Psyllid ID: psy3029


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------
MTIWDNHSLTHNTYLPTYYETDLFLLNRTNQSKEQLRRKQKEGKIQTSSLTEVSVNLPKLNYQKNNKNKKKTLIPYLEMLVSNKIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFHYSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQESLHTSSLRVYDSDNITSANPRGVVEITPLSSLDTPPLTEAETAKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQLRTGLKVSKIPVPTRNREGATTGRITEPDTMNNNNKKKNRVATTGRPVRSRGGPDRLAINPEGVYCNARFMQAITLHIGDKVTVYTVHGKQFEGYLKTFSKQFELVISMTHQVDPENPQCIDPNTVVDMKIFKLDDIVRIEAKNVDLEYAVRDTFATDTAISKFNGVIGERELEPWAEDMLGPGGDDDFELDQMCNHNVGTATSSIKMFIFPLIQVAPYTMEESVLAIQSCLRPS
ccccccccccccccccccEEccEEEEEcccccHHHHHHHHHcccccccccEEEEEcccccHHHccccccccccHHHHHHHHHccccccccccccccccccccccccEEEEEEEEEcccHHHHHHHcccccccccccccccEEEEEEEEEEccEEEEEEEEEcccccHHcccccHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcEEEEEcccEEEEEEEccccccccccccccEEEEEEEEEEccEEEEEEEEcccccccccccccccccccEEcccccHHHHHHHHHHHHHHHcccccccccccccEEEccccccccHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEccccccHHHHHccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHccccc
ccEEcccccccccccccccHHHHHHHHHHcccccEEEcccccccEEEEEHHHEHEcccHHHHcccccccccccccHHccccccccccccccccccccccccHHHHHHHEEEEccccccHHHHHHHHHHcccccccccccccEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHcHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccEEEEEEcccccHHHHHHHHHHcccccccccccEEEEEEEEcccccEEEEEEcccEEEEccccccccccccccccccccccccccccccEEEccccccccccccccEEEcccccEEHHHHHHHEHEEccccEEEEEEccccEcEEEHHHcccEEEEEEEccccccccccccccccEEEEEEEEcccEEEEEEccccHHHHHHHcccccHHHHHcccccccHcccHHHHHHccccccccccHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccc
mtiwdnhslthntylptyyetdlfllnRTNQSKEQLRRKQKegkiqtssltevsvnlpklnyqknnknkkktlIPYLEMLVSNKIKVGLLSDKFVVGLsinsrvpncfeanwfwlgvgkTSMVVRYIGKMFshhisptigasFFTAkinvgenkvKLQVWDTAGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGnktdlessrevNREEAFHYSksiggtyyetsalqdqgiEDVFLNVSKGLICLsqeslhtsslrvydsdnitsanprgvveitplssldtpplteaetAKFVVGLSinsrvpncfeanwfwlgvgkTSMVVRYIGKMFshhisptigasFFTAKINVGENKVKLQLRTglkvskipvptrnregattgritepdtmnnnnkkknrvattgrpvrsrggpdrlainpegvycnaRFMQAITLHIGDKVTVYTVHGKQFEGYLKTFSKQFELVISMThqvdpenpqcidpntvvdmkifkLDDIVRieaknvdleyavrdtfatdTAISkfngvigerelepwaedmlgpggdddfeldqmcnhnvgtatSSIKMFIFPliqvapytmEESVLAIQSCLRPS
mtiwdnhslthnTYLPTYYETDLFLLNRTNQSKEQLRRkqkegkiqtssltevsvnlpklnyqknnknkkktlIPYLEMLVSNKIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVgnktdlessrevnreEAFHYSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQESLHTSSLRVYDSDnitsanprgvveitplssldtpplTEAETAKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLqlrtglkvskipvptrnregattgritepdtmnnnnkkknrvattgrpvrsrggpdrlaiNPEGVYCNARFMQAITLHIGDKVTVYTVHGKQFEGYLKTFSKQFELVISMTHqvdpenpqcidpnTVVDMKIFKLDDIVRIeaknvdleyavrdtfatdtaiSKFNGVIGERELEPWAEDMLGPGGDDDFELDQMCNHNVGTATSSIKMFIFPLIQVAPYTMEESVLAIQSCLRPS
MTIWDNHSLTHNTYLPTYYETDLFLLNRTNQSKEQLRRKQKEGKIQTSSLTEVSVnlpklnyqknnknkkktlIPYLEMLVSNKIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFHYSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQESLHTSSLRVYDSDNITSANPRGVVEITPLSSLDTPPLTEAETAKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQLRTGLKVSKIPVPTRNREGATTGRITEPDTMNNNNKKKNRVATTGRPVRSRGGPDRLAINPEGVYCNARFMQAITLHIGDKVTVYTVHGKQFEGYLKTFSKQFELVISMTHQVDPENPQCIDPNTVVDMKIFKLDDIVRIEAKNVDLEYAVRDTFATDTAISKFNGVIGERELEPWAEDMLGPGGDDDFELDQMCNHNVGTATSSIKMFIFPLIQVAPYTMEESVLAIQSCLRPS
**IWDNHSLTHNTYLPTYYETDLFLLN*******************************************KTLIPYLEMLVSNKIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTD**********EAFHYSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQESLHTSSLRVYDSDNIT*****GVVEITPL*******LTEAETAKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQLRTGLKVS************************************************LAINPEGVYCNARFMQAITLHIGDKVTVYTVHGKQFEGYLKTFSKQFELVISMTHQVDPENPQCIDPNTVVDMKIFKLDDIVRIEAKNVDLEYAVRDTFATDTAISKFNGVIGERELEPWAEDMLGPGGDDDFELDQMCNHNVGTATSSIKMFIFPLIQVAPYTMEESVLAIQSC****
*TI***HSLTHNTYLPTYYETDLFLL************************TEVSVNLPKLN***********LIPYL*****************************CFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFHYSKSIGGTYYETSALQDQGIEDVFLNVSK**********************************************************INSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQLRTGLKVSKIPVPTRNREGATTGRITEPDTMNNNNKKK*************GGPDRLAINPEGVYCNARFMQAITLHIGDKVTVYTVHGKQFEGYLKTFSKQFEL********************VVDMKIFKLDDIVRIEAKNVDLEYAVRDTFATDTAISKFNGVIGERELEPWAEDMLGPGGDDDFELDQMCNHNVGTATSSIKMFIFPLIQVAPYTMEESVLAIQSCLR**
MTIWDNHSLTHNTYLPTYYETDLFLLNRTNQ**************QTSSLTEVSVNLPKLNYQKNNKNKKKTLIPYLEMLVSNKIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTD*********EEAFHYSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQESLHTSSLRVYDSDNITSANPRGVVEITPLSSLDTPPLTEAETAKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQLRTGLKVSKIPVPTRNREGATTGRITEPDTMNNNNKKKNRVATTGRPVRSRGGPDRLAINPEGVYCNARFMQAITLHIGDKVTVYTVHGKQFEGYLKTFSKQFELVISMTHQVDPENPQCIDPNTVVDMKIFKLDDIVRIEAKNVDLEYAVRDTFATDTAISKFNGVIGERELEPWAEDMLGPGGDDDFELDQMCNHNVGTATSSIKMFIFPLIQVAPYTMEESVLAIQSCLRPS
*TIWDNHSLTHNTYLPTYYETDLFLLNRTNQSKEQLRRKQKEGKIQTSSLTEVSVNLPKLNYQKNNKNKKKTLIPYLEMLVSNKIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFHYSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQE**************************************************INSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQLRTGLKVSKIPVPTR*********ITEPDTMNNN***KN*VATTGRPVRSRGGPDRLAINPEGVYCNARFMQAITLHIGDKVTVYTVHGKQFEGYLKTFSKQFELVISMTHQVDPENPQCIDPNTVVDMKIFKLDDIVRIEAKNVDLEYAVRDTFATDTAISKFNGVIGERELEPWAEDMLGPGGDDDFELDQMCNHNVGTATSSIKMFIFPLIQVAPYTMEESVLAIQSCLRP*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIWDNHSLTHNTYLPTYYETDLFLLNRTNQSKEQLRRKQKEGKIQTSSLTEVSVNLPKLNYQKNNKNKKKTLIPYLEMLVSNKIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFHYSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQESLHTSSLRVYDSDNITSANPRGVVEITPLSSLDTPPLTEAETAKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQLRTGLKVSKIPVPTRNREGATTGRITEPDTMNNNNKKKNRVATTGRPVRSRGGPDRLAINPEGVYCNARFMQAITLHIGDKVTVYTVHGKQFEGYLKTFSKQFELVISMTHQVDPENPQCIDPNTVVDMKIFKLDDIVRIEAKNVDLEYAVRDTFATDTAISKFNGVIGERELEPWAEDMLGPGGDDDFELDQMCNHNVGTATSSIKMFIFPLIQVAPYTMEESVLAIQSCLRPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query617 2.2.26 [Sep-21-2011]
Q17R06222 Ras-related protein Rab-2 yes N/A 0.252 0.702 0.487 2e-40
Q9UL25225 Ras-related protein Rab-2 yes N/A 0.252 0.693 0.487 2e-40
P55745223 Ras-related protein Rab-2 yes N/A 0.252 0.699 0.487 2e-40
Q6AXT5223 Ras-related protein Rab-2 yes N/A 0.252 0.699 0.480 3e-40
P35282222 Ras-related protein Rab-2 yes N/A 0.252 0.702 0.480 3e-40
Q8MYF2256 Ras-related protein RabJ yes N/A 0.246 0.593 0.486 6e-39
Q13636194 Ras-related protein Rab-3 no N/A 0.246 0.783 0.493 7e-37
Q921E2194 Ras-related protein Rab-3 no N/A 0.243 0.773 0.5 8e-37
Q6GQP4194 Ras-related protein Rab-3 no N/A 0.243 0.773 0.5 9e-37
Q8WQ53229 Ras-related protein Rab-2 N/A N/A 0.247 0.668 0.418 2e-36
>sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 111/156 (71%)

Query: 117 VGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYY 176
           VGKTS+V+RY    F+     T+ ASF T K+N+G  +V L +WDTAGQERF ++ P+YY
Sbjct: 27  VGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYY 86

Query: 177 RNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFH 236
           R++N A+LV+DIT   SF  +K WVKEL++ +   + LC+VGNK DLE  R V+ +EA  
Sbjct: 87  RDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKVDLEKERHVSIQEAES 146

Query: 237 YSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQ 272
           Y++S+G  +Y TSA Q++GIE++FL++ K +I  +Q
Sbjct: 147 YAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQ 182




Regulates integrin internalization and recycling, but does not influence the traffic of endosomally translocated receptors in general. As a result, may regulate cell adhesion and migration. During the mitosis of adherent cells, controls the endosomal trafficking of integrins which is required for the successful completion of cytokinesis.
Bos taurus (taxid: 9913)
>sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 Back     alignment and function description
>sp|P55745|RAB21_CANFA Ras-related protein Rab-21 OS=Canis familiaris GN=RAB21 PE=3 SV=3 Back     alignment and function description
>sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 Back     alignment and function description
>sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 Back     alignment and function description
>sp|Q8MYF2|RABJ_DICDI Ras-related protein RabJ OS=Dictyostelium discoideum GN=rabJ PE=3 SV=1 Back     alignment and function description
>sp|Q13636|RAB31_HUMAN Ras-related protein Rab-31 OS=Homo sapiens GN=RAB31 PE=1 SV=1 Back     alignment and function description
>sp|Q921E2|RAB31_MOUSE Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 Back     alignment and function description
>sp|Q6GQP4|RAB31_RAT Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 Back     alignment and function description
>sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query617
157128524242 low-Mr GTP-binding protein Rab31, putati 0.298 0.760 0.622 5e-61
170037970240 low-Mr GTP-binding protein Rab31 [Culex 0.298 0.766 0.611 9e-61
158295454242 AGAP006159-PA [Anopheles gambiae str. PE 0.277 0.706 0.656 3e-60
383857603217 PREDICTED: ras-related protein RabJ-like 0.278 0.792 0.610 5e-59
340723572220 PREDICTED: ras-related protein RabJ-like 0.280 0.786 0.606 2e-58
380022458221 PREDICTED: ras-related protein RabJ-like 0.280 0.782 0.601 8e-58
270010105238 hypothetical protein TcasGA2_TC009462 [T 0.322 0.836 0.549 3e-57
91085709224 PREDICTED: similar to AGAP006159-PA [Tri 0.320 0.883 0.551 7e-57
110761970221 PREDICTED: ras-related protein RabJ-like 0.280 0.782 0.583 2e-56
345490640219 PREDICTED: ras-related protein RabJ-like 0.278 0.785 0.618 5e-56
>gi|157128524|ref|XP_001661468.1| low-Mr GTP-binding protein Rab31, putative [Aedes aegypti] gi|108872544|gb|EAT36769.1| AAEL011171-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  242 bits (617), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 149/188 (79%), Gaps = 4/188 (2%)

Query: 116 GVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMY 175
           GVGKTS+VVRY+  +++  ISPTIGASFFT K+N+ + KVK+QVWDTAGQERF++MAP+Y
Sbjct: 15  GVGKTSLVVRYVSNVYTKEISPTIGASFFTCKVNLEDFKVKMQVWDTAGQERFKAMAPLY 74

Query: 176 YRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAF 235
           YRNANAALLVFD+TQY+SF  IK+WV+EL+RNV EP+VL +VGNK DLE  R V+REEA 
Sbjct: 75  YRNANAALLVFDLTQYNSFVEIKSWVQELQRNVQEPMVLSLVGNKLDLEEKRAVSREEAA 134

Query: 236 HYSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQESLHTSSLRVYDSDNIT----SA 291
            Y+ SIGG Y+ETSALQDQGIE VF++++ GLI LS E +  S  R   SD++     S+
Sbjct: 135 LYATSIGGNYFETSALQDQGIEQVFISIAVGLIKLSGEQICPSLKRYESSDSLVLSGYSS 194

Query: 292 NPRGVVEI 299
              GVV++
Sbjct: 195 GMNGVVQM 202




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170037970|ref|XP_001846827.1| low-Mr GTP-binding protein Rab31 [Culex quinquefasciatus] gi|167881359|gb|EDS44742.1| low-Mr GTP-binding protein Rab31 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158295454|ref|XP_316217.3| AGAP006159-PA [Anopheles gambiae str. PEST] gi|157016045|gb|EAA10814.3| AGAP006159-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|383857603|ref|XP_003704294.1| PREDICTED: ras-related protein RabJ-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340723572|ref|XP_003400163.1| PREDICTED: ras-related protein RabJ-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380022458|ref|XP_003695062.1| PREDICTED: ras-related protein RabJ-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|270010105|gb|EFA06553.1| hypothetical protein TcasGA2_TC009462 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91085709|ref|XP_972846.1| PREDICTED: similar to AGAP006159-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|110761970|ref|XP_001122072.1| PREDICTED: ras-related protein RabJ-like [Apis mellifera] Back     alignment and taxonomy information
>gi|345490640|ref|XP_001602002.2| PREDICTED: ras-related protein RabJ-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query617
FB|FBgn0015372261 RabX1 "RabX1" [Drosophila mela 0.285 0.674 0.538 3.7e-48
UNIPROTKB|Q17R06222 RAB21 "Ras-related protein Rab 0.251 0.698 0.496 8.4e-39
UNIPROTKB|F1PGI1238 RAB21 "Ras-related protein Rab 0.251 0.651 0.496 1.1e-38
UNIPROTKB|P55745223 RAB21 "Ras-related protein Rab 0.251 0.695 0.496 1.1e-38
UNIPROTKB|Q9UL25225 RAB21 "Ras-related protein Rab 0.251 0.688 0.496 1.1e-38
UNIPROTKB|F1SH25222 RAB21 "Uncharacterized protein 0.251 0.698 0.496 1.1e-38
UNIPROTKB|F1NC27228 RAB21 "Uncharacterized protein 0.251 0.679 0.496 1.5e-38
MGI|MGI:894308222 Rab21 "RAB21, member RAS oncog 0.251 0.698 0.490 1.5e-38
RGD|1303150223 Rab21 "RAB21, member RAS oncog 0.251 0.695 0.490 1.5e-38
UNIPROTKB|F1MPP1214 LOC781001 "Uncharacterized pro 0.251 0.724 0.490 7.7e-38
FB|FBgn0015372 RabX1 "RabX1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 503 (182.1 bits), Expect = 3.7e-48, P = 3.7e-48
 Identities = 97/180 (53%), Positives = 133/180 (73%)

Query:   116 GVGKTSMVVRYIGKMFSHHIS--PTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAP 173
             GVGKT +V+RYI        S  PTI  SFFT  I + E K+KLQ+WDTAGQER+R++AP
Sbjct:    15 GVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRAVAP 74

Query:   174 MYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREE 233
             MYYRNANAA+LVFD+TQY +F  IK+W++EL RNV +P++L +VGNK D+++ R V+REE
Sbjct:    75 MYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMILTLVGNKMDMQAQRAVSREE 134

Query:   234 AFHYSKSIGGTYYETSALQDQGIEDVFLNVSKGLICLSQESLHTSSLRVYDS-DNITSAN 292
             AF ++ SIG TY+ETS   DQG+E VF++ ++GL+ L+ E   + SLR + S D++   N
Sbjct:   135 AFVFATSIGATYFETSTETDQGLEQVFISTAQGLVRLADEG-KSPSLRSFQSTDSLAYTN 193




GO:0005886 "plasma membrane" evidence=ISS
GO:0003924 "GTPase activity" evidence=ISS;TAS
GO:0005525 "GTP binding" evidence=IEA;ISS
GO:0007422 "peripheral nervous system development" evidence=IMP
GO:0015031 "protein transport" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0031982 "vesicle" evidence=ISS
UNIPROTKB|Q17R06 RAB21 "Ras-related protein Rab-21" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PGI1 RAB21 "Ras-related protein Rab-21" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P55745 RAB21 "Ras-related protein Rab-21" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UL25 RAB21 "Ras-related protein Rab-21" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SH25 RAB21 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NC27 RAB21 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:894308 Rab21 "RAB21, member RAS oncogene family" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1303150 Rab21 "RAB21, member RAS oncogene family" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPP1 LOC781001 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query617
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 3e-65
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 4e-64
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 1e-60
pfam00071162 pfam00071, Ras, Ras family 3e-58
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 1e-56
cd01868165 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- 8e-44
cd01861161 cd01861, Rab6, Rab GTPase family 6 (Rab6) 1e-43
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 4e-43
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 4e-42
cd01862172 cd01862, Rab7, Rab GTPase family 7 (Rab7) 2e-41
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 2e-39
cd01866168 cd01866, Rab2, Rab GTPase family 2 (Rab2) 2e-39
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 4e-38
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 4e-38
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 2e-37
cd01864165 cd01864, Rab19, Rab GTPase family 19 (Rab19) 5e-37
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 6e-37
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 7e-35
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 1e-32
cd04115170 cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu 3e-32
PLN03108210 PLN03108, PLN03108, Rab family protein; Provisiona 4e-32
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 7e-32
cd04118193 cd04118, Rab24, Rab GTPase family 24 (Rab24) 8e-31
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 2e-30
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPase 2e-30
smart00010166 smart00010, small_GTPase, Small GTPase of the Ras 2e-30
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 2e-30
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 3e-30
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 3e-29
cd04117164 cd04117, Rab15, Rab GTPase family 15 (Rab15) 3e-29
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 3e-29
cd04120202 cd04120, Rab12, Rab GTPase family 12 (Rab12) 6e-28
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 7e-28
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 5e-26
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 8e-26
cd04106162 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)- 2e-25
cd04116170 cd04116, Rab9, Rab GTPase family 9 (Rab9) 3e-25
cd04108170 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 6e-25
cd04177168 cd04177, RSR1, RSR1/Bud1p family GTPase 7e-24
pfam14438113 pfam14438, SM-ATX, SM domain found in Ataxin-2 1e-23
cd00157171 cd00157, Rho, Ras homology family (Rho) of small g 2e-23
cd00877166 cd00877, Ran, Ras-related nuclear proteins (Ran)/T 2e-23
cd04138162 cd04138, H_N_K_Ras_like, Ras GTPase family contain 4e-23
cd04130173 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W 1e-22
smart00174174 smart00174, RHO, Rho (Ras homology) subfamily of R 2e-22
cd04145164 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 2e-22
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 6e-22
PLN03071219 PLN03071, PLN03071, GTP-binding nuclear protein Ra 2e-21
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 3e-21
cd04139163 cd04139, RalA_RalB, Ral (Ras-like) family containi 5e-21
smart00176200 smart00176, RAN, Ran (Ras-related nuclear proteins 5e-21
PTZ00132215 PTZ00132, PTZ00132, GTP-binding nuclear protein Ra 5e-21
PTZ00369189 PTZ00369, PTZ00369, Ras-like protein; Provisional 6e-21
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 1e-20
cd04175164 cd04175, Rap1, Rap1 family GTPase consists of Rap1 1e-20
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 3e-20
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 3e-20
cd04141172 cd04141, Rit_Rin_Ric, Ras-like protein in all tiss 3e-20
cd04137180 cd04137, RheB, Ras Homolog Enriched in Brain (RheB 2e-19
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 6e-19
cd04126220 cd04126, Rab20, Rab GTPase family 20 (Rab20) 7e-19
cd04144190 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small 8e-19
cd04124161 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like 1e-18
cd04101167 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like 3e-18
cd04132197 cd04132, Rho4_like, Ras homology family 4 (Rho4) o 5e-18
cd04121189 cd04121, Rab40, Rab GTPase family 40 (Rab40) conta 1e-17
cd04129190 cd04129, Rho2, Ras homology family 2 (Rho2) of sma 2e-17
cd09914161 cd09914, RocCOR, Ras of complex proteins (Roc) C-t 2e-16
cd04128182 cd04128, Spg1, Septum-promoting GTPase (Spg1) 2e-16
cd04140165 cd04140, ARHI_like, A Ras homolog member I (ARHI) 2e-16
pfam08477116 pfam08477, Miro, Miro-like protein 1e-15
cd04143247 cd04143, Rhes_like, Ras homolog enriched in striat 4e-15
cd04133173 cd04133, Rop_like, Rho-related protein from plants 7e-15
cd04135174 cd04135, Tc10, Rho GTPase TC10 (Tc10) 3e-14
cd01870175 cd01870, RhoA_like, Ras homology family A (RhoA)-l 3e-13
cd04147197 cd04147, Ras_dva, Ras - dorsal-ventral anterior lo 3e-13
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 5e-13
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 8e-13
cd04148219 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam 1e-12
cd01875191 cd01875, RhoG, Ras homolog family, member G (RhoG) 3e-12
cd01871174 cd01871, Rac1_like, Ras-related C3 botulinum toxin 3e-12
cd04131176 cd04131, Rnd, Rho family GTPase subfamily Rnd incl 6e-12
cd04174232 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases 1e-10
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 2e-10
cd04172182 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases 2e-10
cd01874175 cd01874, Cdc42, cell division cycle 42 (Cdc42) is 3e-10
cd04134185 cd04134, Rho3, Ras homology family 3 (Rho3) of sma 4e-10
cd04173221 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases 2e-09
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 6e-09
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 1e-08
cd04142198 cd04142, RRP22, Ras-related protein on chromosome 2e-08
cd01873195 cd01873, RhoBTB, RhoBTB protein is an atypical mem 5e-08
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 7e-08
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 1e-07
pfam00071162 pfam00071, Ras, Ras family 2e-07
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 3e-07
cd04151158 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) 5e-07
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 6e-07
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 7e-07
cd01893168 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1) 9e-07
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 5e-06
cd01862172 cd01862, Rab7, Rab GTPase family 7 (Rab7) 6e-06
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 2e-05
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 2e-05
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 2e-05
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 4e-05
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 5e-05
cd01861161 cd01861, Rab6, Rab GTPase family 6 (Rab6) 8e-05
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 1e-04
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 2e-04
PLN00023334 PLN00023, PLN00023, GTP-binding protein; Provision 3e-04
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 4e-04
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 6e-04
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 0.002
cd04162164 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp 0.002
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 0.003
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 0.004
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 0.004
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
 Score =  210 bits (538), Expect = 3e-65
 Identities = 65/150 (43%), Positives = 98/150 (65%)

Query: 116 GVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMY 175
           GVGKTS+++R++   FS +   TIG  F +  I V   KVKLQ+WDTAGQERFRS+   Y
Sbjct: 10  GVGKTSLLLRFVDNKFSENYKSTIGVDFKSKTIEVDGKKVKLQIWDTAGQERFRSITSSY 69

Query: 176 YRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAF 235
           YR A+ A+LV+D+T   SF  +  W+ ELK      + + +VGNK+DLE  R+V+ EEA 
Sbjct: 70  YRGAHGAILVYDVTNRESFENLDKWLNELKEYAPPNIPIILVGNKSDLEDERQVSTEEAQ 129

Query: 236 HYSKSIGGTYYETSALQDQGIEDVFLNVSK 265
            ++K  G  ++ETSA   + +++ F ++++
Sbjct: 130 QFAKENGLLFFETSAKTGENVDEAFESLAR 159


Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which mask C-terminal lipid binding and promote cytosolic localization. While most unicellular organisms possess 5-20 Rab members, several have been found to possess 60 or more Rabs; for many of these Rab isoforms, homologous proteins are not found in other organisms. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Since crystal structures often lack C-terminal residues, the lipid modification site is not available for annotation in many of the CDs in the hierarchy, but is included where possible. Length = 159

>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 Back     alignment and domain information
>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B Back     alignment and domain information
>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|133318 cd04118, Rab24, Rab GTPase family 24 (Rab24) Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like Back     alignment and domain information
>gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) Back     alignment and domain information
>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) Back     alignment and domain information
>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase Back     alignment and domain information
>gnl|CDD|222754 pfam14438, SM-ATX, SM domain found in Ataxin-2 Back     alignment and domain information
>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B Back     alignment and domain information
>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42 Back     alignment and domain information
>gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB Back     alignment and domain information
>gnl|CDD|128473 smart00176, RAN, Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) Back     alignment and domain information
>gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|133326 cd04126, Rab20, Rab GTPase family 20 (Rab20) Back     alignment and domain information
>gnl|CDD|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2) Back     alignment and domain information
>gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) Back     alignment and domain information
>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like Back     alignment and domain information
>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c Back     alignment and domain information
>gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family Back     alignment and domain information
>gnl|CDD|206701 cd04128, Spg1, Septum-promoting GTPase (Spg1) Back     alignment and domain information
>gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and activator of G-protein signaling 1 (Dexras1/AGS1) Back     alignment and domain information
>gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like Back     alignment and domain information
>gnl|CDD|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10) Back     alignment and domain information
>gnl|CDD|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes RhoA, RhoB and RhoC Back     alignment and domain information
>gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases Back     alignment and domain information
>gnl|CDD|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3 Back     alignment and domain information
>gnl|CDD|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8 Back     alignment and domain information
>gnl|CDD|206737 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206735 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases Back     alignment and domain information
>gnl|CDD|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of the Rho family Back     alignment and domain information
>gnl|CDD|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206736 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases Back     alignment and domain information
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|133342 cd04142, RRP22, Ras-related protein on chromosome 22 (RRP22) family Back     alignment and domain information
>gnl|CDD|133275 cd01873, RhoBTB, RhoBTB protein is an atypical member of the Rho family of small GTPases Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|206680 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1), N-terminal Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|177661 PLN00023, PLN00023, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase Back     alignment and domain information
>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 617
KOG0084|consensus205 100.0
KOG0092|consensus200 100.0
KOG0098|consensus216 100.0
KOG0078|consensus207 100.0
KOG0094|consensus221 99.98
KOG0080|consensus209 99.97
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.97
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.97
KOG0394|consensus210 99.97
KOG0087|consensus222 99.97
KOG0093|consensus193 99.97
KOG0086|consensus214 99.96
KOG0079|consensus198 99.96
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.96
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.96
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.96
KOG0091|consensus213 99.96
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.96
KOG0088|consensus218 99.96
KOG0097|consensus215 99.96
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.96
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.96
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.96
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.96
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.96
KOG0095|consensus213 99.96
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.96
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.95
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.95
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.95
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.95
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.95
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.95
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.95
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.95
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.95
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.95
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.95
PTZ00369189 Ras-like protein; Provisional 99.95
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.95
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.95
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.95
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.95
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.95
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.95
PLN03110216 Rab GTPase; Provisional 99.95
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.95
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.95
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.95
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.95
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.95
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.95
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.95
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.95
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.94
PLN03108210 Rab family protein; Provisional 99.94
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.94
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.94
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.94
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.94
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.94
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.94
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.94
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.94
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.94
KOG0083|consensus192 99.94
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.94
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.94
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.94
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.94
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.94
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.94
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.94
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.94
COG1160444 Predicted GTPases [General function prediction onl 99.94
KOG0081|consensus219 99.94
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.93
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.93
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.93
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.93
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.93
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.93
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.93
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.93
PLN03118211 Rab family protein; Provisional 99.93
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.93
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.93
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.93
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.92
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.92
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.92
KOG0395|consensus196 99.92
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.92
PRK03003472 GTP-binding protein Der; Reviewed 99.92
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.92
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.91
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.91
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.91
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.9
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.9
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.9
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.9
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.9
KOG0393|consensus198 99.9
PLN00223181 ADP-ribosylation factor; Provisional 99.9
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.9
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.9
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.9
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.9
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.9
KOG4252|consensus246 99.89
PTZ00133182 ADP-ribosylation factor; Provisional 99.89
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.89
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.89
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.89
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.88
PTZ00099176 rab6; Provisional 99.88
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.88
PRK00093435 GTP-binding protein Der; Reviewed 99.87
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.87
PLN00023334 GTP-binding protein; Provisional 99.87
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.87
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.87
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.87
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.86
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.86
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.86
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.86
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.84
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.84
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.84
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.82
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.82
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.82
KOG3905|consensus473 99.81
KOG1673|consensus205 99.81
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.81
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.81
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.81
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.81
COG1100219 GTPase SAR1 and related small G proteins [General 99.8
PRK12299335 obgE GTPase CgtA; Reviewed 99.8
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.8
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.79
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.78
PF1443877 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. 99.78
KOG0073|consensus185 99.78
PRK04213201 GTP-binding protein; Provisional 99.78
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.77
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.76
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.75
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.75
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.74
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.74
KOG0070|consensus181 99.74
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.74
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.74
PRK15494339 era GTPase Era; Provisional 99.74
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.73
COG1159298 Era GTPase [General function prediction only] 99.73
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.73
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.73
KOG0075|consensus186 99.73
KOG3883|consensus198 99.73
PRK03003472 GTP-binding protein Der; Reviewed 99.72
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.71
PF05783472 DLIC: Dynein light intermediate chain (DLIC); Inte 99.71
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.71
PRK00089292 era GTPase Era; Reviewed 99.7
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.7
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.7
COG1160444 Predicted GTPases [General function prediction onl 99.7
cd00881189 GTP_translation_factor GTP translation factor fami 99.7
PRK12297424 obgE GTPase CgtA; Reviewed 99.69
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.69
PRK11058426 GTPase HflX; Provisional 99.69
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.69
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.69
KOG0096|consensus216 99.68
KOG4423|consensus229 99.67
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.67
COG0218200 Predicted GTPase [General function prediction only 99.67
KOG0071|consensus180 99.66
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.66
PRK12296500 obgE GTPase CgtA; Reviewed 99.66
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.66
PRK12298390 obgE GTPase CgtA; Reviewed 99.65
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.64
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.64
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.63
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.63
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.62
COG0486454 ThdF Predicted GTPase [General function prediction 99.62
COG5180 654 PBP1 Protein interacting with poly(A)-binding prot 99.62
PRK00093435 GTP-binding protein Der; Reviewed 99.61
cd04105203 SR_beta Signal recognition particle receptor, beta 99.61
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.59
PRK05306787 infB translation initiation factor IF-2; Validated 99.59
CHL00189742 infB translation initiation factor 2; Provisional 99.58
PRK05433600 GTP-binding protein LepA; Provisional 99.58
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.58
cd01896233 DRG The developmentally regulated GTP-binding prot 99.58
PRK12317425 elongation factor 1-alpha; Reviewed 99.56
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.56
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.55
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.55
KOG0074|consensus185 99.54
KOG0076|consensus197 99.53
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.53
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.52
KOG0072|consensus182 99.5
COG2229187 Predicted GTPase [General function prediction only 99.48
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.48
PRK10218607 GTP-binding protein; Provisional 99.48
KOG1707|consensus 625 99.48
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.47
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.47
COG1084346 Predicted GTPase [General function prediction only 99.46
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.46
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.45
PRK04004586 translation initiation factor IF-2; Validated 99.44
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.44
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.44
KOG2375|consensus 756 99.44
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.43
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.43
COG2262411 HflX GTPases [General function prediction only] 99.41
KOG1489|consensus366 99.39
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.39
KOG1423|consensus379 99.37
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.37
KOG1191|consensus531 99.37
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.36
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.35
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.35
PRK12736394 elongation factor Tu; Reviewed 99.34
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.34
PRK12735396 elongation factor Tu; Reviewed 99.33
PRK12289352 GTPase RsgA; Reviewed 99.32
COG1163365 DRG Predicted GTPase [General function prediction 99.31
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.31
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.29
CHL00071409 tufA elongation factor Tu 99.29
COG0536369 Obg Predicted GTPase [General function prediction 99.29
PRK12288347 GTPase RsgA; Reviewed 99.26
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.24
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.24
PRK00741526 prfC peptide chain release factor 3; Provisional 99.23
PRK13351 687 elongation factor G; Reviewed 99.22
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.22
PLN03126478 Elongation factor Tu; Provisional 99.21
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.21
PRK00049396 elongation factor Tu; Reviewed 99.21
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.2
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.2
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 99.19
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.18
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.18
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.17
PRK00098298 GTPase RsgA; Reviewed 99.17
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.17
PLN00043447 elongation factor 1-alpha; Provisional 99.17
TIGR00503527 prfC peptide chain release factor 3. This translat 99.16
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.16
KOG0462|consensus650 99.15
PLN03127447 Elongation factor Tu; Provisional 99.15
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.14
KOG0077|consensus193 99.13
KOG2375|consensus 756 99.13
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.13
PRK09602396 translation-associated GTPase; Reviewed 99.12
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.12
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.11
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.1
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.09
COG3596296 Predicted GTPase [General function prediction only 99.09
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.09
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.09
PTZ00141446 elongation factor 1- alpha; Provisional 99.07
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.07
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.05
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.05
PRK09563287 rbgA GTPase YlqF; Reviewed 99.05
KOG0090|consensus238 99.02
KOG1490|consensus620 99.02
PRK12739 691 elongation factor G; Reviewed 99.02
PRK09866741 hypothetical protein; Provisional 99.01
PRK12740 668 elongation factor G; Reviewed 99.01
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.0
PRK148451049 translation initiation factor IF-2; Provisional 98.95
COG1162301 Predicted GTPases [General function prediction onl 98.95
KOG0084|consensus205 98.94
KOG0094|consensus221 98.94
KOG1145|consensus683 98.92
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.91
PTZ00258390 GTP-binding protein; Provisional 98.88
PRK00007 693 elongation factor G; Reviewed 98.87
PRK13796365 GTPase YqeH; Provisional 98.85
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.84
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.82
PRK13768253 GTPase; Provisional 98.81
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.78
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 98.77
KOG1707|consensus625 98.76
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.76
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.75
KOG0092|consensus200 98.71
PRK09601364 GTP-binding protein YchF; Reviewed 98.71
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.68
PRK01889356 GTPase RsgA; Reviewed 98.68
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 98.67
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 98.65
KOG0394|consensus210 98.64
KOG0095|consensus213 98.64
PRK09435332 membrane ATPase/protein kinase; Provisional 98.63
KOG0078|consensus207 98.61
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.59
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.59
COG5257415 GCD11 Translation initiation factor 2, gamma subun 98.58
KOG0080|consensus209 98.57
COG1217603 TypA Predicted membrane GTPase involved in stress 98.57
KOG1486|consensus364 98.56
PF0674172 LsmAD: LsmAD domain; InterPro: IPR009604 This entr 98.54
KOG0079|consensus198 98.54
KOG0098|consensus216 98.53
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.53
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.52
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.52
KOG0705|consensus 749 98.52
KOG1144|consensus1064 98.51
PRK07560 731 elongation factor EF-2; Reviewed 98.48
KOG0410|consensus410 98.47
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.43
KOG3886|consensus295 98.43
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.42
KOG2486|consensus320 98.41
COG3276447 SelB Selenocysteine-specific translation elongatio 98.37
PLN00116 843 translation elongation factor EF-2 subunit; Provis 98.36
COG0012372 Predicted GTPase, probable translation factor [Tra 98.36
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.36
KOG0087|consensus222 98.35
COG1161322 Predicted GTPases [General function prediction onl 98.35
PTZ00416 836 elongation factor 2; Provisional 98.35
KOG1532|consensus366 98.33
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.32
KOG0458|consensus603 98.3
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.29
KOG0086|consensus214 98.29
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 98.26
KOG0461|consensus522 98.26
KOG0093|consensus193 98.24
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 98.22
KOG1547|consensus336 98.01
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.01
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.0
KOG0097|consensus215 98.0
KOG0083|consensus192 97.99
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.98
KOG2655|consensus366 97.98
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 97.97
COG5019373 CDC3 Septin family protein [Cell division and chro 97.97
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.93
KOG1487|consensus358 97.91
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.91
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 97.9
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 97.9
KOG0468|consensus 971 97.89
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 97.86
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 97.83
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 97.83
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 97.83
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.82
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 97.81
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.81
KOG0091|consensus213 97.8
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 97.78
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 97.78
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 97.77
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 97.76
COG1161322 Predicted GTPases [General function prediction onl 97.73
PRK09563287 rbgA GTPase YlqF; Reviewed 97.73
KOG2484|consensus435 97.73
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 97.72
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 97.71
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 97.7
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.7
COG0050394 TufB GTPases - translation elongation factors [Tra 97.68
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 97.67
KOG1954|consensus532 97.67
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 97.66
KOG4273|consensus418 97.64
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.64
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.63
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 97.62
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 97.62
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 97.61
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.61
KOG1143|consensus591 97.58
COG5258527 GTPBP1 GTPase [General function prediction only] 97.57
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 97.57
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 97.56
KOG1424|consensus562 97.54
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 97.54
PLN03071219 GTP-binding nuclear protein Ran; Provisional 97.54
PLN00023334 GTP-binding protein; Provisional 97.52
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 97.52
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 97.5
KOG0448|consensus749 97.5
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 97.48
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 97.48
PLN03110216 Rab GTPase; Provisional 97.48
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 97.48
KOG0081|consensus219 97.48
KOG0088|consensus218 97.47
KOG0395|consensus196 97.46
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 97.46
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 97.46
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 97.44
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.42
KOG1424|consensus562 97.41
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 97.41
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 97.4
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 97.39
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 97.39
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 97.38
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 97.38
PTZ00369189 Ras-like protein; Provisional 97.37
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 97.37
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 97.37
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 97.36
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 97.36
KOG0460|consensus449 97.34
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 97.33
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 97.32
PLN03108210 Rab family protein; Provisional 97.32
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 97.29
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 97.29
KOG1191|consensus531 97.28
cd0172581 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins 97.27
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 97.26
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 97.26
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 97.24
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 97.24
cd03110179 Fer4_NifH_child This protein family's function is 97.23
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 97.22
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.22
PF1270196 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC 97.22
PRK12288347 GTPase RsgA; Reviewed 97.21
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 97.18
cd0173378 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins 97.18
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 97.17
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.17
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 97.17
PRK10416318 signal recognition particle-docking protein FtsY; 97.15
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 97.15
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 97.14
KOG0393|consensus198 97.11
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 97.11
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 97.09
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 97.09
KOG1491|consensus391 97.08
KOG2423|consensus572 97.06
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 97.05
KOG2485|consensus335 97.05
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 97.05
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 97.05
PRK13796365 GTPase YqeH; Provisional 97.04
PRK14974336 cell division protein FtsY; Provisional 97.02
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.01
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 97.01
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.0
KOG2484|consensus435 97.0
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 96.99
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 96.98
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 96.97
PRK12289352 GTPase RsgA; Reviewed 96.97
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 96.97
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 96.95
cd0060063 Sm_like The eukaryotic Sm and Sm-like (LSm) protei 96.93
COG1100219 GTPase SAR1 and related small G proteins [General 96.93
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 96.91
cd03112158 CobW_like The function of this protein family is u 96.91
cd0172490 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins 96.9
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 96.9
KOG4252|consensus246 96.89
COG0523323 Putative GTPases (G3E family) [General function pr 96.88
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.88
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 96.86
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 96.85
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 96.85
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 96.84
KOG0463|consensus641 96.84
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 96.81
PF0142367 LSM: LSM domain ; InterPro: IPR001163 This family 96.79
KOG3859|consensus406 96.79
cd0172170 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins 96.78
cd0173674 LSm14_N LSm14 (also known as RAP55) belongs to a f 96.77
PLN03118211 Rab family protein; Provisional 96.73
TIGR00064272 ftsY signal recognition particle-docking protein F 96.73
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.73
>KOG0084|consensus Back     alignment and domain information
Probab=100.00  E-value=4.6e-34  Score=267.67  Aligned_cols=167  Identities=38%  Similarity=0.667  Sum_probs=161.5

Q ss_pred             cceEEEEEccCcccccccCCCCCCccccCCCCCCCCHHHHHHHHHcCCCCCccCCCcceeEEEEEEEECCeEEEEEEEec
Q psy3029          83 NKIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDT  162 (617)
Q Consensus        83 ~~ikV~i~G~~~~~~~~~~~~~~~~~~~i~G~~nVGKSSLinrl~~~~~~~~~~~t~g~~~~~~~i~~~~~~~~l~i~Dt  162 (617)
                      ..+||+|+|+                      +|||||||+.||..+.|.+.+..|+|+++..+.+.++++.++++||||
T Consensus         8 ylFKiiliGd----------------------s~VGKtCL~~Rf~~~~f~e~~~sTIGVDf~~rt~e~~gk~iKlQIWDT   65 (205)
T KOG0084|consen    8 YLFKIILIGD----------------------SGVGKTCLLLRFKDDTFTESYISTIGVDFKIRTVELDGKTIKLQIWDT   65 (205)
T ss_pred             eEEEEEEECC----------------------CCcChhhhhhhhccCCcchhhcceeeeEEEEEEeeecceEEEEEeeec
Confidence            3489999999                      999999999999999999999999999999999999999999999999


Q ss_pred             CCcccccccchhhhccCCEEEEEEeCCChhhHHHHHHHHHHHHhcCCCCCeEEEEEECCCCCCccccCHHHHHHHHHhcC
Q psy3029         163 AGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFHYSKSIG  242 (617)
Q Consensus       163 ~G~e~~~~~~~~~~~~ad~iIlV~Dis~~~S~~~l~~~l~~i~~~~~~~iPvIlVgNK~DL~~~~~v~~~e~~~~~~~~g  242 (617)
                      +|+|||+.+...||++|++||+|||+++.+||..+..|+.++.++...++|.+|||||+|+.+.+.++.++++.|+.+++
T Consensus        66 AGQERFrtit~syYR~ahGii~vyDiT~~~SF~~v~~Wi~Ei~~~~~~~v~~lLVGNK~Dl~~~~~v~~~~a~~fa~~~~  145 (205)
T KOG0084|consen   66 AGQERFRTITSSYYRGAHGIIFVYDITKQESFNNVKRWIQEIDRYASENVPKLLVGNKCDLTEKRVVSTEEAQEFADELG  145 (205)
T ss_pred             cccHHHhhhhHhhccCCCeEEEEEEcccHHHhhhHHHHHHHhhhhccCCCCeEEEeeccccHhheecCHHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999999998889999999999999999999999999999999


Q ss_pred             Ce-EEEEcCCCCCCHHHHHHHHHHHHHHhh
Q psy3029         243 GT-YYETSALQDQGIEDVFLNVSKGLICLS  271 (617)
Q Consensus       243 ~~-~~evSAktg~gI~eLf~~I~~~l~~~~  271 (617)
                      ++ |+|+|||++.||++.|..|...+....
T Consensus       146 ~~~f~ETSAK~~~NVe~~F~~la~~lk~~~  175 (205)
T KOG0084|consen  146 IPIFLETSAKDSTNVEDAFLTLAKELKQRK  175 (205)
T ss_pred             CcceeecccCCccCHHHHHHHHHHHHHHhc
Confidence            98 999999999999999999999887654



>KOG0092|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG5180 PBP1 Protein interacting with poly(A)-binding protein [RNA processing and modification] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>KOG2375|consensus Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>KOG2375|consensus Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>PF06741 LsmAD: LsmAD domain; InterPro: IPR009604 This entry represents a conserved region approximately 250 residues long located on eukaryotic ataxin-2 [] Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>KOG4273|consensus Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>KOG0448|consensus Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins Back     alignment and domain information
>KOG3859|consensus Back     alignment and domain information
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query617
1z08_A170 Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 2e-42
1z08_A170 Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 6e-04
1yzu_A170 Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng 2e-41
1yzt_A184 Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng 2e-41
2fg5_A192 Crystal Structure Of Human Rab31 In Complex With A 8e-38
2fg5_A192 Crystal Structure Of Human Rab31 In Complex With A 4e-05
2hei_A179 Crystal Structure Of Human Rab5b In Complex With Gd 8e-35
1ek0_A170 Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 6e-34
1ek0_A170 Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 1e-04
1yvd_A169 Gppnhp-Bound Rab22 Gtpase Length = 169 2e-33
1huq_A164 1.8a Crystal Structure Of The Monomeric Gtpase Rab5 2e-33
1tu3_A171 Crystal Structure Of Rab5 Complex With Rabaptin5 C- 4e-33
1n6h_A170 Crystal Structure Of Human Rab5a Length = 170 4e-33
1n6r_A170 Crystal Structure Of Human Rab5a A30l Mutant Comple 5e-33
1n6o_A170 Crystal Structure Of Human Rab5a A30k Mutant Comple 5e-33
1n6p_A170 Crystal Structure Of Human Rab5a A30e Mutant Comple 5e-33
1n6n_A170 Crystal Structure Of Human Rab5a A30r Mutant Comple 5e-33
1n6i_A170 Crystal Structure Of Human Rab5a A30p Mutant Comple 5e-33
1z07_A166 Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 2e-32
1z0d_A167 Gdp-bound Rab5c Gtpase Length = 167 2e-32
1z0j_A170 Structure Of Gtp-Bound Rab22q64l Gtpase In Complex 2e-32
3mjh_A168 Crystal Structure Of Human Rab5a In Complex With Th 3e-32
2efc_B181 Ara7-GdpATVPS9A Length = 181 4e-32
1tu4_A171 Crystal Structure Of Rab5-Gdp Complex Length = 171 7e-32
3tso_A178 Structure Of The Cancer Associated Rab25 Protein In 6e-31
2oil_A193 Crystal Structure Of Human Rab25 In Complex With Gd 6e-31
2ew1_A201 Crystal Structure Of Rab30 In Complex With A Gtp An 3e-30
2a5j_A191 Crystal Structure Of Human Rab2b Length = 191 2e-29
1z0a_A174 Gdp-Bound Rab2a Gtpase Length = 174 2e-29
3bfk_A181 Crystal Structure Of Plasmodium Falciparum Rab11a I 5e-29
2bmd_A186 High Resolution Structure Of Gdp-Bound Human Rab4a 5e-28
1yu9_A175 Gppnhp-Bound Rab4a Length = 175 6e-28
1z0f_A179 Gdp-Bound Rab14 Gtpase Length = 179 8e-28
2f9l_A199 3d Structure Of Inactive Human Rab11b Gtpase Length 1e-27
1oiv_A191 X-Ray Structure Of The Small G Protein Rab11a In Co 2e-27
1yzk_A184 Gppnhp Bound Rab11 Gtpase Length = 184 2e-27
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 3e-27
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 3e-27
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 3e-27
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 5e-27
4drz_A196 Crystal Structure Of Human Rab14 Length = 196 5e-27
1z0k_A172 Structure Of Gtp-Bound Rab4q67l Gtpase In Complex W 5e-27
2o52_A200 Crystal Structure Of Human Rab4b In Complex With Gd 1e-26
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 1e-26
1oiw_A191 X-ray Structure Of The Small G Protein Rab11a In Co 2e-26
2hv8_A172 Crystal Structure Of Gtp-Bound Rab11 In Complex Wit 2e-26
2fe4_A171 The Crystal Structure Of Human Neuronal Rab6b In It 2e-26
2gzd_A173 Crystal Structure Of Rab11 In Complex With Rab11-Fi 2e-26
2d7c_A167 Crystal Structure Of Human Rab11 In Complex With Fi 2e-26
1yzq_A170 Gppnhp-Bound Rab6 Gtpase Length = 170 2e-26
3tw8_B181 Gef Domain Of Dennd 1b In Complex With Rab Gtpase R 2e-26
2y8e_A179 Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo 3e-26
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 3e-26
2gil_A162 Structure Of The Extremely Slow Gtpase Rab6a In The 4e-26
2hup_A201 Crystal Structure Of Human Rab43 In Complex With Gd 4e-26
1x3s_A195 Crystal Structure Of Human Rab18 In Complex With Gp 5e-26
2il1_A192 Crystal Structure Of A Predicted Human Gtpase In Co 7e-26
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 8e-26
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 8e-26
1d5c_A162 Crystal Structure Of Plasmodium Falciparum Rab6 Com 1e-25
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 1e-25
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 1e-25
4dkx_A216 Crystal Structure Of The Rab 6a'(Q72l) Length = 216 1e-25
1vg0_B207 The Crystal Structures Of The Rep-1 Protein In Comp 2e-25
1vg0_B207 The Crystal Structures Of The Rep-1 Protein In Comp 3e-04
1vg1_A185 Gdp-bound Rab7 Length = 185 2e-25
1vg1_A185 Gdp-bound Rab7 Length = 185 4e-04
3cwz_A188 Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 2e-25
3bbp_A211 Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 3e-25
3law_A207 Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 4e-25
3law_A207 Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 3e-04
3cpj_B223 Crystal Structure Of Ypt31 In Complex With Yeast Ra 5e-25
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 7e-25
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 8e-25
4fmc_B171 Espg-Rab1 Complex Length = 171 8e-25
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 1e-24
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 1e-24
2g6b_A180 Crystal Structure Of Human Rab26 In Complex With A 1e-24
1t91_A207 Crystal Structure Of Human Small Gtpase Rab7(Gtp) L 1e-24
1t91_A207 Crystal Structure Of Human Small Gtpase Rab7(Gtp) L 3e-04
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 1e-24
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 1e-24
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 3e-24
3rwm_B185 Crystal Structure Of Ypt32 In Complex With Gppnhp L 4e-24
3qbt_A174 Crystal Structure Of Ocrl1 540-678 In Complex With 4e-24
2fu5_C183 Structure Of Rab8 In Complex With Mss4 Length = 183 5e-24
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 1e-23
1ky2_A182 Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 1e-23
2gf9_A189 Crystal Structure Of Human Rab3d In Complex With Gd 2e-23
2f7s_A217 The Crystal Structure Of Human Rab27b Bound To Gdp 5e-23
3dz8_A191 Crystal Structure Of Human Rab3b Gtpase Bound With 3e-22
3rab_A169 Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 3e-22
1z22_A168 Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Spac 5e-22
2iez_A220 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 5e-22
2if0_A200 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 5e-22
2iey_A195 Crystal Structure Of Mouse Rab27b Bound To Gdp In H 7e-22
2zet_A203 Crystal Structure Of The Small Gtpase Rab27b Comple 1e-21
1z06_A189 Gppnhp-Bound Rab33 Gtpase Length = 189 1e-21
1zbd_A203 Structural Basis Of Rab Effector Specificity: Cryst 1e-21
1yzl_A179 Gppnhp-Bound Rab9 Gtpase Length = 179 2e-21
3bc1_A195 Crystal Structure Of The Complex Rab27a-slp2a Lengt 2e-21
2g77_B198 Crystal Structure Of Gyp1 Tbc Domain In Complex Wit 2e-21
1wms_A177 High Resolution Crystal Structure Of Human Rab9 Gtp 7e-21
1s8f_A177 Crystal Structure Of Rab9 Complexed To Gdp Reveals 9e-21
2p5s_A199 Rab Domain Of Human Rasef In Complex With Gdp Lengt 3e-20
2ocb_A180 Crystal Structure Of Human Rab9b In Complex With A 5e-20
4fmc_F117 Espg-Rab1 Complex Length = 117 7e-20
1byu_A216 Canine Gdp-Ran Length = 216 2e-18
2bku_A177 Kap95p:rangtp Complex Length = 177 2e-18
3ea5_A216 Kap95p Binding Induces The Switch Loops Of Rangdp T 2e-17
1rrp_A204 Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 2e-17
1qg2_A216 Canine Gdp-Ran R76e Mutant Length = 216 2e-17
1a2k_C216 Gdpran-Ntf2 Complex Length = 216 2e-17
3gj0_A221 Crystal Structure Of Human Rangdp Length = 221 2e-17
1wa5_A176 Crystal Structure Of The Exportin Cse1p Complexed W 2e-17
1qbk_C216 Structure Of The Karyopherin Beta2-ran Gppnhp Nucle 3e-17
1qg4_A216 Canine Gdp-Ran F72y Mutant Length = 216 5e-17
1clu_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 6e-17
1agp_A166 Three-Dimensional Structures And Properties Of A Tr 6e-17
3clv_A208 Crystal Structure Of Rab5a From Plasmodium Falcipar 6e-17
421p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 6e-17
2bov_A206 Molecular Recognition Of An Adp-Ribosylating Clostr 7e-17
2a78_A187 Crystal Structure Of The C3bot-Rala Complex Reveals 7e-17
1uad_A175 Crystal Structure Of The Rala-gppnhp-sec5 Ral-bindi 7e-17
3m1i_A219 Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex 8e-17
1jah_A166 H-Ras P21 Protein Mutant G12p, Complexed With Guano 9e-17
3icq_B171 Karyopherin Nuclear State Length = 171 9e-17
2x19_A172 Crystal Structure Of Importin13 - Rangtp Complex Le 9e-17
1u8y_A168 Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal 1e-16
3ran_A216 Canine Gdp-Ran Q69l Mutant Length = 216 1e-16
3nby_C176 Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclea 1e-16
3nc1_C182 Crystal Structure Of The Crm1-Rangtp Complex Length 2e-16
4epr_A170 Discovery Of Small Molecules That Bind To K-Ras And 2e-16
4dso_A189 Small-Molecule Ligands Bind To A Distinct Pocket In 2e-16
3gj4_A221 Crystal Structure Of Human Rangdp-Nup153znf3 Comple 2e-16
2ke5_A174 Solution Structure And Dynamics Of The Small Gtpase 3e-16
2kwi_A178 Ralb-Rlip76 (Ralbp1) Complex Length = 178 3e-16
1zc3_A175 Crystal Structure Of The Ral-Binding Domain Of Exo8 7e-16
3con_A190 Crystal Structure Of The Human Nras Gtpase Bound Wi 1e-15
4q21_A189 Molecular Switch For Signal Transduction: Structura 2e-15
2cl0_X166 Crystal Structure Analysis Of A Fluorescent Form Of 2e-15
3k9n_A166 Allosteric Modulation Of H-Ras Gtpase Length = 166 3e-15
2cld_X166 Crystal Structure Analysis Of A Fluorescent Form Of 4e-15
4efm_A171 Crystal Structure Of H-Ras G12v In Complex With Gpp 5e-15
4efl_A171 Crystal Structure Of H-Ras Wt In Complex With Gppnh 5e-15
3ddc_A166 Crystal Structure Of Nore1a In Complex With Ras Len 5e-15
2c5l_A173 Structure Of Plc Epsilon Ras Association Domain Wit 6e-15
2ery_A172 The Crystal Structure Of The Ras Related Protein Rr 6e-15
1lfd_B167 Crystal Structure Of The Active Ras Protein Complex 6e-15
2x1v_A166 Crystal Structure Of The Activating H-Ras I163f Mut 7e-15
2hxs_A178 Crystal Structure Of Rab28a Gtpase In The Inactive 7e-15
3lo5_A166 Crystal Structure Of The Dominant Negative S17n Mut 8e-15
221p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 9e-15
6q21_A171 Molecular Switch For Signal Transduction: Structura 1e-14
2q21_A171 Crystal Structures At 2.2 Angstroms Resolution Of T 1e-14
2fn4_A181 The Crystal Structure Of Human Ras-Related Protein, 1e-14
1wq1_R166 Ras-Rasgap Complex Length = 166 1e-14
1rvd_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 1e-14
3kkm_A172 Crystal Structure Of H-Ras T35s In Complex With Gpp 1e-14
4epx_A170 Discovery Of Small Molecules That Bind To K-Ras And 1e-14
4ept_A170 Discovery Of Small Molecules That Bind To K-Ras And 1e-14
1lf0_A166 Crystal Structure Of Rasa59g In The Gtp-Bound Form 2e-14
3v4f_A166 H-Ras Peg 400CACL2, ORDERED OFF Length = 166 2e-14
2rgb_A166 Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 2e-14
2quz_A166 Crystal Structure Of The Activating H-Rask117r Muta 2e-14
621p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 2e-14
3i3s_R166 Crystal Structure Of H-Ras With Thr50 Replaced By I 2e-14
1iaq_A166 C-H-Ras P21 Protein Mutant With Thr 35 Replaced By 3e-14
1zw6_A166 Crystal Structure Of The Gtp-Bound Form Of Rasq61g 3e-14
4efn_A171 Crystal Structure Of H-Ras Q61l In Complex With Gpp 4e-14
1zvq_A166 Structure Of The Q61g Mutant Of Ras In The Gdp-Boun 4e-14
521p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 4e-14
1nvv_Q166 Structural Evidence For Feedback Activation By Rasg 5e-14
721p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 5e-14
2rgc_A166 Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 5e-14
2rga_A166 Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 6e-14
4djt_A218 Crystal Structure Of A Nuclear Gtp-Binding Protein 6e-14
1xj0_A166 Crystal Structure Of The Gdp-Bound Form Of The Rasg 6e-14
1xcm_A167 Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mu 7e-14
4dxa_A169 Co-Crystal Structure Of Rap1 In Complex With Krit1 8e-14
1hh4_A192 Rac1-Rhogdi Complex Involved In Nadph Oxidase Activ 9e-14
2wbl_C180 Three-Dimensional Structure Of A Binary Rop-Prone C 9e-14
1g4u_R184 Crystal Structure Of The Salmonella Tyrosine Phosph 1e-13
1mh1_A186 Small G-Protein Length = 186 1e-13
3gft_A187 Human K-Ras In Complex With A Gtp Analogue Length = 1e-13
2h7v_A188 Co-crystal Structure Of Ypka-rac1 Length = 188 1e-13
3brw_D167 Structure Of The Rap-Rapgap Complex Length = 167 1e-13
1c1y_A167 Crystal Structure Of Rap.Gmppnp In Complex With The 2e-13
3oes_A201 Crystal Structure Of The Small Gtpase Rhebl1 Length 2e-13
1gua_A167 Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 2e-13
2atv_A196 The Crystal Structure Of Human Rerg In The Gdp Boun 2e-13
1i4d_D192 Crystal Structure Analysis Of Rac1-Gdp Complexed Wi 2e-13
2vrw_A184 Critical Structural Role For The Ph And C1 Domains 3e-13
2nty_C180 Rop4-Gdp-Prone8 Length = 180 7e-13
2q3h_A201 The Crystal Structure Of Rhoua In The Gdp-bound Sta 1e-12
1xtq_A177 Structure Of Small Gtpase Human Rheb In Complex Wit 1e-12
3t5g_A181 Structure Of Fully Modified Farnesylated Rheb In Co 1e-12
2erx_A172 Crystal Structure Of Diras2 In Complex With Gdp And 1e-12
3sea_A167 Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo 2e-12
1e96_A192 Structure Of The RacP67PHOX COMPLEX Length = 192 2e-12
2l0x_A169 Solution Structure Of The 21 Kda Gtpase Rheb Bound 2e-12
1i4t_D192 Crystal Structure Analysis Of Rac1-Gmppnp In Comple 2e-12
2j0v_A212 The Crystal Structure Of Arabidopsis Thaliana Rac7- 2e-12
3sbd_A187 Crystal Structure Of Rac1 P29s Mutant Length = 187 2e-12
2fju_A178 Activated Rac1 Bound To Its Effector Phospholipase 4e-12
1he1_C176 Crystal Structure Of The Complex Between The Gap Do 4e-12
1foe_B177 Crystal Structure Of Rac1 In Complex With The Guani 4e-12
3sua_A184 Crystal Structure Of The Intracellular Domain Of Pl 4e-12
1ds6_A192 Crystal Structure Of A Rac-Rhogdi Complex Length = 4e-12
2yin_C196 Structure Of The Complex Between Dock2 And Rac1. Le 5e-12
2wkp_A332 Structure Of A Photoactivatable Rac1 Containing Lov 5e-12
2wkr_A332 Structure Of A Photoactivatable Rac1 Containing The 6e-12
2w2t_A185 Rac2 (G12v) In Complex With Gdp Length = 185 6e-12
2wkq_A332 Structure Of A Photoactivatable Rac1 Containing The 6e-12
3th5_A204 Crystal Structure Of Wild-Type Rac1 Length = 204 6e-12
3bwd_D182 Crystal Structure Of The Plant Rho Protein Rop5 Len 1e-11
2c2h_A192 Crystal Structure Of The Human Rac3 In Complex With 1e-11
2j1l_A214 Crystal Structure Of Human Rho-Related Gtp-Binding 1e-11
2g0n_A179 The Crystal Structure Of The Human Rac3 In Complex 2e-11
1cxz_A182 Crystal Structure Of Human Rhoa Complexed With The 2e-11
2ic5_A180 Crystal Structure Of Human Rac3 Grown In The Presen 2e-11
3b13_B184 Crystal Structure Of The Dhr-2 Domain Of Dock2 In C 2e-11
3tvd_A193 Crystal Structure Of Mouse Rhoa-Gtp Complex Length 2e-11
4gzm_A204 Crystal Structure Of Rac1 F28l Mutant Length = 204 3e-11
1s1c_A183 Crystal Structure Of The Complex Between The Human 3e-11
3kz1_E182 Crystal Structure Of The Complex Of Pdz-Rhogef DhPH 3e-11
3lw8_A185 Shigella Ipgb2 In Complex With Human Rhoa, Gdp And 3e-11
3ryt_C180 The Plexin A1 Intracellular Region In Complex With 3e-11
1x86_B196 Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-A 3e-11
4f38_A195 Crystal Structure Of Geranylgeranylated Rhoa In Com 3e-11
4gzl_A204 Crystal Structure Of Rac1 Q61l Mutant Length = 204 4e-11
1lb1_B192 Crystal Structure Of The Dbl And Pleckstrin Homolog 4e-11
1gwn_A205 The Crystal Structure Of The Core Domain Of RhoeRND 4e-11
2atx_A194 Crystal Structure Of The Tc10 Gppnhp Complex Length 4e-11
2v55_B200 Mechanism Of Multi-site Phosphorylation From A Rock 4e-11
1m7b_A184 Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATI 5e-11
2w2v_A184 Rac2 (G12v) In Complex With Gtpgs Length = 184 7e-11
1xcg_B178 Crystal Structure Of Human Rhoa In Complex With DhP 8e-11
3q3j_B214 Crystal Structure Of Plexin A2 Rbd In Complex With 9e-11
1tx4_B177 RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 9e-11
2gcn_A201 Crystal Structure Of The Human Rhoc-Gdp Complex Len 9e-11
3msx_A180 Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With 9e-11
1dpf_A180 Crystal Structure Of A Mg-Free Form Of Rhoa Complex 9e-11
1ow3_B193 Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With 1e-10
2gco_A201 Crystal Structure Of The Human Rhoc-gppnhp Complex 1e-10
1cc0_A190 Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Le 1e-10
3kkp_A183 Crystal Structure Of M-Ras P40d In Complex With Gpp 1e-10
3pir_A183 Crystal Structure Of M-Rasd41e In Complex With Gppn 1e-10
3a58_B188 Crystal Structure Of Sec3p - Rho1p Complex From Sac 1e-10
2fv8_A207 The Crystal Structure Of Rhob In The Gdp-Bound Stat 1e-10
3rap_R167 The Small G Protein Rap2 In A Non Catalytic Complex 2e-10
3kko_A183 Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX 2e-10
1x1r_A178 Crystal Structure Of M-Ras In Complex With Gdp Leng 2e-10
1z2c_A193 Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With 2e-10
1ryf_A203 Alternative Splicing Of Rac1 Generates Rac1b, A Sel 3e-10
3ref_B194 Crystal Structure Of Ehrho1 Bound To Gdp And Magnes 6e-10
1kmq_A184 Crystal Structure Of A Constitutively Activated Rho 8e-10
4dvg_A188 Crystal Structure Of E. Histolytica Formin1 Bound T 8e-10
1a4r_B191 G12v Mutant Of Human Placental Cdc42 Gtpase In The 1e-09
1an0_A190 Cdc42hs-Gdp Complex Length = 190 1e-09
2rex_B197 Crystal Structure Of The Effector Domain Of Plxnb1 1e-09
2cls_A198 The Crystal Structure Of The Human Rnd1 Gtpase In T 1e-09
1grn_A191 Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. 1e-09
2odb_A192 The Crystal Structure Of Human Cdc42 In Complex Wit 2e-09
2qrz_A189 Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is 2e-09
2dfk_B194 Crystal Structure Of The Cdc42-Collybistin Ii Compl 2e-09
2wm9_B190 Structure Of The Complex Between Dock9 And Cdc42. L 2e-09
1kz7_B188 Crystal Structure Of The DhPH FRAGMENT OF MURINE DB 2e-09
4did_A193 Crystal Structure Of Salmonella Effector N-Terminal 2e-09
1cee_A179 Solution Structure Of Cdc42 In Complex With The Gtp 2e-09
1am4_D177 Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. S 2e-09
1aje_A194 Cdc42 From Human, Nmr, 20 Structures Length = 194 2e-09
3gcg_A182 Crystal Structure Of Map And Cdc42 Complex Length = 2e-09
1doa_A191 Structure Of The Rho Family Gtp-Binding Protein Cdc 2e-09
1ees_A178 Solution Structure Of Cdc42hs Complexed With A Pept 3e-09
1gzs_A180 Crystal Structure Of The Complex Between The Gef Do 3e-09
3eg5_A178 Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex W 3e-09
2gf0_A199 The Crystal Structure Of The Human Diras1 Gtpase In 4e-09
3qbv_A178 Structure Of Designed Orthogonal Interaction Betwee 7e-09
2kb0_A178 Cdc42(T35a) Length = 178 1e-08
2ase_A178 Nmr Structure Of The F28l Mutant Of Cdc42hs Length 1e-08
3vhl_B195 Crystal Structure Of The Dhr-2 Domain Of Dock8 In C 1e-08
1nf3_A195 Structure Of Cdc42 In A Complex With The Gtpase-Bin 1e-08
1cf4_A184 Cdc42ACK GTPASE-Binding Domain Complex Length = 184 1e-08
2yc2_C208 Intraflagellar Transport Complex 25-27 From Chlamyd 2e-08
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 7e-08
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 4e-07
3q85_A169 Crystal Structure Of Rem2 G-Domain -Gtp Analog Comp 6e-07
2h18_A193 Structure Of Human Adp-Ribosylation Factor-Like 10b 6e-07
3cbq_A195 Crystal Structure Of The Human Rem2 Gtpase With Bou 1e-06
4aii_A180 Crystal Structure Of The Rat Rem2 Gtpase - G Domain 4e-06
3c5c_A187 Crystal Structure Of Human Ras-Like, Family 12 Prot 1e-05
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 1e-04
3q72_A166 Crystal Structure Of Rad G-Domain-Gtp Analog Comple 2e-04
2dpx_A174 Crystal Structure Of Human Rad Gtpase Length = 174 2e-04
2gjs_A176 The Crystal Structure Of Human Rrad In Complex With 2e-04
2nzj_A175 The Crystal Structure Of Rem1 In Complex With Gdp L 2e-04
1r4a_A165 Crystal Structure Of Gtp-Bound Adp-Ribosylation Fac 3e-04
1moz_A183 Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharo 5e-04
3tjz_A164 Crystal Structure Of Arf1 Bound To The GammaZETA-Co 5e-04
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 6e-04
4dcn_A166 Crystal Structure Analysis Of The Arfaptin2 Bar Dom 7e-04
>pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 Back     alignment and structure

Iteration: 1

Score = 170 bits (431), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 76/152 (50%), Positives = 110/152 (72%) Query: 117 VGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMYY 176 VGKTS+V+RY F+ T+GASF T K+N+G +V L +WDTAGQERF ++ P+YY Sbjct: 17 VGKTSLVLRYCENKFNDKHITTLGASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYY 76 Query: 177 RNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFH 236 R++N A+LV+DIT SF +K WVKEL++ + + LC+VGNK DLE R V+ +EA Sbjct: 77 RDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAES 136 Query: 237 YSKSIGGTYYETSALQDQGIEDVFLNVSKGLI 268 Y++S+G +Y TSA Q++GIE++FL++ K +I Sbjct: 137 YAESVGAKHYHTSAKQNKGIEELFLDLCKRMI 168
>pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 Back     alignment and structure
>pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 Back     alignment and structure
>pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 Back     alignment and structure
>pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 Back     alignment and structure
>pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 Back     alignment and structure
>pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 Back     alignment and structure
>pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 Back     alignment and structure
>pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 Back     alignment and structure
>pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 Back     alignment and structure
>pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Monomeric Gtpase Rab5c (Mouse) Length = 164 Back     alignment and structure
>pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 Back     alignment and structure
>pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 Back     alignment and structure
>pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 Back     alignment and structure
>pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 Back     alignment and structure
>pdb|1Z0D|A Chain A, Gdp-bound Rab5c Gtpase Length = 167 Back     alignment and structure
>pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 Back     alignment and structure
>pdb|3MJH|A Chain A, Crystal Structure Of Human Rab5a In Complex With The C2h2 Zinc Finger Of Eea1 Length = 168 Back     alignment and structure
>pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 Back     alignment and structure
>pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 Back     alignment and structure
>pdb|3TSO|A Chain A, Structure Of The Cancer Associated Rab25 Protein In Complex With Fip2 Length = 178 Back     alignment and structure
>pdb|2OIL|A Chain A, Crystal Structure Of Human Rab25 In Complex With Gdp Length = 193 Back     alignment and structure
>pdb|2EW1|A Chain A, Crystal Structure Of Rab30 In Complex With A Gtp Analogue Length = 201 Back     alignment and structure
>pdb|2A5J|A Chain A, Crystal Structure Of Human Rab2b Length = 191 Back     alignment and structure
>pdb|1Z0A|A Chain A, Gdp-Bound Rab2a Gtpase Length = 174 Back     alignment and structure
>pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 Back     alignment and structure
>pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 Back     alignment and structure
>pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 Back     alignment and structure
>pdb|1Z0F|A Chain A, Gdp-Bound Rab14 Gtpase Length = 179 Back     alignment and structure
>pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 Back     alignment and structure
>pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|4DRZ|A Chain A, Crystal Structure Of Human Rab14 Length = 196 Back     alignment and structure
>pdb|1Z0K|A Chain A, Structure Of Gtp-Bound Rab4q67l Gtpase In Complex With The Central Rab Binding Domain Of Rabenosyn-5 Length = 172 Back     alignment and structure
>pdb|2O52|A Chain A, Crystal Structure Of Human Rab4b In Complex With Gdp Length = 200 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|1OIW|A Chain A, X-ray Structure Of The Small G Protein Rab11a In Complex With Gtpgammas Length = 191 Back     alignment and structure
>pdb|2HV8|A Chain A, Crystal Structure Of Gtp-Bound Rab11 In Complex With Fip3 Length = 172 Back     alignment and structure
>pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 Back     alignment and structure
>pdb|2GZD|A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 Length = 173 Back     alignment and structure
>pdb|2D7C|A Chain A, Crystal Structure Of Human Rab11 In Complex With Fip3 Rab- Binding Domain Length = 167 Back     alignment and structure
>pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 Back     alignment and structure
>pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 Back     alignment and structure
>pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 Back     alignment and structure
>pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 Back     alignment and structure
>pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 Back     alignment and structure
>pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 Back     alignment and structure
>pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 Back     alignment and structure
>pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 Back     alignment and structure
>pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 Back     alignment and structure
>pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 Back     alignment and structure
>pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 Back     alignment and structure
>pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 Back     alignment and structure
>pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 Back     alignment and structure
>pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 Back     alignment and structure
>pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|1T91|A Chain A, Crystal Structure Of Human Small Gtpase Rab7(Gtp) Length = 207 Back     alignment and structure
>pdb|1T91|A Chain A, Crystal Structure Of Human Small Gtpase Rab7(Gtp) Length = 207 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 Back     alignment and structure
>pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 Back     alignment and structure
>pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|1KY2|A Chain A, Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 Back     alignment and structure
>pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 Back     alignment and structure
>pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 Back     alignment and structure
>pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 Back     alignment and structure
>pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 Back     alignment and structure
>pdb|1Z22|A Chain A, Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Space Group Length = 168 Back     alignment and structure
>pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 Back     alignment and structure
>pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 Back     alignment and structure
>pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 Back     alignment and structure
>pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 Back     alignment and structure
>pdb|1Z06|A Chain A, Gppnhp-Bound Rab33 Gtpase Length = 189 Back     alignment and structure
>pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 Back     alignment and structure
>pdb|1YZL|A Chain A, Gppnhp-Bound Rab9 Gtpase Length = 179 Back     alignment and structure
>pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 Back     alignment and structure
>pdb|2G77|B Chain B, Crystal Structure Of Gyp1 Tbc Domain In Complex With Rab33 Gtpase Bound To Gdp And Alf3 Length = 198 Back     alignment and structure
>pdb|1WMS|A Chain A, High Resolution Crystal Structure Of Human Rab9 Gtpase: A Novel Antiviral Drug Target Length = 177 Back     alignment and structure
>pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii Length = 177 Back     alignment and structure
>pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 Back     alignment and structure
>pdb|2OCB|A Chain A, Crystal Structure Of Human Rab9b In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure
>pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 Back     alignment and structure
>pdb|2BKU|A Chain A, Kap95p:rangtp Complex Length = 177 Back     alignment and structure
>pdb|3EA5|A Chain A, Kap95p Binding Induces The Switch Loops Of Rangdp To Adopt The Gtp- Bound Conformation: Implications For Nuclear Import Complex Assembly Dynamics Length = 216 Back     alignment and structure
>pdb|1RRP|A Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 204 Back     alignment and structure
>pdb|1QG2|A Chain A, Canine Gdp-Ran R76e Mutant Length = 216 Back     alignment and structure
>pdb|1A2K|C Chain C, Gdpran-Ntf2 Complex Length = 216 Back     alignment and structure
>pdb|3GJ0|A Chain A, Crystal Structure Of Human Rangdp Length = 221 Back     alignment and structure
>pdb|1WA5|A Chain A, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 176 Back     alignment and structure
>pdb|1QBK|C Chain C, Structure Of The Karyopherin Beta2-ran Gppnhp Nuclear Transport Complex Length = 216 Back     alignment and structure
>pdb|1QG4|A Chain A, Canine Gdp-Ran F72y Mutant Length = 216 Back     alignment and structure
>pdb|1CLU|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|1AGP|A Chain A, Three-Dimensional Structures And Properties Of A Transforming And A Nontransforming Gly-12 Mutant Of P21-H-Ras Length = 166 Back     alignment and structure
>pdb|3CLV|A Chain A, Crystal Structure Of Rab5a From Plasmodium Falciparum, Pfb0500c Length = 208 Back     alignment and structure
>pdb|421P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2BOV|A Chain A, Molecular Recognition Of An Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme By Rala Gtpase Length = 206 Back     alignment and structure
>pdb|2A78|A Chain A, Crystal Structure Of The C3bot-Rala Complex Reveals A Novel Type Of Action Of A Bacterial Exoenzyme Length = 187 Back     alignment and structure
>pdb|1UAD|A Chain A, Crystal Structure Of The Rala-gppnhp-sec5 Ral-binding Domain Complex Length = 175 Back     alignment and structure
>pdb|3M1I|A Chain A, Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex With Yeas (Yrb1p) And Yeast Rangtp (Gsp1pgtp) Length = 219 Back     alignment and structure
>pdb|1JAH|A Chain A, H-Ras P21 Protein Mutant G12p, Complexed With Guanosine-5'- [beta,Gamma-Methylene] Triphosphate And Magnesium Length = 166 Back     alignment and structure
>pdb|3ICQ|B Chain B, Karyopherin Nuclear State Length = 171 Back     alignment and structure
>pdb|2X19|A Chain A, Crystal Structure Of Importin13 - Rangtp Complex Length = 172 Back     alignment and structure
>pdb|1U8Y|A Chain A, Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal Two Novel Binding Sites That Are Also Present In Ras And Rap Length = 168 Back     alignment and structure
>pdb|3RAN|A Chain A, Canine Gdp-Ran Q69l Mutant Length = 216 Back     alignment and structure
>pdb|3NBY|C Chain C, Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclear Export Complex Length = 176 Back     alignment and structure
>pdb|3NC1|C Chain C, Crystal Structure Of The Crm1-Rangtp Complex Length = 182 Back     alignment and structure
>pdb|4EPR|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4DSO|A Chain A, Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity Length = 189 Back     alignment and structure
>pdb|3GJ4|A Chain A, Crystal Structure Of Human Rangdp-Nup153znf3 Complex Length = 221 Back     alignment and structure
>pdb|2KE5|A Chain A, Solution Structure And Dynamics Of The Small Gtpase Ralb In Its Active Conformation: Significance For Effector Protein Binding Length = 174 Back     alignment and structure
>pdb|2KWI|A Chain A, Ralb-Rlip76 (Ralbp1) Complex Length = 178 Back     alignment and structure
>pdb|1ZC3|A Chain A, Crystal Structure Of The Ral-Binding Domain Of Exo84 In Complex With The Active Rala Length = 175 Back     alignment and structure
>pdb|3CON|A Chain A, Crystal Structure Of The Human Nras Gtpase Bound With Gdp Length = 190 Back     alignment and structure
>pdb|4Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 189 Back     alignment and structure
>pdb|2CL0|X Chain X, Crystal Structure Analysis Of A Fluorescent Form Of H-Ras P21 In Complex With Gppnhp Length = 166 Back     alignment and structure
>pdb|3K9N|A Chain A, Allosteric Modulation Of H-Ras Gtpase Length = 166 Back     alignment and structure
>pdb|4EFM|A Chain A, Crystal Structure Of H-Ras G12v In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|4EFL|A Chain A, Crystal Structure Of H-Ras Wt In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|3DDC|A Chain A, Crystal Structure Of Nore1a In Complex With Ras Length = 166 Back     alignment and structure
>pdb|2C5L|A Chain A, Structure Of Plc Epsilon Ras Association Domain With Hras Length = 173 Back     alignment and structure
>pdb|2ERY|A Chain A, The Crystal Structure Of The Ras Related Protein Rras2 (Rras2) In The Gdp Bound State Length = 172 Back     alignment and structure
>pdb|1LFD|B Chain B, Crystal Structure Of The Active Ras Protein Complexed With The Ras-interacting Domain Of Ralgds Length = 167 Back     alignment and structure
>pdb|2X1V|A Chain A, Crystal Structure Of The Activating H-Ras I163f Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|2HXS|A Chain A, Crystal Structure Of Rab28a Gtpase In The Inactive (Gdp-3'p- Bound) Form Length = 178 Back     alignment and structure
>pdb|3LO5|A Chain A, Crystal Structure Of The Dominant Negative S17n Mutant Of Ras Length = 166 Back     alignment and structure
>pdb|221P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|6Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 171 Back     alignment and structure
>pdb|2Q21|A Chain A, Crystal Structures At 2.2 Angstroms Resolution Of The Catalytic Domains Of Normal Ras Protein And An Oncogenic Mutant Complexed With Gsp Length = 171 Back     alignment and structure
>pdb|2FN4|A Chain A, The Crystal Structure Of Human Ras-Related Protein, Rras, In The Gdp- Bound State Length = 181 Back     alignment and structure
>pdb|1WQ1|R Chain R, Ras-Rasgap Complex Length = 166 Back     alignment and structure
>pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|3KKM|A Chain A, Crystal Structure Of H-Ras T35s In Complex With Gppnhp Length = 172 Back     alignment and structure
>pdb|4EPX|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4EPT|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|1LF0|A Chain A, Crystal Structure Of Rasa59g In The Gtp-Bound Form Length = 166 Back     alignment and structure
>pdb|3V4F|A Chain A, H-Ras Peg 400CACL2, ORDERED OFF Length = 166 Back     alignment and structure
>pdb|2RGB|A Chain A, Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 Back     alignment and structure
>pdb|2QUZ|A Chain A, Crystal Structure Of The Activating H-Rask117r Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|621P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|3I3S|R Chain R, Crystal Structure Of H-Ras With Thr50 Replaced By Isoleucine Length = 166 Back     alignment and structure
>pdb|1IAQ|A Chain A, C-H-Ras P21 Protein Mutant With Thr 35 Replaced By Ser (T35s) Complexed With Guanosine-5'-[b,G-Imido] Triphosphate Length = 166 Back     alignment and structure
>pdb|1ZW6|A Chain A, Crystal Structure Of The Gtp-Bound Form Of Rasq61g Length = 166 Back     alignment and structure
>pdb|4EFN|A Chain A, Crystal Structure Of H-Ras Q61l In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|1ZVQ|A Chain A, Structure Of The Q61g Mutant Of Ras In The Gdp-Bound Form Length = 166 Back     alignment and structure
>pdb|521P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|1NVV|Q Chain Q, Structural Evidence For Feedback Activation By Rasgtp Of The Ras-specific Nucleotide Exchange Factor Sos Length = 166 Back     alignment and structure
>pdb|721P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2RGC|A Chain A, Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 Back     alignment and structure
>pdb|2RGA|A Chain A, Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 Back     alignment and structure
>pdb|4DJT|A Chain A, Crystal Structure Of A Nuclear Gtp-Binding Protein From Encephalitozoon Cuniculi Bound To Gdp-Mg2+ Length = 218 Back     alignment and structure
>pdb|1XJ0|A Chain A, Crystal Structure Of The Gdp-Bound Form Of The Rasg60a Mutant Length = 166 Back     alignment and structure
>pdb|1XCM|A Chain A, Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mutant Length = 167 Back     alignment and structure
>pdb|4DXA|A Chain A, Co-Crystal Structure Of Rap1 In Complex With Krit1 Length = 169 Back     alignment and structure
>pdb|1HH4|A Chain A, Rac1-Rhogdi Complex Involved In Nadph Oxidase Activation Length = 192 Back     alignment and structure
>pdb|2WBL|C Chain C, Three-Dimensional Structure Of A Binary Rop-Prone Complex Length = 180 Back     alignment and structure
>pdb|1G4U|R Chain R, Crystal Structure Of The Salmonella Tyrosine Phosphatase And Gtpase Activating Protein Sptp Bound To Rac1 Length = 184 Back     alignment and structure
>pdb|1MH1|A Chain A, Small G-Protein Length = 186 Back     alignment and structure
>pdb|3GFT|A Chain A, Human K-Ras In Complex With A Gtp Analogue Length = 187 Back     alignment and structure
>pdb|2H7V|A Chain A, Co-crystal Structure Of Ypka-rac1 Length = 188 Back     alignment and structure
>pdb|3BRW|D Chain D, Structure Of The Rap-Rapgap Complex Length = 167 Back     alignment and structure
>pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 167 Back     alignment and structure
>pdb|3OES|A Chain A, Crystal Structure Of The Small Gtpase Rhebl1 Length = 201 Back     alignment and structure
>pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 167 Back     alignment and structure
>pdb|2ATV|A Chain A, The Crystal Structure Of Human Rerg In The Gdp Bound State Length = 196 Back     alignment and structure
>pdb|1I4D|D Chain D, Crystal Structure Analysis Of Rac1-Gdp Complexed With Arfaptin (P21) Length = 192 Back     alignment and structure
>pdb|2VRW|A Chain A, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 184 Back     alignment and structure
>pdb|2NTY|C Chain C, Rop4-Gdp-Prone8 Length = 180 Back     alignment and structure
>pdb|2Q3H|A Chain A, The Crystal Structure Of Rhoua In The Gdp-bound State Length = 201 Back     alignment and structure
>pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 Back     alignment and structure
>pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 Back     alignment and structure
>pdb|2ERX|A Chain A, Crystal Structure Of Diras2 In Complex With Gdp And Inorganic Phosphate Length = 172 Back     alignment and structure
>pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 Back     alignment and structure
>pdb|1E96|A Chain A, Structure Of The RacP67PHOX COMPLEX Length = 192 Back     alignment and structure
>pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 Back     alignment and structure
>pdb|1I4T|D Chain D, Crystal Structure Analysis Of Rac1-Gmppnp In Complex With Arfaptin Length = 192 Back     alignment and structure
>pdb|2J0V|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Rac7-Rop9: The First Ras Superfamily Gtpase From The Plant Kingdom Length = 212 Back     alignment and structure
>pdb|3SBD|A Chain A, Crystal Structure Of Rac1 P29s Mutant Length = 187 Back     alignment and structure
>pdb|2FJU|A Chain A, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 178 Back     alignment and structure
>pdb|1HE1|C Chain C, Crystal Structure Of The Complex Between The Gap Domain Of The Pseudomonas Aeruginosa Exos Toxin And Human Rac Length = 176 Back     alignment and structure
>pdb|1FOE|B Chain B, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 177 Back     alignment and structure
>pdb|3SUA|A Chain A, Crystal Structure Of The Intracellular Domain Of Plexin-B1 In Complex With Rac1 Length = 184 Back     alignment and structure
>pdb|1DS6|A Chain A, Crystal Structure Of A Rac-Rhogdi Complex Length = 192 Back     alignment and structure
>pdb|2YIN|C Chain C, Structure Of The Complex Between Dock2 And Rac1. Length = 196 Back     alignment and structure
>pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 Back     alignment and structure
>pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 Back     alignment and structure
>pdb|2W2T|A Chain A, Rac2 (G12v) In Complex With Gdp Length = 185 Back     alignment and structure
>pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 Back     alignment and structure
>pdb|3TH5|A Chain A, Crystal Structure Of Wild-Type Rac1 Length = 204 Back     alignment and structure
>pdb|3BWD|D Chain D, Crystal Structure Of The Plant Rho Protein Rop5 Length = 182 Back     alignment and structure
>pdb|2C2H|A Chain A, Crystal Structure Of The Human Rac3 In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|2J1L|A Chain A, Crystal Structure Of Human Rho-Related Gtp-Binding Protein Rhod Length = 214 Back     alignment and structure
>pdb|2G0N|A Chain A, The Crystal Structure Of The Human Rac3 In Complex With Gdp And Chloride Length = 179 Back     alignment and structure
>pdb|1CXZ|A Chain A, Crystal Structure Of Human Rhoa Complexed With The Effector Domain Of The Protein Kinase PknPRK1 Length = 182 Back     alignment and structure
>pdb|2IC5|A Chain A, Crystal Structure Of Human Rac3 Grown In The Presence Of Gpp(Nh)p. Length = 180 Back     alignment and structure
>pdb|3B13|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock2 In Complex With Rac1 (T17n Mutant) Length = 184 Back     alignment and structure
>pdb|3TVD|A Chain A, Crystal Structure Of Mouse Rhoa-Gtp Complex Length = 193 Back     alignment and structure
>pdb|4GZM|A Chain A, Crystal Structure Of Rac1 F28l Mutant Length = 204 Back     alignment and structure
>pdb|1S1C|A Chain A, Crystal Structure Of The Complex Between The Human Rhoa And Rho-Binding Domain Of Human Rocki Length = 183 Back     alignment and structure
>pdb|3KZ1|E Chain E, Crystal Structure Of The Complex Of Pdz-Rhogef DhPH DOMAINS WITH GTP- Gamma-S Activated Rhoa Length = 182 Back     alignment and structure
>pdb|3LW8|A Chain A, Shigella Ipgb2 In Complex With Human Rhoa, Gdp And Mg2+ (Complex A) Length = 185 Back     alignment and structure
>pdb|3RYT|C Chain C, The Plexin A1 Intracellular Region In Complex With Rac1 Length = 180 Back     alignment and structure
>pdb|1X86|B Chain B, Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-Associated Rhogef In Complex With Rhoa Length = 196 Back     alignment and structure
>pdb|4F38|A Chain A, Crystal Structure Of Geranylgeranylated Rhoa In Complex With Rhogdi In Its Active Gppnhp-Bound Form Length = 195 Back     alignment and structure
>pdb|4GZL|A Chain A, Crystal Structure Of Rac1 Q61l Mutant Length = 204 Back     alignment and structure
>pdb|1LB1|B Chain B, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 192 Back     alignment and structure
>pdb|1GWN|A Chain A, The Crystal Structure Of The Core Domain Of RhoeRND3 - A Constitutively Activated Small G Protein Length = 205 Back     alignment and structure
>pdb|2ATX|A Chain A, Crystal Structure Of The Tc10 Gppnhp Complex Length = 194 Back     alignment and structure
>pdb|2V55|B Chain B, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 200 Back     alignment and structure
>pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATIONS Length = 184 Back     alignment and structure
>pdb|2W2V|A Chain A, Rac2 (G12v) In Complex With Gtpgs Length = 184 Back     alignment and structure
>pdb|1XCG|B Chain B, Crystal Structure Of Human Rhoa In Complex With DhPH Fragment Of Pdzrhogef Length = 178 Back     alignment and structure
>pdb|3Q3J|B Chain B, Crystal Structure Of Plexin A2 Rbd In Complex With Rnd1 Length = 214 Back     alignment and structure
>pdb|1TX4|B Chain B, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 Back     alignment and structure
>pdb|2GCN|A Chain A, Crystal Structure Of The Human Rhoc-Gdp Complex Length = 201 Back     alignment and structure
>pdb|3MSX|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 180 Back     alignment and structure
>pdb|1DPF|A Chain A, Crystal Structure Of A Mg-Free Form Of Rhoa Complexed With Gdp Length = 180 Back     alignment and structure
>pdb|1OW3|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 193 Back     alignment and structure
>pdb|2GCO|A Chain A, Crystal Structure Of The Human Rhoc-gppnhp Complex Length = 201 Back     alignment and structure
>pdb|1CC0|A Chain A, Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Length = 190 Back     alignment and structure
>pdb|3KKP|A Chain A, Crystal Structure Of M-Ras P40d In Complex With Gppnhp Length = 183 Back     alignment and structure
>pdb|3PIR|A Chain A, Crystal Structure Of M-Rasd41e In Complex With Gppnhp (Type 1) Length = 183 Back     alignment and structure
>pdb|3A58|B Chain B, Crystal Structure Of Sec3p - Rho1p Complex From Saccharomyces Cerevisiae Length = 188 Back     alignment and structure
>pdb|2FV8|A Chain A, The Crystal Structure Of Rhob In The Gdp-Bound State Length = 207 Back     alignment and structure
>pdb|3RAP|R Chain R, The Small G Protein Rap2 In A Non Catalytic Complex With Gtp Length = 167 Back     alignment and structure
>pdb|3KKO|A Chain A, Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX WITH GP Length = 183 Back     alignment and structure
>pdb|1X1R|A Chain A, Crystal Structure Of M-Ras In Complex With Gdp Length = 178 Back     alignment and structure
>pdb|1Z2C|A Chain A, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 193 Back     alignment and structure
>pdb|1RYF|A Chain A, Alternative Splicing Of Rac1 Generates Rac1b, A Self-Activating Gtpase Length = 203 Back     alignment and structure
>pdb|3REF|B Chain B, Crystal Structure Of Ehrho1 Bound To Gdp And Magnesium Length = 194 Back     alignment and structure
>pdb|1KMQ|A Chain A, Crystal Structure Of A Constitutively Activated Rhoa Mutant (Q63l) Length = 184 Back     alignment and structure
>pdb|4DVG|A Chain A, Crystal Structure Of E. Histolytica Formin1 Bound To Ehrho1-Gtpgammas Length = 188 Back     alignment and structure
>pdb|1A4R|B Chain B, G12v Mutant Of Human Placental Cdc42 Gtpase In The Gdp Form Length = 191 Back     alignment and structure
>pdb|1AN0|A Chain A, Cdc42hs-Gdp Complex Length = 190 Back     alignment and structure
>pdb|2REX|B Chain B, Crystal Structure Of The Effector Domain Of Plxnb1 Bound With Rnd1 Gtpase Length = 197 Back     alignment and structure
>pdb|2CLS|A Chain A, The Crystal Structure Of The Human Rnd1 Gtpase In The Active Gtp Bound State Length = 198 Back     alignment and structure
>pdb|1GRN|A Chain A, Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. Length = 191 Back     alignment and structure
>pdb|2ODB|A Chain A, The Crystal Structure Of Human Cdc42 In Complex With The Crib Domain Of Human P21-Activated Kinase 6 (Pak6) Length = 192 Back     alignment and structure
>pdb|2QRZ|A Chain A, Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is Required Length = 189 Back     alignment and structure
>pdb|2DFK|B Chain B, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 194 Back     alignment and structure
>pdb|2WM9|B Chain B, Structure Of The Complex Between Dock9 And Cdc42. Length = 190 Back     alignment and structure
>pdb|1KZ7|B Chain B, Crystal Structure Of The DhPH FRAGMENT OF MURINE DBS IN Complex With The Placental Isoform Of Human Cdc42 Length = 188 Back     alignment and structure
>pdb|4DID|A Chain A, Crystal Structure Of Salmonella Effector N-Terminal Domain Sopb In Complex With Cdc42 Length = 193 Back     alignment and structure
>pdb|1CEE|A Chain A, Solution Structure Of Cdc42 In Complex With The Gtpase Binding Domain Of Wasp Length = 179 Back     alignment and structure
>pdb|1AM4|D Chain D, Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. Sapiens) Length = 177 Back     alignment and structure
>pdb|1AJE|A Chain A, Cdc42 From Human, Nmr, 20 Structures Length = 194 Back     alignment and structure
>pdb|3GCG|A Chain A, Crystal Structure Of Map And Cdc42 Complex Length = 182 Back     alignment and structure
>pdb|1DOA|A Chain A, Structure Of The Rho Family Gtp-Binding Protein Cdc42 In Complex With The Multifunctional Regulator Rhogdi Length = 191 Back     alignment and structure
>pdb|1EES|A Chain A, Solution Structure Of Cdc42hs Complexed With A Peptide Derived From P-21 Activated Kinase, Nmr, 20 Structures Length = 178 Back     alignment and structure
>pdb|1GZS|A Chain A, Crystal Structure Of The Complex Between The Gef Domain Of The Salmonella Typhimurium Sope Toxin And Human Cdc42 Length = 180 Back     alignment and structure
>pdb|3EG5|A Chain A, Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex With Cdc42-Gmppnp Length = 178 Back     alignment and structure
>pdb|2GF0|A Chain A, The Crystal Structure Of The Human Diras1 Gtpase In The Inactive Gdp Bound State Length = 199 Back     alignment and structure
>pdb|3QBV|A Chain A, Structure Of Designed Orthogonal Interaction Between Cdc42 And Nucleotide Exchange Domains Of Intersectin Length = 178 Back     alignment and structure
>pdb|2KB0|A Chain A, Cdc42(T35a) Length = 178 Back     alignment and structure
>pdb|2ASE|A Chain A, Nmr Structure Of The F28l Mutant Of Cdc42hs Length = 178 Back     alignment and structure
>pdb|3VHL|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock8 In Complex With Cdc42 (T17n Mutant) Length = 195 Back     alignment and structure
>pdb|1NF3|A Chain A, Structure Of Cdc42 In A Complex With The Gtpase-Binding Domain Of The Cell Polarity Protein, Par6 Length = 195 Back     alignment and structure
>pdb|1CF4|A Chain A, Cdc42ACK GTPASE-Binding Domain Complex Length = 184 Back     alignment and structure
>pdb|2YC2|C Chain C, Intraflagellar Transport Complex 25-27 From Chlamydomonas Length = 208 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|3Q85|A Chain A, Crystal Structure Of Rem2 G-Domain -Gtp Analog Complex Length = 169 Back     alignment and structure
>pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 Back     alignment and structure
>pdb|3CBQ|A Chain A, Crystal Structure Of The Human Rem2 Gtpase With Bound Gdp Length = 195 Back     alignment and structure
>pdb|4AII|A Chain A, Crystal Structure Of The Rat Rem2 Gtpase - G Domain Bound To Gdp Length = 180 Back     alignment and structure
>pdb|3C5C|A Chain A, Crystal Structure Of Human Ras-Like, Family 12 Protein In Complex With Gdp Length = 187 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|3Q72|A Chain A, Crystal Structure Of Rad G-Domain-Gtp Analog Complex Length = 166 Back     alignment and structure
>pdb|2DPX|A Chain A, Crystal Structure Of Human Rad Gtpase Length = 174 Back     alignment and structure
>pdb|2GJS|A Chain A, The Crystal Structure Of Human Rrad In Complex With Gdp Length = 176 Back     alignment and structure
>pdb|2NZJ|A Chain A, The Crystal Structure Of Rem1 In Complex With Gdp Length = 175 Back     alignment and structure
>pdb|1R4A|A Chain A, Crystal Structure Of Gtp-Bound Adp-Ribosylation Factor Like Protein 1 (Arl1) And Grip Domain Of Golgin245 Complex Length = 165 Back     alignment and structure
>pdb|1MOZ|A Chain A, Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharomyces Cerevisiae Length = 183 Back     alignment and structure
>pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|4DCN|A Chain A, Crystal Structure Analysis Of The Arfaptin2 Bar Domain In Complex With Arl1 Length = 166 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query617
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 1e-65
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 3e-09
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 6e-65
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 3e-09
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 8e-65
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 4e-09
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 3e-64
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 7e-09
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 3e-64
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 7e-09
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 2e-62
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 2e-08
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 4e-62
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 2e-08
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 8e-59
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 2e-07
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 1e-58
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 3e-06
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 2e-58
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 2e-07
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 4e-58
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 3e-08
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 4e-58
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 1e-07
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 4e-58
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 2e-07
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 5e-58
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 2e-07
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 1e-57
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 4e-07
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 2e-57
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 5e-07
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 3e-57
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 4e-07
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 5e-57
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 6e-07
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 5e-57
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 7e-07
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 7e-56
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 1e-06
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 1e-55
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 1e-06
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 3e-55
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 2e-06
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 6e-55
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 3e-06
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 6e-55
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 3e-06
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 8e-55
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 2e-06
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 1e-54
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 2e-06
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 1e-54
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 3e-07
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 2e-54
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 9e-06
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 3e-54
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 3e-06
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 3e-54
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 4e-06
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 3e-54
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 2e-08
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 4e-54
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 5e-08
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 5e-54
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 2e-06
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 8e-54
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 6e-07
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 1e-53
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 9e-07
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 1e-53
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 5e-07
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 1e-53
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 4e-07
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 1e-52
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 5e-07
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 3e-52
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 4e-06
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 7e-52
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 1e-04
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 1e-51
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 8e-07
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 6e-51
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 1e-09
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 1e-50
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 2e-04
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 1e-50
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 1e-06
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 2e-50
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 6e-04
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 2e-49
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 5e-05
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 2e-49
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 4e-04
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 3e-49
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 7e-04
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 5e-49
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 7e-04
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 5e-49
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 3e-04
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 8e-49
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 6e-05
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 8e-49
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 8e-04
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 6e-48
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 8e-04
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 8e-48
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 7e-04
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 1e-47
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 3e-04
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 2e-47
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 2e-04
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 7e-47
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 4e-04
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 1e-46
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 3e-04
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 3e-46
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 4e-04
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 4e-46
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 6e-04
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 8e-46
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 2e-04
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 4e-45
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 7e-04
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 2e-44
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 4e-44
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 4e-04
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 1e-43
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 3e-05
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 2e-42
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 2e-42
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 2e-05
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 4e-42
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 2e-04
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 2e-41
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 1e-40
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 3e-35
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 3e-34
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 2e-33
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 1e-32
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 4e-32
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 6e-32
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 4e-31
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 6e-31
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 6e-30
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 9e-30
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 3e-29
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 3e-29
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 5e-27
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 8e-21
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 1e-16
3t1o_A198 Gliding protein MGLA; G domain containing protein, 2e-16
3llu_A196 RAS-related GTP-binding protein C; structural geno 2e-14
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 1e-13
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 1e-13
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 2e-13
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 2e-13
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 2e-13
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 2e-13
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 4e-13
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 9e-13
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 2e-12
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 3e-12
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 6e-12
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 9e-12
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 9e-11
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
3o47_A329 ADP-ribosylation factor GTPase-activating protein 9e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-08
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 5e-08
2fh5_B214 SR-beta, signal recognition particle receptor beta 1e-06
1nrj_B218 SR-beta, signal recognition particle receptor beta 8e-06
2ged_A193 SR-beta, signal recognition particle receptor beta 1e-05
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 2e-04
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
 Score =  212 bits (541), Expect = 1e-65
 Identities = 63/152 (41%), Positives = 99/152 (65%)

Query: 116 GVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMY 175
           G GK+S+V+R++   F      TIGA+FF+  + V +  VK ++WDTAGQER+ S+APMY
Sbjct: 22  GAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMY 81

Query: 176 YRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAF 235
           YR A AA++VFD+T   SF   K WV+EL+   +  +V+ + GNK+DL  +R+V  E+A 
Sbjct: 82  YRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQ 141

Query: 236 HYSKSIGGTYYETSALQDQGIEDVFLNVSKGL 267
            Y++  G  + ETSA     ++++F  +++ L
Sbjct: 142 TYAQENGLFFMETSAKTATNVKEIFYEIARRL 173


>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Length = 255 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query617
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 100.0
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.96
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.96
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.95
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.95
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.95
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.95
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.95
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.95
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.95
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.95
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.95
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.95
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.95
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.95
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.95
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.95
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.95
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.95
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.95
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.95
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.95
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.95
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.95
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.95
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.95
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.95
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.95
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.95
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.95
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.95
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.95
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.95
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.95
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.95
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.95
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.95
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.94
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.94
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.94
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.94
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.94
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.94
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.94
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.94
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.94
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.94
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.94
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.94
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.94
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.94
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.94
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.94
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.94
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.94
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.94
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.94
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.94
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.94
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.94
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.94
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.94
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.94
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.94
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.93
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.93
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.93
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.93
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.93
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.93
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.93
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.93
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.93
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.93
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.93
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.93
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.93
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.92
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.92
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.92
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.92
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.91
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.91
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.91
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.91
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.91
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.91
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.91
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.91
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.91
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.91
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.91
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.91
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.91
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.9
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.9
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.9
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.9
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.9
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.9
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.9
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.83
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.89
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.88
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.88
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.87
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.86
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.86
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.86
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.86
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.85
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.85
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.85
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.85
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.85
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.84
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.83
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.83
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.83
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.82
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.81
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.8
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.8
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.79
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.78
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.78
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.77
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.77
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.76
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.75
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.75
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.74
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.73
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.71
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 99.71
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.7
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.69
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 99.67
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.67
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 99.67
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.67
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.67
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.66
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.66
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.66
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.65
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.65
2ged_A193 SR-beta, signal recognition particle receptor beta 99.65
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.64
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.64
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.63
1wb1_A482 Translation elongation factor SELB; selenocysteine 99.63
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.63
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.63
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.61
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.6
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.6
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 99.59
2elf_A370 Protein translation elongation factor 1A; tRNA, py 99.59
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.59
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.59
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.58
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.58
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.58
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 99.57
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.57
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.56
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 99.54
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.52
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.52
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.52
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.51
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.51
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.51
1f60_A458 Elongation factor EEF1A; protein-protein complex, 99.5
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.5
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.49
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.49
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.49
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.48
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.48
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.48
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.47
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.44
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.44
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.44
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.43
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.4
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.39
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.34
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.33
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.33
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.33
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.32
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.3
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 99.28
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.2
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.18
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.16
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 99.14
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.12
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.11
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.11
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.1
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.06
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.02
3vqt_A548 RF-3, peptide chain release factor 3; translation, 99.0
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 98.95
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.94
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.93
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.83
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.74
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.71
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.69
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.66
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.63
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.61
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.48
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.4
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.25
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.21
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 98.2
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 98.17
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.07
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.75
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.71
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.58
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 97.53
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 97.48
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.46
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 97.44
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 97.43
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 97.42
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 97.4
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 97.39
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 97.39
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.38
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 97.38
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 97.37
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 97.36
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 97.33
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 97.33
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 97.31
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 97.3
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 97.3
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 97.27
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.26
2vxe_A88 CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA 97.25
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.25
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.25
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 97.25
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 97.22
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 97.21
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.2
2fb7_A95 SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 97.19
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 97.19
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 97.18
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 97.18
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 97.17
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 97.13
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 97.13
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 97.11
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 97.1
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 97.09
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 97.08
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 97.08
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 97.07
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 97.06
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 97.05
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 97.05
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 97.05
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 97.04
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 97.04
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.03
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 97.03
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 97.03
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 97.02
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 97.0
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 97.0
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 96.99
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 96.98
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.97
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 96.97
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 96.96
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 96.95
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 96.94
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 96.92
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 96.91
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 96.9
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 96.9
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 96.87
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 96.85
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 96.84
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 96.83
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 96.83
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 96.8
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 96.77
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 96.76
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 96.76
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 96.75
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 96.74
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 96.74
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 96.71
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 96.69
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 96.68
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 96.67
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 96.67
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.67
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 96.64
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 96.62
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.54
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.54
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 96.54
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.54
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.51
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 96.5
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 96.48
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 96.45
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 96.45
1y96_A86 Gemin6, SIP2, GEM-associated protein 6; SM fold, p 96.41
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 96.37
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 96.35
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 96.35
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 96.3
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 96.22
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 96.2
3t1o_A198 Gliding protein MGLA; G domain containing protein, 96.19
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 96.18
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 96.17
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 96.08
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 95.04
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.05
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 96.05
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 96.04
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 95.98
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 95.97
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.9
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 95.9
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 95.89
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 95.87
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 95.77
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 95.75
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 95.73
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 95.73
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 95.7
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 95.67
3lxx_A239 GTPase IMAP family member 4; structural genomics c 95.62
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 95.61
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 95.61
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 95.57
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.51
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 95.43
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.4
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 95.34
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 95.3
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 95.3
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 95.27
3cwq_A209 Para family chromosome partitioning protein; alpha 95.26
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 95.18
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 95.11
3iby_A256 Ferrous iron transport protein B; G protein, G dom 95.1
3lxw_A247 GTPase IMAP family member 1; immunity, structural 95.05
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 95.02
1m5q_A130 SMAP3, small nuclear ribonucleoprotein homolog, SM 95.0
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 94.99
2fh5_B214 SR-beta, signal recognition particle receptor beta 94.92
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 94.9
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.83
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 94.8
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 94.77
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 94.65
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 94.52
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 94.32
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 94.18
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.16
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 93.98
3o47_A329 ADP-ribosylation factor GTPase-activating protein 93.94
3llu_A196 RAS-related GTP-binding protein C; structural geno 93.68
4a53_A125 EDC3; RNA binding protein; NMR {Schizosaccharomyce 93.64
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.63
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 93.44
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 93.29
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 93.06
2xxa_A433 Signal recognition particle protein; protein trans 92.91
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 92.81
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 92.76
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 92.7
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.67
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 92.66
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 92.64
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 92.59
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 92.5
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 92.43
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 92.41
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 92.35
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.0
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 91.9
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 91.85
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 91.7
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 91.65
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 91.63
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 91.61
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.56
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 91.43
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 91.41
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 91.32
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 91.29
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 91.28
2hf9_A226 Probable hydrogenase nickel incorporation protein 90.95
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 90.93
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 90.81
3uc9_A233 Increased recombination centers protein 6; rossman 90.7
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 90.66
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 90.49
1y96_B85 Gemin7, SIP3, GEM-associated protein 7; SM fold, p 90.43
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 90.41
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 90.32
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 90.21
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 90.2
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 90.15
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 90.09
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 90.07
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 89.98
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.88
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 89.76
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 89.66
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 89.63
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 89.61
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 89.59
1b0u_A262 Histidine permease; ABC transporter, transport pro 89.49
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 89.45
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 89.44
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 89.42
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 89.38
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 89.2
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 89.19
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 89.17
1sgw_A214 Putative ABC transporter; structural genomics, P p 89.16
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 89.11
1g6h_A257 High-affinity branched-chain amino acid transport 89.09
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 89.01
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 89.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 88.96
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 88.95
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 88.94
1ji0_A240 ABC transporter; ATP binding protein, structural g 88.93
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 88.93
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 88.92
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 88.88
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 88.84
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 88.83
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 88.81
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 88.81
2ghi_A260 Transport protein; multidrug resistance protein, M 88.78
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 88.71
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 88.62
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 88.59
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 88.49
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 88.43
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 88.41
2eyu_A261 Twitching motility protein PILT; pilus retraction 88.38
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 88.34
2ged_A193 SR-beta, signal recognition particle receptor beta 88.33
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 88.31
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 88.24
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 88.2
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 88.2
4a74_A231 DNA repair and recombination protein RADA; hydrola 88.15
1nrj_B218 SR-beta, signal recognition particle receptor beta 88.13
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 87.9
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 87.82
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 87.82
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 87.73
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 87.72
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 87.62
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 87.55
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 87.15
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 87.01
2vc8_A84 Enhancer of mRNA-decapping protein 3; P-BODY compo 86.95
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 86.94
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 86.87
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 86.82
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 86.73
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 86.63
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 86.56
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 86.56
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 86.48
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 86.43
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 86.43
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 86.27
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 86.24
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 86.22
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 86.2
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 86.12
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 86.12
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 86.02
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 86.0
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 85.99
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 85.95
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 85.89
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-32  Score=271.63  Aligned_cols=166  Identities=34%  Similarity=0.629  Sum_probs=146.0

Q ss_pred             cceEEEEEccCcccccccCCCCCCccccCCCCCCCCHHHHHHHHHcCCCCCccCCCcceeEEEEEEEECCeEEEEEEEec
Q psy3029          83 NKIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDT  162 (617)
Q Consensus        83 ~~ikV~i~G~~~~~~~~~~~~~~~~~~~i~G~~nVGKSSLinrl~~~~~~~~~~~t~g~~~~~~~i~~~~~~~~l~i~Dt  162 (617)
                      +++||+|+|+                      +|||||||++||+.+.|...+.||+|.++..+.+.+++..+.++||||
T Consensus        12 k~~KivlvGd----------------------~~VGKTsLi~r~~~~~f~~~~~~Tig~d~~~k~~~~~~~~v~l~iwDt   69 (216)
T 4dkx_A           12 RKFKLVFLGE----------------------QSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDT   69 (216)
T ss_dssp             -CEEEEEECS----------------------TTSSHHHHHHHHHHSCCC----------CEEEEEECSSCEEEEEEECC
T ss_pred             CcEEEEEECc----------------------CCcCHHHHHHHHHhCCCCCCcCCccceEEEEEEEEecceEEEEEEEEC
Confidence            4579999999                      999999999999999999999999999999999999999999999999


Q ss_pred             CCcccccccchhhhccCCEEEEEEeCCChhhHHHHHHHHHHHHhcCCCCCeEEEEEECCCCCCccccCHHHHHHHHHhcC
Q psy3029         163 AGQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFHYSKSIG  242 (617)
Q Consensus       163 ~G~e~~~~~~~~~~~~ad~iIlV~Dis~~~S~~~l~~~l~~i~~~~~~~iPvIlVgNK~DL~~~~~v~~~e~~~~~~~~g  242 (617)
                      +|+++|..+++.|+++++++|+|||++++.||+.+..|+..+......++|++|||||+|+..++.++.+++.+++++++
T Consensus        70 aGqe~~~~l~~~~~~~a~~~ilv~di~~~~Sf~~i~~~~~~i~~~~~~~~piilVgNK~Dl~~~r~V~~~e~~~~a~~~~  149 (216)
T 4dkx_A           70 AGLERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELN  149 (216)
T ss_dssp             SCTTTCGGGHHHHHTTCSEEEEEEETTCHHHHHTHHHHHHHHHHHHTTSSEEEEEEECTTCGGGCCSCHHHHHHHHHHHT
T ss_pred             CCchhhhhHHHHHhccccEEEEEeecchhHHHHHHHHHHHHHHHhcCCCCeEEEEeeccchHhcCcccHHHHhhHHHHhC
Confidence            99999999999999999999999999999999999999999988777779999999999999889999999999999999


Q ss_pred             CeEEEEcCCCCCCHHHHHHHHHHHHHHh
Q psy3029         243 GTYYETSALQDQGIEDVFLNVSKGLICL  270 (617)
Q Consensus       243 ~~~~evSAktg~gI~eLf~~I~~~l~~~  270 (617)
                      +.|++|||++|.||+++|+.|++.+...
T Consensus       150 ~~~~e~SAktg~nV~e~F~~i~~~i~~~  177 (216)
T 4dkx_A          150 VMFIETSAKAGYNVKQLFRRVAAALPGM  177 (216)
T ss_dssp             CEEEEEBTTTTBSHHHHHHHHHHHC---
T ss_pred             CeeEEEeCCCCcCHHHHHHHHHHHHHhh
Confidence            9999999999999999999999887643



>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Back     alignment and structure
>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Back     alignment and structure
>1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3uc9_A Increased recombination centers protein 6; rossmann-fold, clathrin accessory factor; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 617
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 5e-37
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 2e-06
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 6e-37
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 2e-06
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 4e-35
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 0.002
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 1e-34
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 1e-06
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 1e-33
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 3e-06
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 3e-32
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 4e-04
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 8e-32
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 0.002
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 2e-31
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 0.004
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 1e-30
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 0.001
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 1e-29
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 1e-29
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 3e-04
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 8e-29
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 7e-28
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 2e-25
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 3e-24
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 4e-24
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9e-24
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 5e-23
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 2e-22
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 7e-04
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 1e-21
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 2e-21
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 7e-21
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 1e-20
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 1e-20
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 0.002
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 5e-20
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 1e-19
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 2e-19
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 0.002
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 2e-19
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 6e-19
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 7e-19
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 7e-19
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 2e-18
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 2e-18
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 0.001
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 3e-18
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 3e-18
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-17
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 3e-17
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 9e-17
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 2e-16
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 9e-16
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 2e-15
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 2e-14
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 1e-13
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 2e-13
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 4e-13
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 5e-13
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 4e-12
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 5e-12
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 8e-12
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 3e-10
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 3e-10
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 5e-10
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 7e-10
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 3e-09
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 2e-08
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 4e-08
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 5e-04
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab8a
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  133 bits (336), Expect = 5e-37
 Identities = 52/150 (34%), Positives = 85/150 (56%)

Query: 116 GVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTAGQERFRSMAPMY 175
           GVGKT ++ R+    F+     TIG  F    I +   ++KLQ+WDTAGQERFR++   Y
Sbjct: 16  GVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAY 75

Query: 176 YRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAF 235
           YR A   +LV+DIT   SF  I+ W++ ++ +    +   ++GNK D+   R+V++E   
Sbjct: 76  YRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGE 135

Query: 236 HYSKSIGGTYYETSALQDQGIEDVFLNVSK 265
             +   G  + ETSA  +  +E+ F  +++
Sbjct: 136 KLALDYGIKFMETSAKANINVENAFFTLAR 165


>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query617
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.97
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.97
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.96
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.96
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.96
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.96
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.96
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.96
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.95
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.95
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.95
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.94
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.94
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.94
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.93
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.92
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.91
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.91
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.9
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.9
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.88
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.82
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.82
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.81
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.8
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.8
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.8
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.79
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.76
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.76
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.74
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.74
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.72
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.72
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.7
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.69
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.67
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.64
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.64
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.62
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.6
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.57
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.56
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.49
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.48
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.41
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.36
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.36
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.32
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.15
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.13
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.09
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 99.07
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.06
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.02
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.0
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.96
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.93
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 98.84
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 98.81
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.79
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.57
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.52
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.52
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.47
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.44
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.28
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.02
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.99
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 97.98
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 97.92
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 97.91
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.91
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 97.82
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 97.81
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.74
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 97.72
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.71
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.7
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 97.69
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 97.68
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 97.66
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 97.65
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 97.63
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 97.61
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 97.6
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 97.56
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.55
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 97.53
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 97.51
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.45
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 97.29
d2vxfa180 LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) 97.29
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.25
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 97.25
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.24
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.23
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 97.22
d1d3ba_72 D3 core SNRNP protein {Human (Homo sapiens) [TaxId 97.19
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 97.12
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.07
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.92
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.91
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 96.72
d1b34a_80 D1 core SNRNP protein {Human (Homo sapiens) [TaxId 96.71
d1i4k1_72 Archaeal homoheptameric Sm protein {Archaeon Archa 96.67
d1th7a176 Archaeal homoheptameric Sm protein {Sulfolobus sol 96.67
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.65
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 96.65
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.63
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.62
d1okkd2207 GTPase domain of the signal recognition particle r 96.51
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.51
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.45
d2qy9a2211 GTPase domain of the signal recognition particle r 96.41
d1vmaa2213 GTPase domain of the signal recognition particle r 96.39
d1mgqa_74 Archaeal homoheptameric Sm protein {Archaeon Metha 96.32
d1d3bb_81 B core SNRNP protein {Human (Homo sapiens) [TaxId: 96.3
d1h641_71 Archaeal homoheptameric Sm protein {Archaeon Pyroc 96.28
d1i8fa_71 Archaeal homoheptameric Sm protein {Archaeon Pyrob 96.16
d1m5q1_127 Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul 96.15
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.79
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.77
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.6
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.52
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 95.5
d1ljoa_75 Archaeal homoheptameric Sm protein {Archaeon Archa 95.5
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 95.47
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.24
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.13
d1n9ra_68 Small nuclear ribonucleoprotein F, Smf {Baker's ye 94.85
d2fwka192 U6 snRNA-associated sm-like protein LSM5 {Cryptosp 94.59
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.49
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 94.46
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.39
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.26
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.22
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.0
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.59
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.4
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.32
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.27
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.26
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.1
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 93.02
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.95
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 92.53
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 92.32
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 91.2
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 91.11
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 90.92
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.87
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.76
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.76
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.73
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 90.73
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 90.7
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 90.34
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.3
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 90.26
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 90.19
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 90.14
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.07
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 89.96
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 89.88
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 89.85
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 89.82
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 89.77
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.75
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 89.74
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 89.66
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 89.66
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 89.62
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 89.59
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 89.55
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 89.4
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.34
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.29
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 89.28
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 89.19
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 89.16
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 89.13
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 89.01
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 88.94
d1g2912240 Maltose transport protein MalK, N-terminal domain 88.74
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 88.59
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 88.44
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 88.41
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 88.06
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 87.95
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 87.75
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 87.68
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 87.43
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 87.13
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 86.32
d2hyda1255 Putative multidrug export ATP-binding/permease pro 86.26
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.23
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 86.21
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 86.18
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 85.89
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 85.83
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 85.69
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 85.57
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 85.24
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 85.24
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 85.12
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 85.04
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 84.99
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 83.96
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 83.81
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 83.59
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 83.33
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 82.94
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 82.52
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 82.36
d1b34b_93 D2 core SNRNP protein {Human (Homo sapiens) [TaxId 82.01
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 81.47
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 81.44
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 81.18
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 81.02
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 80.99
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 80.89
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 80.79
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 80.13
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab23
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.97  E-value=1.8e-30  Score=242.89  Aligned_cols=162  Identities=35%  Similarity=0.589  Sum_probs=152.5

Q ss_pred             ceEEEEEccCcccccccCCCCCCccccCCCCCCCCHHHHHHHHHcCCCCCccCCCcceeEEEEEEEECCeEEEEEEEecC
Q psy3029          84 KIKVGLLSDKFVVGLSINSRVPNCFEANWFWLGVGKTSMVVRYIGKMFSHHISPTIGASFFTAKINVGENKVKLQVWDTA  163 (617)
Q Consensus        84 ~ikV~i~G~~~~~~~~~~~~~~~~~~~i~G~~nVGKSSLinrl~~~~~~~~~~~t~g~~~~~~~i~~~~~~~~l~i~Dt~  163 (617)
                      .+||+++|+                      +|||||||++||+++.+...+.+|++.++..+.....+..+.+.+||++
T Consensus         2 ~iKv~liG~----------------------~~vGKSsLi~rl~~~~~~~~~~~ti~~~~~~~~~~~~~~~~~~~i~d~~   59 (164)
T d1z2aa1           2 AIKMVVVGN----------------------GAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTA   59 (164)
T ss_dssp             EEEEEEECS----------------------TTSSHHHHHHHHHHCCCCCCSSCCCSSSEEEEEEEETTEEEEEEEECCT
T ss_pred             eEEEEEECC----------------------CCcCHHHHHHHHHhCCCCcccccccccccceeeeeecCceeeeeeeccC
Confidence            478999999                      9999999999999999999999999999999999999999999999999


Q ss_pred             CcccccccchhhhccCCEEEEEEeCCChhhHHHHHHHHHHHHhcCCCCCeEEEEEECCCCCCccccCHHHHHHHHHhcCC
Q psy3029         164 GQERFRSMAPMYYRNANAALLVFDITQYHSFAAIKTWVKELKRNVDEPLVLCVVGNKTDLESSREVNREEAFHYSKSIGG  243 (617)
Q Consensus       164 G~e~~~~~~~~~~~~ad~iIlV~Dis~~~S~~~l~~~l~~i~~~~~~~iPvIlVgNK~DL~~~~~v~~~e~~~~~~~~g~  243 (617)
                      |++++..+...+++++|++++|||++++.||+.+..|+..+.+..+ ++|++|||||+|+..++++..+++.++++.+++
T Consensus        60 g~~~~~~~~~~~~~~~~~~i~v~d~~~~~s~~~~~~~~~~i~~~~~-~~~iilVgnK~Dl~~~~~v~~~~~~~~~~~~~~  138 (164)
T d1z2aa1          60 GQEEFDAITKAYYRGAQACVLVFSTTDRESFEAISSWREKVVAEVG-DIPTALVQNKIDLLDDSCIKNEEAEGLAKRLKL  138 (164)
T ss_dssp             TGGGTTCCCHHHHTTCCEEEEEEETTCHHHHHTHHHHHHHHHHHHC-SCCEEEEEECGGGGGGCSSCHHHHHHHHHHHTC
T ss_pred             CccchhhhhhhhhccCceEEEEEeccchhhhhhcccccccccccCC-CceEEEeeccCCcccceeeeehhhHHHHHHcCC
Confidence            9999999999999999999999999999999999999999987665 479999999999988888999999999999999


Q ss_pred             eEEEEcCCCCCCHHHHHHHHHHHHH
Q psy3029         244 TYYETSALQDQGIEDVFLNVSKGLI  268 (617)
Q Consensus       244 ~~~evSAktg~gI~eLf~~I~~~l~  268 (617)
                      +|+++||++|.||+++|+.|++++.
T Consensus       139 ~~~e~Sak~g~~v~e~f~~l~~~~l  163 (164)
T d1z2aa1         139 RFYRTSVKEDLNVSEVFKYLAEKHL  163 (164)
T ss_dssp             EEEECBTTTTBSSHHHHHHHHHHHH
T ss_pred             EEEEeccCCCcCHHHHHHHHHHHHh
Confidence            9999999999999999999998775



>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure