The Structural Basis For Differences In Assembly Length = 156 Back     alignment and structure
>pdb|1T13|A Chain A, Crystal Structure Of Lumazine Synthase From Brucella Abortus Bound To 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) Pyrimidinedione Length = 158 Back     alignment and structure
>pdb|1DI0|A Chain A, Crystal Structure Of Lumazine Synthase From Brucella Abortus Length = 158 Back     alignment and structure
>pdb|2OBX|A Chain A, Lumazine Synthase Ribh2 From Mesorhizobium Loti (gene Mll7281, Swiss- Prot Entry Q986n2) Complexed With Inhibitor 5-nitro-6-(d- Ribitylamino)-2,4(1h,3h) Pyrimidinedione Length = 157 Back     alignment and structure
>pdb|1TZT|A Chain A, T. Maritima Nusb, P21 Length = 142 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query956
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 1e-149
1g57_A217 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphat 1e-101
3mio_A206 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphat 3e-97
1tks_A204 3,4-dihydroxy-2-butanone 4-phosphate synthase; rib 6e-97
1k4i_A233 3,4-dihydroxy-2-butanone 4-phosphate synthase; rib 6e-92
1snn_A227 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphat 1e-86
1olt_A457 Oxygen-independent coproporphyrinogen III oxidase; 4e-57
3d3b_A141 Protein NUSB, N utilization substance protein B; N 1e-33
1di0_A158 Lumazine synthase; transferase; 2.70A {Brucella ab 3e-33
1kz1_A159 6,7-dimethyl-8-ribityllumazine synthase; riboflavi 4e-33
1rvv_A154 Riboflavin synthase; transferase, flavoprotein; HE 5e-33
2obx_A157 DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine sy 2e-32
3nq4_A156 6,7-dimethyl-8-ribityllumazine synthase; 30MER, ic 2e-32
2i0f_A157 6,7-dimethyl-8-ribityllumazine synthase 1; lumazin 4e-31
1hqk_A154 6,7-dimethyl-8-ribityllumazine synthase; analysi s 4e-31
1c2y_A156 Protein (lumazine synthase); riboflavin biosynthes 1e-30
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 4e-30
1eyv_A156 NUSB protein, N-utilizing substance protein B homo 8e-30
1tzv_A142 NUSB protein, N utilization substance protein B ho 9e-30
1ejb_A168 Lumazine synthase; analysis, inhibitor complex, vi 3e-29
3r2d_A149 Protein NUSB, N utilization substance protein B; c 1e-28
2c92_A160 6,7-dimethyl-8-ribityllumazine synthase; transfera 2e-28
1c41_A200 Lumazine synthase; riboflavin biosynthesis, transf 1e-24
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2b99_A156 Riboflavin synthase; lumazine riboflavin, transfer 4e-13
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 6e-04
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Length = 350 Back     alignment and structure
 Score =  444 bits (1145), Expect = e-149
 Identities = 109/265 (41%), Positives = 171/265 (64%), Gaps = 10/265 (3%)

Query: 3   MINSKYNKRKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAIL-GNKKHCLDFNA 61
           M++      ++S+APM++ TDRH R   RQ++    LYTEM   QA+L GN++  L F  
Sbjct: 1   MLD-----PRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRP 55

Query: 62  EEHPIAFQVGDNEPKKLAKSAKIIQKWGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVS 121
           EEHPIA Q+  ++PK LA++A+I + +GYDEINLN GCPS + Q G +GA L+     V 
Sbjct: 56  EEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVR 115

Query: 122 DCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIVHARNAFLKKLNP 181
           + +KAM ++V + +TVK R+G++   +Y  +   V  ++ AG + F+VHAR+A L  L+ 
Sbjct: 116 EILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALL-ALST 174

Query: 182 KQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFL 241
           K NR+IP L++++V+ LK DFP+L  + NGGI++ +E   HL  +DGVMLGR  Y++PF+
Sbjct: 175 KANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFV 234

Query: 242 MSNFDLNYYSNLPQYKIPTRIDIIN 266
           +   D   +      + P+R+++  
Sbjct: 235 LEEADRRVFGL---PRRPSRLEVAR 256
>1g57_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavine biosynthesis, skeletal rearrangement, antimicrobial target; 1.40A {Escherichia coli} SCOP: d.115.1.2 PDB: 1g58_A 1iez_A 3ls6_A 3lrj_A 3lqu_A 3h07_A Length = 217 Back     alignment and structure
>3mio_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin, ribulose-5-phosphate, FAD, FMN; 1.80A {Mycobacterium tuberculosis} PDB: 3mgz_A 3mk5_A Length = 206 Back     alignment and structure
>1tks_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, 3,4-dihydroxy-2-B 4-phosphate synthase, synthetic gene, ISO; 1.60A {Candida albicans} SCOP: d.115.1.2 PDB: 1tku_A* 2ris_A 2riu_A* Length = 204 Back     alignment and structure
>1k4i_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesi antimicrobial target, structure-based design, isomerase; 0.98A {Magnaporthe grisea} SCOP: d.115.1.2 PDB: 1k49_A 1k4l_A 1k4o_A 1k4p_A Length = 233 Back     alignment and structure
>1snn_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, isomerase; HET: 5RP; 1.55A {Methanocaldococcus jannaschii} SCOP: d.115.1.2 PDB: 1pvy_A* 1pvw_A Length = 227 Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Length = 457 Back     alignment and structure
>3d3b_A Protein NUSB, N utilization substance protein B; NUSB, NUSE, NUT site, phage lambda, lambdan antitermina antitermination; HET: NHE; 1.30A {Escherichia coli} PDB: 3d3c_A 3imq_A 1ey1_A Length = 141 Back     alignment and structure
>1di0_A Lumazine synthase; transferase; 2.70A {Brucella abortus} SCOP: c.16.1.1 PDB: 1t13_A* 1xn1_A Length = 158 Back     alignment and structure
>1kz1_A 6,7-dimethyl-8-ribityllumazine synthase; riboflavin biosynthesis, ligand binding, transferase; 2.00A {Schizosaccharomyces pombe} SCOP: c.16.1.1 PDB: 2a59_A* 2a58_A* 2a57_A* 1kyv_A* 1kyx_A* 1kyy_A* 1kz9_A 1kz4_A 1kz6_A Length = 159 Back     alignment and structure
>1rvv_A Riboflavin synthase; transferase, flavoprotein; HET: INI; 2.40A {Bacillus subtilis} SCOP: c.16.1.1 PDB: 1zis_A* 1vsw_A 1vsx_A 3jv8_A Length = 154 Back     alignment and structure
>2obx_A DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine synthase 1, riboflavin S; alpha-beta, transferase; HET: INI; 2.53A {Mesorhizobium loti} Length = 157 Back     alignment and structure
>3nq4_A 6,7-dimethyl-8-ribityllumazine synthase; 30MER, icosahedral, flavodoxin like fold, transferase, DMRL riboflavin biosynthesis, drug targe; 3.50A {Salmonella typhimurium} PDB: 3mk3_A Length = 156 Back     alignment and structure
>2i0f_A 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine synthase RIBH1, transferase; 2.22A {Brucella abortus} PDB: 2f59_A 2o6h_A* Length = 157 Back     alignment and structure
>1hqk_A 6,7-dimethyl-8-ribityllumazine synthase; analysi stability, vitamin biosynthesis, transferase; 1.60A {Aquifex aeolicus} SCOP: c.16.1.1 PDB: 1nqu_A* 1nqv_A* 1nqw_A* 1nqx_A* Length = 154 Back     alignment and structure
>1c2y_A Protein (lumazine synthase); riboflavin biosynthesis, transferase; HET: LMZ; 3.30A {Spinacia oleracea} SCOP: c.16.1.1 Length = 156 Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Length = 318 Back     alignment and structure
>1eyv_A NUSB protein, N-utilizing substance protein B homolog; helical bundle, structural genomics, PSI, protein structure initiative; 1.60A {Mycobacterium tuberculosis} SCOP: a.79.1.1 Length = 156 Back     alignment and structure
>1tzv_A NUSB protein, N utilization substance protein B homolog; RNA-protein interaction, transcriptional antitermination, transcription regulation; 1.35A {Thermotoga maritima} SCOP: a.79.1.1 PDB: 1tzu_A 1tzt_A 1tzw_A 1tzx_A* Length = 142 Back     alignment and structure
>1ejb_A Lumazine synthase; analysis, inhibitor complex, vitamin biosynthesis transferase; HET: INJ; 1.85A {Saccharomyces cerevisiae} SCOP: c.16.1.1 PDB: 2jfb_A Length = 168 Back     alignment and structure
>3r2d_A Protein NUSB, N utilization substance protein B; cross species NUSB-NUSE-RNA interaction; 2.20A {Aquifex aeolicus} PDB: 2jr0_A 3r2c_A* Length = 149 Back     alignment and structure
>2c92_A 6,7-dimethyl-8-ribityllumazine synthase; transferase, riboflavin biosynthesis, inhibitor binding; HET: TP6; 1.6A {Mycobacterium tuberculosis} PDB: 1w29_A* 1w19_A* 2c94_A* 2c97_A* 2c9b_A* 2c9d_A* 2vi5_A* Length = 160 Back     alignment and structure
>1c41_A Lumazine synthase; riboflavin biosynthesis, transferase; HET: LMZ; 3.10A {Magnaporthe grisea} SCOP: c.16.1.1 Length = 200 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2b99_A Riboflavin synthase; lumazine riboflavin, transferase; HET: RDL; 2.22A {Methanocaldococcus jannaschii} PDB: 2b98_A* Length = 156 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query956
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 100.0
1olt_A457 Oxygen-independent coproporphyrinogen III oxidase; 100.0
1tks_A204 3,4-dihydroxy-2-butanone 4-phosphate synthase; rib 100.0
1k4i_A233 3,4-dihydroxy-2-butanone 4-phosphate synthase; rib 100.0
3mio_A206 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphat 100.0
1snn_A227 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphat 100.0
1g57_A217 DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphat 100.0
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 100.0
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 100.0
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 100.0
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 100.0
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 100.0
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 100.0
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 100.0
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 100.0
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 99.98
3nq4_A156 6,7-dimethyl-8-ribityllumazine synthase; 30MER, ic 99.97
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 99.97
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 99.97
1kz1_A159 6,7-dimethyl-8-ribityllumazine synthase; riboflavi 99.97
2i0f_A157 6,7-dimethyl-8-ribityllumazine synthase 1; lumazin 99.97
1c2y_A156 Protein (lumazine synthase); riboflavin biosynthes 99.97
1hqk_A154 6,7-dimethyl-8-ribityllumazine synthase; analysi s 99.97
1rvv_A154 Riboflavin synthase; transferase, flavoprotein; HE 99.97
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 99.97
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 99.97
1ejb_A168 Lumazine synthase; analysis, inhibitor complex, vi 99.97
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 99.97
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.97
1di0_A158 Lumazine synthase; transferase; 2.70A {Brucella ab 99.97
2c92_A160 6,7-dimethyl-8-ribityllumazine synthase; transfera 99.97
2obx_A157 DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine sy 99.97
1c41_A200 Lumazine synthase; riboflavin biosynthesis, transf 99.94
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.96
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.96
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 99.95
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 99.95
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 99.95
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 99.95
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 99.95
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 99.94
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 99.94
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 99.94
2b99_A156 Riboflavin synthase; lumazine riboflavin, transfer 99.93
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 99.93
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 99.93
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 99.92
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 99.92
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 99.91
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 99.9
2qgq_A304 Protein TM_1862; alpha-beta protein, structural ge 99.89
3d3b_A141 Protein NUSB, N utilization substance protein B; N 99.86
1tzv_A142 NUSB protein, N utilization substance protein B ho 99.85
3r2d_A149 Protein NUSB, N utilization substance protein B; c 99.85
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 99.84
1r30_A369 Biotin synthase; SAM radical protein, TIM barrel, 99.82
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 99.82
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 99.8
1eyv_A156 NUSB protein, N-utilizing substance protein B homo 99.8
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 99.8
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 99.8
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.76
3t7v_A350 Methylornithine synthase PYLB; TIM-barrel fold, mu 99.75
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 99.74
3iix_A348 Biotin synthetase, putative; adoMet radical, SAM r 99.74
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 99.71
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.68
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 99.65
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.63
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 99.63
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 99.62
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 99.6
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.58
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 99.58
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 99.57
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 99.54
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 99.48
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 99.42
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 99.41
3c8f_A245 Pyruvate formate-lyase 1-activating enzyme; adoMet 99.36
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 99.36
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 99.35
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 99.33
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 99.33
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 99.29
2yx0_A342 Radical SAM enzyme; predicted tRNA modification en 99.29
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 99.29
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 99.27
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 99.23
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 99.2
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 99.18
1tv8_A340 MOAA, molybdenum cofactor biosynthesis protein A; 99.17
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 99.13
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 99.11
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.1
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 99.1
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 99.07
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 99.06
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 99.05
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 99.05
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 99.04
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 99.01
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.98
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.98
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 98.97
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 98.91
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 98.87
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 98.87
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 98.86
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.85
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 98.82
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.82
2z2u_A311 UPF0026 protein MJ0257; metal binding protein; 2.4 98.8
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 98.79
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 98.78
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 98.77
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 98.76
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 98.76
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 98.73
3eez_A378 Putative mandelate racemase/muconate lactonizing e 98.71
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 98.7
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 98.68
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 98.67
2qgy_A391 Enolase from the environmental genome shotgun sequ 98.67
2gl5_A410 Putative dehydratase protein; structural genomics, 98.65
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 98.62
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 98.61
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 98.61
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 98.61
2a5h_A416 L-lysine 2,3-aminomutase; radical SAM, four-iron-f 98.6
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 98.56
2poz_A392 Putative dehydratase; octamer, structural genomics 98.55
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 98.53
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 98.53
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 98.48
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.48
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 98.47
2oz8_A389 MLL7089 protein; structural genomics, unknown func 98.47
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 98.46
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 98.45
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 98.44
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 98.44
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 98.39
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 98.37
2o56_A407 Putative mandelate racemase; dehydratase, structur 98.36
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 98.35
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 98.35
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 98.33
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 98.33
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 98.31
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 98.31
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.3
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 98.3
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 98.28
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 98.28
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 98.27
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 98.25
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 98.25
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 98.21
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 98.2
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 98.2
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 98.2
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 98.2
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 98.18
1tzz_A392 Hypothetical protein L1841; structural genomics, m 98.17
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 98.15
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 98.14
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 98.12
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 98.11
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 98.1
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 98.1
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 98.08
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 98.07
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 98.06
1ofd_A1520 Ferredoxin-dependent glutamate synthase 2; oxidore 98.06
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.05
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 98.05
3rfa_A404 Ribosomal RNA large subunit methyltransferase N; r 98.04
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 98.04
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 98.03
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.02
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 98.01
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 98.01
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 98.01
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 97.96
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.93
1viz_A240 PCRB protein homolog; structural genomics, unknown 97.92
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 97.91
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 97.91
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 97.91
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 97.91
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 97.89
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 97.89
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 97.87
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 97.84
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 97.84
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 97.84
3can_A182 Pyruvate-formate lyase-activating enzyme; structur 97.84
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 97.83
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 97.82
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 97.82
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.82
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 97.8
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 97.79
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 97.79
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 97.77
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 97.76
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 97.76
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 97.75
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 97.74
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 97.74
3r0u_A379 Enzyme of enolase superfamily; structural genomics 97.74
3oa3_A288 Aldolase; structural genomics, seattle structural 97.74
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 97.73
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 97.73
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 97.72
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 97.72
1ujp_A271 Tryptophan synthase alpha chain; riken structural 97.71
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 97.69
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 97.69
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 97.69
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 97.67
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 97.67
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 97.66
1ea0_A1479 Glutamate synthase [NADPH] large chain; oxidoreduc 97.61
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 97.61
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 97.6
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 97.59
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.58
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 97.58
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 97.56
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 97.56
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 97.56
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 97.55
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 97.53
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 97.52
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.5
3tha_A252 Tryptophan synthase alpha chain; structural genomi 97.47
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 97.47
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 97.45
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 97.41
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.4
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 97.4
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 97.4
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 97.39
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 97.38
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.37
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 97.36
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 97.32
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 97.31
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 97.24
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 97.16
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 97.15
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 97.14
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 97.03
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 97.02
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 96.99
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 96.99
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 96.98
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 96.97
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 96.92
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 96.91
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 96.89
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.77
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 96.73
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 96.72
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 96.72
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 96.68
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 96.65
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 96.63
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 96.62
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 96.6
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 96.59
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 96.58
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 96.51
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 96.49
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 96.47
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 96.43
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 96.42
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 96.4
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 96.39
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 96.37
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 96.36
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 96.33
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 96.32
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 96.28
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 96.26
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 96.18
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 96.1
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 96.09
3u9i_A393 Mandelate racemase/muconate lactonizing enzyme, C 95.97
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 95.91
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 95.91
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 95.88
3s5s_A389 Mandelate racemase/muconate lactonizing enzyme FA 95.86
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 95.83
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 95.81
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 95.78
2ozt_A332 TLR1174 protein; structural genomics, O-succinylbe 95.77
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 95.71
4h83_A388 Mandelate racemase/muconate lactonizing enzyme; st 95.54
3kts_A192 Glycerol uptake operon antiterminator regulatory; 95.48
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 95.46
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 95.43
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 95.3
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 95.27
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 95.25
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.17
3va8_A445 Probable dehydratase; enolase, magnesium binding s 95.1
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 95.1
3vdg_A445 Probable glucarate dehydratase; enolase, magnesium 95.04
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.03
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 95.01
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 94.91
3qld_A388 Mandelate racemase/muconate lactonizing protein; s 94.84
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 94.83
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 94.79
3cyj_A372 Mandelate racemase/muconate lactonizing enzyme-LI 94.77
4fhd_A368 Spore photoproduct lyase; partial TIM-barrel, DNA 94.69
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 94.68
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 94.66
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 94.64
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 94.56
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 94.45
3vc5_A441 Mandelate racemase/muconate lactonizing protein; d 94.45
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 94.4
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 94.11
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 94.01
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 93.99
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 93.98
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 93.96
3ijl_A338 Muconate cycloisomerase; enolase superfamily, dipe 93.85
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 93.84
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 93.83
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 93.58
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 93.54
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 93.51
3p0w_A470 Mandelate racemase/muconate lactonizing protein; s 93.39
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 93.32
3mzn_A450 Glucarate dehydratase; lyase, structural genomics, 93.26
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 93.25
4h2h_A376 Mandelate racemase/muconate lactonizing enzyme; en 93.22
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 93.14
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 92.94
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 92.92
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 92.76
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 92.64
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 92.63
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 92.6
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 92.43
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 92.31
2opj_A327 O-succinylbenzoate-COA synthase; TIM barrel, struc 92.3
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 92.15
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 92.14
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 92.1
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 92.03
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 91.92
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 91.89
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 91.77
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 91.76
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 91.69
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 91.67
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 91.67
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 91.6
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 91.53
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 91.49
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 91.49
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 91.47
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 91.46
3v5c_A392 Mandelate racemase/muconate lactonizing protein; e 91.36
3pfr_A455 Mandelate racemase/muconate lactonizing protein; e 91.27
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 91.23
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 91.22
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 91.15
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 91.14
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 91.0
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 90.99
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 90.99
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 90.98
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 90.97
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 90.87
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 90.87
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 90.83
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, tr 90.82
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 90.81
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 90.75
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 90.72
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 90.69
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 90.67
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 90.67
3nl6_A540 Thiamine biosynthetic bifunctional enzyme; thiamin 90.66
1jpd_X324 L-Ala-D/L-Glu epimerase; enolase superfamily, muco 90.65
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 90.54
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 90.49
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 90.44
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 90.42
3n9r_A307 Fructose-bisphosphate aldolase; FBP aldolase, clas 90.28
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 90.27
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 90.25
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 90.24
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 90.22
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 90.22
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 90.19
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 90.13
3p6l_A262 Sugar phosphate isomerase/epimerase; TIM barrel, s 90.1
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 90.03
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 89.95
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 89.93
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 89.88
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 89.87
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 89.86
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 89.86
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 89.73
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 89.7
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 89.68
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 89.6
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 89.6
3lmz_A257 Putative sugar isomerase; structural genomics, joi 89.55
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 89.51
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 89.48
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 89.42
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 89.39
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 89.35
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 89.26
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 89.17
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 89.16
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 89.13
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 89.06
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 89.01
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 89.01
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 88.94
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 88.93
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 88.85
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 88.85
3gk0_A278 PNP synthase, pyridoxine 5'-phosphate synthase; de 88.74
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 88.68
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 88.64
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 88.64
2p8t_A 200 Hypothetical protein PH0730; pyrococcus horikoshii 88.58
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 88.56
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 88.46
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 88.45
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 88.44
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 88.44
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 88.39
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 88.34
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 88.33
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 88.25
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 88.17
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 88.16
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 88.05
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 88.02
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 87.98
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 87.98
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 87.95
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 87.92
3ech_A142 MEXR, multidrug resistance operon repressor; winge 87.89
2h09_A155 Transcriptional regulator MNTR; transcription regu 87.8
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 87.78
1kko_A413 3-methylaspartate ammonia-lyase; enolase superfami 87.72
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 87.71
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 87.66
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 87.65
1bja_A95 Transcription regulatory protein MOTA; activation 87.56
1kcz_A413 Beta-methylaspartase; beta zigzag, alpha/beta-barr 87.55
3oop_A143 LIN2960 protein; protein structure initiative, PSI 87.54
2egz_A219 3-dehydroquinate dehydratase; aquifex aeolicus VF5 87.53
3e6m_A161 MARR family transcriptional regulator; APC88769, s 87.44
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 87.38
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 87.36
2hr3_A147 Probable transcriptional regulator; MCSG, structur 87.29
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 87.26
2pg4_A95 Uncharacterized protein; structural genomics, join 87.21
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 87.13
3s2w_A159 Transcriptional regulator, MARR family; structural 87.02
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 86.88
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 86.85
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 86.8
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 86.77
1q7z_A566 5-methyltetrahydrofolate S-homocysteine methyltran 86.75
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 86.73
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 86.68
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 86.64
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 86.61
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 86.57
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 86.5
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 86.39
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 86.37
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 86.26
4g8t_A464 Glucarate dehydratase; enolase, enzyme function IN 86.24
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 86.23
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 86.17
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 86.15
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 86.15
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 86.11
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 86.1
3noy_A366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 86.08
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 86.07
2okt_A342 OSB synthetase, O-succinylbenzoic acid synthetase; 86.01
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 86.0
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
Probab=100.00  E-value=2.8e-50  Score=451.75  Aligned_cols=297  Identities=38%  Similarity=0.637  Sum_probs=257.4

Q ss_pred             CCCceEEccCcCcCCHHHHHHHHHcCCCcEEEeccccccccc-CCchhccccCCCCCCEEEEecCCCHHHHHHHHHHHHH
Q psy2378           9 NKRKISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAIL-GNKKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQK   87 (956)
Q Consensus         9 ~~~~i~lAPM~~~td~~fR~~~~~~g~~~l~~tem~~~~~l~-~~~~~~~~~~~~~~p~~vQl~g~~~~~~~~aA~~~~~   87 (956)
                      ++||+++|||+|+||.+||++++++|++|++||||++++.++ +...++..+++.+.|+++||+|++|+.|+++|+++++
T Consensus         2 l~nriv~APM~g~td~~~r~~~r~~Gg~gli~te~~~~~~~~~~~~~~~~~~~~~~~p~~vQL~g~~p~~~~~aA~~a~~   81 (350)
T 3b0p_A            2 LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEA   81 (350)
T ss_dssp             CCCSEEECCCTTTSSHHHHHHHHHHCSSSBEECCCEEHHHHHHSCHHHHHCCCGGGCSEEEEEECSCHHHHHHHHHHHHH
T ss_pred             CCCCEEECCCCCCCHHHHHHHHHHcCCCCEEEeCCEEechhhcCCHHHHhccCCCCCeEEEEeCCCCHHHHHHHHHHHHH
Confidence            489999999999999999999999998899999999999887 5555667788999999999999999999999999999


Q ss_pred             cCCCEEEecCCCCcceeeeCcccccccCChHHHHHHHHHHhhccCccEEEEeccCCCCCCcHHHHHHHHHHHHHcCCCEE
Q psy2378          88 WGYDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTF  167 (956)
Q Consensus        88 ~G~d~IeiN~gCP~~~~~~~~~G~~l~~~~~~~~eiv~~v~~~~~~pv~vKir~g~~~~~~~~~~~~~a~~l~~~G~~~i  167 (956)
                      +|||+||||+|||.+|+++++||++|++|++++.+|++++++++++||++|+|+||++..+.+++.++++.++++|+|+|
T Consensus        82 ~G~D~IeIn~gcP~~~~~~d~~G~~l~~~~~~~~eiv~av~~~v~~PV~vKiR~g~~~~~~~~~~~~~a~~l~~aG~d~I  161 (350)
T 3b0p_A           82 FGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVF  161 (350)
T ss_dssp             TTCSEEEEEECCCSHHHHHTTCGGGGGGCHHHHHHHHHHHHHHCSSCEEEEEESCBTTCCCHHHHHHHHHHHHHTTCCEE
T ss_pred             cCCCEEEECCcCCCCcCcCCCcchhHHhCHHHHHHHHHHHHHHhCCceEEEEecCcCccccHHHHHHHHHHHHHcCCCEE
Confidence            99999999999999999999999999999999999999999999999999999999987766678999999999999999


Q ss_pred             EEcccccccccCCCCCCCCCCcCcHHHHHHHHHhCCCceEEEecCCCCHHHHHHHhhhcCEEEEccccccCCcchHHHHH
Q psy2378         168 IVHARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNYIDGVMLGREAYKNPFLMSNFDL  247 (956)
Q Consensus       168 ~vh~r~~~~~g~~~~~~~~~~~~~~~~i~~v~~~~~~ipVi~nGgI~s~~da~~~l~~ad~VmiGR~~l~~P~l~~~i~~  247 (956)
                      +||+|+.+ +|++|..+++.++.+|++++++++.++++|||+||||.|+++++++++.||+||+||+++.|||+|+++++
T Consensus       162 ~V~~r~~~-~g~~g~~~~~~~~~~~~~i~~ik~~~~~iPVianGgI~s~eda~~~l~GaD~V~iGRa~l~~P~l~~~i~~  240 (350)
T 3b0p_A          162 VVHARSAL-LALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLKRVDGVMLGRAVYEDPFVLEEADR  240 (350)
T ss_dssp             EEECSCBC-----------CCCCCHHHHHHHHHHCTTSEEEEESSCCSHHHHHHHHTTSSEEEECHHHHHCGGGGTTHHH
T ss_pred             EEecCchh-cccCcccccCCCcccHHHHHHHHHhCCCCeEEEECCcCCHHHHHHHHhCCCEEEECHHHHhCcHHHHHHHH
Confidence            99999863 36666655566778999999999998789999999999999999999779999999999999999999999


Q ss_pred             hhccCCCCCCCCCHHHHHHHHHhhhhcccccccccCCCCHHHHHHHHHhhcccccccCCHHHHHHccCccccc
Q psy2378         248 NYYSNLPQYKIPTRIDIINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLKLDMMTK  320 (956)
Q Consensus       248 ~~~~~~~~~~~~~~~e~~~~~~~~~e~egdlv~~a~~~t~~~v~fm~~y~~Glic~~l~~~~~~~L~l~~m~~  320 (956)
                      .+++ ..  +.+++.|+++.+++|.+.....   .+ ....+++|+.||++|+       +.+.+++..++..
T Consensus       241 ~l~~-~~--~~~~~~~~~~~~~~~~~~~~~~---g~-~~~~~~kh~~~~~~g~-------~~~~~~r~~l~~~  299 (350)
T 3b0p_A          241 RVFG-LP--RRPSRLEVARRMRAYLEEEVLK---GT-PPWAVLRHMLNLFRGR-------PKGRLWRRLLSEG  299 (350)
T ss_dssp             HTTC-CS--CCCCHHHHHHHHHHHHHHHHHH---TC-CHHHHHTTSTTTTTTS-------TTHHHHHHHHHHH
T ss_pred             HhcC-CC--CCCCHHHHHHHHHHHHHHHHHc---Cc-cHHHHHHHHHHHHccC-------CCHHHHHHHHHCC
Confidence            8876 33  6789999999999998865441   11 2345777888888887       5666777666654
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
>1tks_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, 3,4-dihydroxy-2-B 4-phosphate synthase, synthetic gene, ISO; 1.60A {Candida albicans} SCOP: d.115.1.2 PDB: 1tku_A* 2ris_A 2riu_A* Back     alignment and structure
>1k4i_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesi antimicrobial target, structure-based design, isomerase; 0.98A {Magnaporthe grisea} SCOP: d.115.1.2 PDB: 1k49_A 1k4l_A 1k4o_A 1k4p_A Back     alignment and structure
>3mio_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin, ribulose-5-phosphate, FAD, FMN; 1.80A {Mycobacterium tuberculosis} SCOP: d.115.1.0 PDB: 3mgz_A 3mk5_A Back     alignment and structure
>1snn_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, isomerase; HET: 5RP; 1.55A {Methanocaldococcus jannaschii} SCOP: d.115.1.2 PDB: 1pvy_A* 1pvw_A Back     alignment and structure
>1g57_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavine biosynthesis, skeletal rearrangement, antimicrobial target; 1.40A {Escherichia coli} SCOP: d.115.1.2 PDB: 1g58_A 1iez_A 3ls6_A 3lrj_A 3lqu_A 3h07_A Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3nq4_A 6,7-dimethyl-8-ribityllumazine synthase; 30MER, icosahedral, flavodoxin like fold, transferase, DMRL riboflavin biosynthesis, drug targe; 3.50A {Salmonella typhimurium} PDB: 3mk3_A Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1kz1_A 6,7-dimethyl-8-ribityllumazine synthase; riboflavin biosynthesis, ligand binding, transferase; 2.00A {Schizosaccharomyces pombe} SCOP: c.16.1.1 PDB: 2a59_A* 2a58_A* 2a57_A* 1kyv_A* 1kyx_A* 1kyy_A* 1kz9_A 1kz4_A 1kz6_A Back     alignment and structure
>2i0f_A 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine synthase RIBH1, transferase; 2.22A {Brucella abortus} PDB: 2f59_A 2o6h_A* Back     alignment and structure
>1c2y_A Protein (lumazine synthase); riboflavin biosynthesis, transferase; HET: LMZ; 3.30A {Spinacia oleracea} SCOP: c.16.1.1 Back     alignment and structure
>1hqk_A 6,7-dimethyl-8-ribityllumazine synthase; analysi stability, vitamin biosynthesis, transferase; 1.60A {Aquifex aeolicus} SCOP: c.16.1.1 PDB: 1nqu_A* 1nqv_A* 1nqw_A* 1nqx_A* Back     alignment and structure
>1rvv_A Riboflavin synthase; transferase, flavoprotein; HET: INI; 2.40A {Bacillus subtilis} SCOP: c.16.1.1 PDB: 1zis_A* 1vsw_A 1vsx_A 3jv8_A Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>1ejb_A Lumazine synthase; analysis, inhibitor complex, vitamin biosynthesis transferase; HET: INJ; 1.85A {Saccharomyces cerevisiae} SCOP: c.16.1.1 PDB: 2jfb_A Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1di0_A Lumazine synthase; transferase; 2.70A {Brucella abortus} SCOP: c.16.1.1 PDB: 1t13_A* 1xn1_A Back     alignment and structure
>2c92_A 6,7-dimethyl-8-ribityllumazine synthase; transferase, riboflavin biosynthesis, inhibitor binding; HET: TP6; 1.6A {Mycobacterium tuberculosis} PDB: 1w29_A* 1w19_A* 2c94_A* 2c97_A* 2c9b_A* 2c9d_A* 2vi5_A* Back     alignment and structure
>2obx_A DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine synthase 1, riboflavin S; alpha-beta, transferase; HET: INI; 2.53A {Mesorhizobium loti} Back     alignment and structure
>1c41_A Lumazine synthase; riboflavin biosynthesis, transferase; HET: LMZ; 3.10A {Magnaporthe grisea} SCOP: c.16.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>2b99_A Riboflavin synthase; lumazine riboflavin, transferase; HET: RDL; 2.22A {Methanocaldococcus jannaschii} PDB: 2b98_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Back     alignment and structure
>3d3b_A Protein NUSB, N utilization substance protein B; NUSB, NUSE, NUT site, phage lambda, lambdan antitermina antitermination; HET: NHE; 1.30A {Escherichia coli} PDB: 3d3c_A 3imq_A 1ey1_A Back     alignment and structure
>1tzv_A NUSB protein, N utilization substance protein B homolog; RNA-protein interaction, transcriptional antitermination, transcription regulation; 1.35A {Thermotoga maritima} SCOP: a.79.1.1 PDB: 1tzu_A 1tzt_A 1tzw_A 1tzx_A* Back     alignment and structure
>3r2d_A Protein NUSB, N utilization substance protein B; cross species NUSB-NUSE-RNA interaction; 2.20A {Aquifex aeolicus} PDB: 2jr0_A 3r2c_A* 4eya_A Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1eyv_A NUSB protein, N-utilizing substance protein B homolog; helical bundle, structural genomics, PSI, protein structure initiative; 1.60A {Mycobacterium tuberculosis} SCOP: a.79.1.1 Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A* Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii} Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3rfa_A Ribosomal RNA large subunit methyltransferase N; radical SAM, S-adenosylmethionine, iron sulfur cluster, oxidoreductase; HET: SAM; 2.05A {Escherichia coli} PDB: 3rf9_A* Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, pyruvate-formate lyase-activating enzym MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>2ozt_A TLR1174 protein; structural genomics, O-succinylbenzoate synthase, PSI, protein structure initiative; 1.42A {Synechococcus elongatus} PDB: 3h7v_A Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>3cyj_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, isomerase, PSI-2; 2.30A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>4fhd_A Spore photoproduct lyase; partial TIM-barrel, DNA repair, damaged DNA; HET: EEM 0TT; 2.00A {Geobacillus thermodenitrificans} PDB: 4fhc_A* 4fhg_A* 4fhe_A* 4fhf_A* Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>3ijl_A Muconate cycloisomerase; enolase superfamily, dipeptide epimerase, L-Pro-D-Glu, nonpr binding; HET: DGL; 1.50A {Bacteroides thetaiotaomicron} PDB: 3iji_A* 3ijq_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 4hn8_A 3nxl_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>4h2h_A Mandelate racemase/muconate lactonizing enzyme; enolase, mandelate racemase subgroup, enzyme function initia EFI, structural genomics; HET: 0XW; 1.70A {Pelagibaca bermudensis} PDB: 2pmq_A* Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2opj_A O-succinylbenzoate-COA synthase; TIM barrel, structural genomics, protein structure initiative; 1.60A {Thermobifida fusca} PDB: 2qvh_A* Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3v5c_A Mandelate racemase/muconate lactonizing protein; enolase fold, galacturonate dehydratase, double Mg site, LYA; 1.53A {Paenibacillus SP} PDB: 3v5f_A* 3p3b_A* 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3pfr_A Mandelate racemase/muconate lactonizing protein; emolase superfamily fold, D-glucarate dehydratase, D-glucara isomerase; HET: GKR; 1.90A {Actinobacillus succinogenes} PDB: 3n6j_A 3n6h_A* 4gyp_C* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>1jpd_X L-Ala-D/L-Glu epimerase; enolase superfamily, muconate lactonizing enzyme subgroup, alpha/beta barrel, structural genomics, isomerase; 2.60A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3n9r_A Fructose-bisphosphate aldolase; FBP aldolase, class II, inhibitor, lyase; HET: TD3; 1.80A {Helicobacter pylori} SCOP: c.1.10.0 PDB: 3c52_A* 3c56_A* 3c4u_A* 3n9s_A* Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei} Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* 3zvi_A 3zvh_A Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>4g8t_A Glucarate dehydratase; enolase, enzyme function INI EFI, structural genomics, lyase; 1.70A {Actinobacillus succinogenes} PDB: 1ec7_A 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 3pwi_A* 1jct_A* 3pwg_A* 1bqg_A Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>2okt_A OSB synthetase, O-succinylbenzoic acid synthetase; enolase, structural genom protein structure initiative, PSI, nysgrc; 1.30A {Staphylococcus aureus subsp} PDB: 2ola_A 3h70_A Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 956
d1snna_219 d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphat 2e-48
d1g57a_209 d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphat 3e-47
d1tksa_202 d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphat 5e-45
d1k4ia_216 d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphat 7e-42
d1olta_441 c.1.28.2 (A:) Oxygen-independent coproporphyrinoge 7e-36
d1vhna_305 c.1.4.1 (A:) Putative flavin oxidoreducatase TM009 2e-28
d1ey1a_139 a.79.1.1 (A:) Antitermination factor NusB {Escheri 1e-19
d1eyva_131 a.79.1.1 (A:) Antitermination factor NusB {Mycobac 9e-18
d1c41a_195 c.16.1.1 (A:) Lumazine synthase {Rice blast fungus 2e-17
d1kz1a_150 c.16.1.1 (A:) Lumazine synthase {Fission yeast (Sc 3e-17
d1tzva_141 a.79.1.1 (A:) Antitermination factor NusB {Thermot 3e-17
d1di0a_148 c.16.1.1 (A:) Lumazine synthase {Brucella abortus 2e-16
d1ejba_168 c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Sa 6e-16
d1rvv1_154 c.16.1.1 (1:) Lumazine synthase {Bacillus subtilis 1e-15
d1c2ya_155 c.16.1.1 (A:) Lumazine synthase {Spinach (Spinacia 1e-15
d1ep3a_311 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactoco 1e-15
d1nqua_154 c.16.1.1 (A:) Lumazine synthase {Aquifex aeolicus 2e-14
d1sqga1140 a.79.1.3 (A:5-144) Ribosomal RNA small subunit met 2e-12
d1gtea2312 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenas 5e-09
d1ps9a1330 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-ter 2e-06
d1z41a1337 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacill 1e-04
>d1snna_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 219 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: YrdC/RibB
superfamily: YrdC/RibB
family: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB
domain: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB
species: Archaeon Methanocaldococcus jannaschii [TaxId: 2190]

 Score =  168 bits (428), Expect = 2e-48
 Identities = 61/198 (30%), Positives = 92/198 (46%), Gaps = 32/198 (16%)

Query: 264 IINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLKLDMMTKKNN 323
           I+  DS+ RE E D++++S F+TP  I  M K A GLIC  L    C +L +  M     
Sbjct: 16  ILVYDSDEREGETDMVVASQFITPEHIRIMRKDAGGLICTALHPDICNKLGIPFMVDILE 75

Query: 324 S------------------SFGTNFTVSIEAANGVTTGISASDRAHTIK--VASSKKAKP 363
                                 ++F+++I       TGI+ +DRA TIK      K+ + 
Sbjct: 76  FASQKFKVLRELYPNDIPYDEKSSFSITINHRK-TFTGITDNDRAFTIKKLAELVKEGRF 134

Query: 364 SD----IVQPGHIFPLQAKKGGVLIRGGHTEAGCDLTKLAGLTPSAVICEILNDDGTMAR 419
           +D       PG +  L+A +G V  R GHTE    L +LA L P   ICE++ DDG    
Sbjct: 135 NDFGKEFRSPGSVTLLRAAEGLVKNRQGHTEMTVALAELANLVPITTICEMMGDDGNAMS 194

Query: 420 -------AQEKNILHISV 430
                  A++ N++++S 
Sbjct: 195 KNETKRYAEKHNLIYLSG 212
>d1g57a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure
>d1tksa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans [TaxId: 5476]} Length = 202 Back     information, alignment and structure
>d1k4ia_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Magnaporthe grisea [TaxId: 148305]} Length = 216 Back     information, alignment and structure
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Length = 441 Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Length = 305 Back     information, alignment and structure
>d1ey1a_ a.79.1.1 (A:) Antitermination factor NusB {Escherichia coli [TaxId: 562]} Length = 139 Back     information, alignment and structure
>d1eyva_ a.79.1.1 (A:) Antitermination factor NusB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 131 Back     information, alignment and structure
>d1c41a_ c.16.1.1 (A:) Lumazine synthase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 195 Back     information, alignment and structure
>d1kz1a_ c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 150 Back     information, alignment and structure
>d1tzva_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima [TaxId: 2336]} Length = 141 Back     information, alignment and structure
>d1di0a_ c.16.1.1 (A:) Lumazine synthase {Brucella abortus [TaxId: 235]} Length = 148 Back     information, alignment and structure
>d1ejba_ c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 168 Back     information, alignment and structure
>d1rvv1_ c.16.1.1 (1:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]} Length = 154 Back     information, alignment and structure
>d1c2ya_ c.16.1.1 (A:) Lumazine synthase {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 155 Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 311 Back     information, alignment and structure
>d1nqua_ c.16.1.1 (A:) Lumazine synthase {Aquifex aeolicus [TaxId: 63363]} Length = 154 Back     information, alignment and structure
>d1sqga1 a.79.1.3 (A:5-144) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Length = 312 Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Length = 337 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query956
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 100.0
d1olta_441 Oxygen-independent coproporphyrinogen III oxidase 100.0
d1g57a_209 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHB 100.0
d1tksa_202 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHB 100.0
d1k4ia_216 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHB 100.0
d1snna_219 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHB 100.0
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 99.97
d1kz1a_150 Lumazine synthase {Fission yeast (Schizosaccharomy 99.97
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 99.97
d1nqua_154 Lumazine synthase {Aquifex aeolicus [TaxId: 63363] 99.97
d1c2ya_155 Lumazine synthase {Spinach (Spinacia oleracea) [Ta 99.96
d1rvv1_154 Lumazine synthase {Bacillus subtilis [TaxId: 1423] 99.96
d1c41a_195 Lumazine synthase {Rice blast fungus (Magnaporthe 99.96
d1di0a_148 Lumazine synthase {Brucella abortus [TaxId: 235]} 99.96
d1ejba_168 Lumazine synthase {Baker's yeast (Saccharomyces ce 99.96
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 99.95
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 99.94
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 99.93
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 99.92
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 99.91
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.91
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 99.9
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 99.88
d1ey1a_139 Antitermination factor NusB {Escherichia coli [Tax 99.82
d1tzva_141 Antitermination factor NusB {Thermotoga maritima [ 99.78
d1eyva_131 Antitermination factor NusB {Mycobacterium tubercu 99.76
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.7
d1sqga1140 Ribosomal RNA small subunit methyltransferase B, R 99.65
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 99.59
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 99.53
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 99.53
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 99.52
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 99.52
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 98.98
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.86
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 98.82
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.68
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 98.54
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 98.51
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 98.34
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 98.2
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 98.18
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 98.09
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 98.09
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 98.08
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 98.06
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 98.05
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 98.04
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 97.95
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 97.81
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 97.75
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 97.74
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 97.63
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 97.63
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 97.61
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 97.58
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 97.57
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 97.53
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 97.5
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 97.44
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 97.36
d1tv8a_327 Molybdenum cofactor biosynthesis protein A MoaA {S 97.32
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 97.26
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 97.25
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 97.11
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 97.09
d1jpma1234 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 97.08
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 97.03
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 96.95
d1ofda2809 Alpha subunit of glutamate synthase, central and F 96.91
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 96.86
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 96.86
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 96.85
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 96.84
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 96.82
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 96.8
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 96.77
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 96.74
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 96.52
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 96.5
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 96.42
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 96.36
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.22
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 96.2
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 96.2
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 96.03
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 95.98
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 95.92
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 95.9
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 95.89
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 95.75
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 95.68
d1sjda1242 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 95.28
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 95.18
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 95.15
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 94.95
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 94.84
d1jpdx1208 L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 94.72
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 94.72
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 94.68
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 94.64
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 94.42
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 94.39
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 94.36
d2gdqa1256 Hypothetical protein YitF {Bacillus subtilis [TaxI 94.35
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 94.3
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 94.29
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 94.29
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 94.26
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 94.26
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 94.24
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 94.21
d1wuea1241 N-acylamino acid racemase {Enterococcus faecalis [ 94.18
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 94.17
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 94.1
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 93.76
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 93.74
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 93.66
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 93.56
d1f6ya_262 Methyltetrahydrofolate: corrinoid/iron-sulfur prot 93.47
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 93.43
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 93.42
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 93.38
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 93.08
d1jdfa1309 D-glucarate dehydratase {Escherichia coli [TaxId: 92.89
d3bofa1260 Cobalamin-dependent methionine synthase MetH, C-te 92.49
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 92.41
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 92.19
d2p8ta169 Hypothetical protein PH0730 {Pyrococcus horikoshii 92.13
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 91.73
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 91.64
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 91.36
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 91.04
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 91.01
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 90.99
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 90.86
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 90.66
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 90.48
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 90.35
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 89.99
d1mkma175 Transcriptional regulator IclR, N-terminal domain 89.66
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 89.61
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 89.21
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 89.18
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 88.61
d1kkoa1251 beta-Methylaspartase {Citrobacter amalonaticus [Ta 88.6
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 88.17
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 88.03
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 88.0
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 87.74
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 87.57
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 87.41
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 87.38
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 87.26
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 86.94
d2g50a2282 Pyruvate kinase, N-terminal domain {Rabbit (Orycto 86.62
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 86.53
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 86.53
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 86.43
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 86.02
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 85.81
d1geha1307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 85.24
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 85.16
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 84.92
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 84.87
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 84.83
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 84.77
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 84.53
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 84.41
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 84.32
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 84.13
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 84.02
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 83.62
d1kcza1253 beta-Methylaspartase {Clostridium tetanomorphum [T 83.48
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 83.03
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 82.87
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 82.77
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 82.42
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 81.96
d1wdda1325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 81.79
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 81.67
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 81.61
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 81.03
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 81.02
d1tx2a_273 Dihydropteroate synthetase {Bacillus anthracis [Ta 80.46
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 80.17
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Putative flavin oxidoreducatase TM0096
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=8.9e-56  Score=483.67  Aligned_cols=283  Identities=22%  Similarity=0.332  Sum_probs=241.7

Q ss_pred             ceEEccCcCcCCHHHHHHHHHcCCCcEEEeccccccccc-CC-chhccccCCCCCCEEEEecCCCHHHHHHHHHHHHHcC
Q psy2378          12 KISIAPMMNLTDRHCRMFHRQITRYSWLYTEMFTTQAIL-GN-KKHCLDFNAEEHPIAFQVGDNEPKKLAKSAKIIQKWG   89 (956)
Q Consensus        12 ~i~lAPM~~~td~~fR~~~~~~g~~~l~~tem~~~~~l~-~~-~~~~~~~~~~~~p~~vQl~g~~~~~~~~aA~~~~~~G   89 (956)
                      |++||||+|+||.+||++|+.+| +|++||||+++++++ +. ....+..+++++|+++||+|++|+.+++||+.+++ |
T Consensus         2 ki~LAPM~g~td~~fR~l~~~~g-~~~~~Temi~~~~~~~~~~~~~~~~~~~~e~p~~~Ql~g~~p~~~~~aa~~~~~-~   79 (305)
T d1vhna_           2 KVGLAPMAGYTDSAFRTLAFEWG-ADFAFSEMVSAKGFLMNSQKTEELLPQPHERNVAVQIFGSEPNELSEAARILSE-K   79 (305)
T ss_dssp             EEEECCCTTTCSHHHHHHHHTTT-CCCEECSCEEHHHHHTTCHHHHHHSCCTTCTTEEEEEECSCHHHHHHHHHHHTT-T
T ss_pred             eEEEECcCCCccHHHHHHHHHHC-cCEEEECCEEechhhhCChhhHhhccCCCCCCeEEEEeccchhhhhhhhhhhhh-h
Confidence            78999999999999999999998 699999999999988 43 22234467889999999999999999999987765 9


Q ss_pred             CCEEEecCCCCcceeeeCcccccccCChHHHHHHHHHHhhccCccEEEEeccCCCCCCcHHHHHHHHHHHHHcCCCEEEE
Q psy2378          90 YDEINLNCGCPSNRVQNGFFGAILMTKPLLVSDCIKAMRDSVEIDITVKHRIGIDDINSYDFVRDFVGTVSSAGCRTFIV  169 (956)
Q Consensus        90 ~d~IeiN~gCP~~~~~~~~~G~~l~~~~~~~~eiv~~v~~~~~~pv~vKir~g~~~~~~~~~~~~~a~~l~~~G~~~i~v  169 (956)
                      +|+||||||||++++.++|+|++|+++|+++.+||+++++++++|||||+|+||++..    ..++++.++++|+++|+|
T Consensus        80 ~~~IdlN~GCP~~~v~~~g~Ga~Ll~~p~~~~~iv~~~~~~~~~pvsvK~RlG~d~~~----~~~~~~~l~~~G~~~itv  155 (305)
T d1vhna_          80 YKWIDLNAGCPVRKVVKEGAGGALLKDLRHFRYIVRELRKSVSGKFSVKTRLGWEKNE----VEEIYRILVEEGVDEVFI  155 (305)
T ss_dssp             CSEEEEEECCCCHHHHHTTCGGGGGSCHHHHHHHHHHHHHHCSSEEEEEEESCSSSCC----HHHHHHHHHHTTCCEEEE
T ss_pred             eeeeeEEEEecchhhcccccceeeccCHHHHHHHhhhhhhhcccccccccccCcccch----hhHHHHHHHHhCCcEEEe
Confidence            9999999999999999999999999999999999999999999999999999998755    468899999999999999


Q ss_pred             cccccccccCCCCCCCCCCcCcHHHHHHHHHhCCCceEEEecCCCCHHHHHHHhhh--cCEEEEccccccCCcchHHHHH
Q psy2378         170 HARNAFLKKLNPKQNRKIPILKYNFVYNLKKDFPELEIIINGGIKTKKEIDLHLNY--IDGVMLGREAYKNPFLMSNFDL  247 (956)
Q Consensus       170 h~r~~~~~g~~~~~~~~~~~~~~~~i~~v~~~~~~ipVi~nGgI~s~~da~~~l~~--ad~VmiGR~~l~~P~l~~~i~~  247 (956)
                      |+||+        .+.|.++++|+.++++++   ++|||+||||.|++|+.++++.  |||||||||+++|||+|.++++
T Consensus       156 H~Rt~--------~q~~~~~a~~~~i~~~~~---~ipvi~NGdI~s~~d~~~~l~~tg~dgVMiGRgal~nP~if~~i~~  224 (305)
T d1vhna_         156 HTRTV--------VQSFTGRAEWKALSVLEK---RIPTFVSGDIFTPEDAKRALEESGCDGLLVARGAIGRPWIFKQIKD  224 (305)
T ss_dssp             ESSCT--------TTTTSSCCCGGGGGGSCC---SSCEEEESSCCSHHHHHHHHHHHCCSEEEESGGGTTCTTHHHHHHH
T ss_pred             chhhh--------hhccccchhhhHHHhhhh---hhhhhcccccccHHHHHHHHHhcCCCeEehhHHHHHhhhHhhhhhh
Confidence            99994        456677899999988765   5899999999999999999986  9999999999999999999998


Q ss_pred             hhccCCCCCCCCCHHHHHHHHHhhhhcccccccccCCCCHHHHHHHHHhhcccccccCCHHHHHHccCcccccc
Q psy2378         248 NYYSNLPQYKIPTRIDIINLDSENRENEGDIILSSDFVTPNAINFMSKYARGLICMTLTEKHCIQLKLDMMTKK  321 (956)
Q Consensus       248 ~~~~~~~~~~~~~~~e~~~~~~~~~e~egdlv~~a~~~t~~~v~fm~~y~~Glic~~l~~~~~~~L~l~~m~~~  321 (956)
                      .+.+...  ..+++.|+++.+.+|.+...++... ...-..+++|+.+|.+|+       +.+.+++-.++...
T Consensus       225 ~l~~~~~--~~~~~~e~~~~~~~~~~~~~~~~g~-~~~l~~~rkhl~~~~kg~-------p~ak~~R~~l~~~~  288 (305)
T d1vhna_         225 FLRSGKY--SEPSREEILRTFERHLELLIKTKGE-RKAVVEMRKFLAGYTKDL-------KGARRFREKVMKIE  288 (305)
T ss_dssp             HHHHSCC--CCCCHHHHHHHHHHHHHHHHHHHCH-HHHHHHHHTTHHHHTTTC-------TTHHHHHHHHTTCC
T ss_pred             hhcCCCc--ccchhHHHHHhHHHHHHHHHHhcCc-chHHHHHHHHHHHHHcCC-------CcHHHHHHHHHhCC
Confidence            8776654  5689999999998887644332110 011123556888999998       66777777776543
>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g57a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tksa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1k4ia_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Magnaporthe grisea [TaxId: 148305]} Back     information, alignment and structure
>d1snna_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kz1a_ c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nqua_ c.16.1.1 (A:) Lumazine synthase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1c2ya_ c.16.1.1 (A:) Lumazine synthase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1rvv1_ c.16.1.1 (1:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1c41a_ c.16.1.1 (A:) Lumazine synthase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1di0a_ c.16.1.1 (A:) Lumazine synthase {Brucella abortus [TaxId: 235]} Back     information, alignment and structure
>d1ejba_ c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ey1a_ a.79.1.1 (A:) Antitermination factor NusB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tzva_ a.79.1.1 (A:) Antitermination factor NusB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eyva_ a.79.1.1 (A:) Antitermination factor NusB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1sqga1 a.79.1.3 (A:5-144) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wuea1 c.1.11.2 (A:1127-1367) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1jdfa1 c.1.11.2 (A:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tx2a_ c.1.21.1 (A:) Dihydropteroate synthetase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure