Psyllid ID: psy3224

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------128

SLGKGHKGYSEYSVSKLKTQLAYVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKDEEEDDEEDLNDSNFDEFNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNEGQVVGQAIPPPPIPLVNRNKKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKDEEEDDEEDLNDSNFDEFNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNVPEVGDARNRKQRNPRAEKFTPLPDSVLRGNLGGESTGAIDPNSGLMSQIPGTATPGMLTPSGDLDLRKMGQARNTLMNVKLNQISDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAGAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARASAPTPRVMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCHRSGSRRCMGVKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVKKRCLAAEPKHGENWCRVAKNVSNWKLPRETILSLVAKDLPIPI

cccccccccccccHHHccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHcccccccHHHHHHcccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcHHcccccHHHHHHHHHccccccc

ccccccccccEEEHHHHHHHHccccccEEEccccccccHHcccccccccHHHHHHHHHHHHHcHccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHcHHHHccccccHHHHHHHHccccccEEccccccccccccccccccccccccccHHHHHHHHHHHHEEEHHHcccccccccEEcccccccccHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcHHHccccHHHHHHHHHHHccccc

slgkghkgyseySVSKLKTQLAYVVGQtvvdpkgyltdlqsmiptyggdiNDIKKARLLLKSkhfmgvpaplgyvagvgrgatgfttrsdigpardandvsddrhaapvkrkkkdeeeddeedlndsnfdefngyggslfnkdpydkddeeADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEwknegqvvgqaippppiplvnrnkkhfmgvpaplgyvagvgrgatgfttrsdigpardandvsddrhaapvkrkkkdeeeddeedlndsnfdefngyggslfnkdpydkddeeADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMdewknvpevgdarnrkqrnpraekftplpdsvlrgnlggestgaidpnsglmsqipgtatpgmltpsgdldlrkMGQARNTLMNVKlnqisdsvvgqtvvdpkgyltdlqsmiptyggdiNDIKKARLLLKSVretnpnhppawiaSARLEEVTGKVQAARNLIMKgceenqtsEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNKAreniptdrQIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGygveqedrkhtwmeDAESCANQGAYECARAIYAQALatfpskksIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAkskwlagdvpaARGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAgafqanpnsEEIWLAAVKLESENNEYERARRLLAKArasaptprvmIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAikkcphsvPLWIMLANLEERRKMLIKARSVLekgrlrnpncAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAifleprpqrktksvdalkkcehdphVLLAVSKLFwcenknqkchrsgsrrcmgvktksvdalkkcehdphVLLAVSKLFWCENKNQKCREWFNrtvkidpdlgdAWAYFYKFEIINGTEETQAEVKKRCLaaepkhgenwCRVAKnvsnwklprETILSLVakdlpipi

slgkghkgySEYSVSKLKTQLAYVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSKHFMGVPAPLGYVAGVGRGATGfttrsdigpardandvsddrhaapvkrkkkdeeeddeedlndsnfdefngyggslfnkdpydkddEEADMIYEEidkrmdekrkdYREKRLREELeryrqerpkiqqqfsDLKRGLVTVSMDEWKNEGqvvgqaippppiPLVNRNKKHFMGVPAPLGYVAGVGRGATGfttrsdigpardandvsddrhaapvkrkkkdeeeddeedlndsnfdefngyggslfnkdpydkddEEADMIYEEidkrmdekrkdYREKRLREELeryrqerpkiqqqfsdlkrGLVTvsmdewknvpevgdarnrkqrnpraekftplpdsvlrgNLGGEstgaidpnsgLMSQIPGTATPGMLTPSGDLDLRKMGQARNTLMNVklnqisdsvvGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVretnpnhppawiasarleEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQavrhiptsvriwikaadletetkAKRRVYRKalehipnsvrlwkAAVELEDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNkareniptdrqIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAgafqanpnsEEIWLAAVKLESENNEYERARRLLAkarasaptprVMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAikkcphsvPLWIMLANLEERRKMLIKARsvlekgrlrnpncAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKNqkchrsgsrrcmgvKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVKKRCLAaepkhgenwcrvaknvsnwklpretilslvakdlpipi

SLGKGHKGYSEYSVSKLKTQLAYVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKdeeeddeedlndsnfdefnGYGGSLFNKDPYDKDDEEADMIYEEIDkrmdekrkdyrekrlreeleryrqerPKIQQQFSDLKRGLVTVSMDEWKNEGQVVGQAIPPPPIPLVNRNKKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKdeeeddeedlndsnfdefnGYGGSLFNKDPYDKDDEEADMIYEEIDkrmdekrkdyrekrlreeleryrqerPKIQQQFSDLKRGLVTVSMDEWKNVPEVGDARNRKQRNPRAEKFTPLPDSVLRGNLGGESTGAIDPNSGLMSQIPGTATPGMLTPSGDLDLRKMGQARNTLMNVKLNQISDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNEYErarrllakaraqagafqaNPNSEEIWLAAVKLESENNEYErarrllakaraSAPTPRVMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCHRSGSRRCMGVKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVKKRCLAAEPKHGENWCRVAKNVSNWKLPRETILSLVAKDLPIPI

***********YSVSKLKTQLAYVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSKHFMGVPAPLGYVAGVGRGATGFT****************************************************************************************************************GLVTVSMDEWKNEGQVVGQAIPPPPIPLVNRNKKHFMGVPAPLGYVAGVGRGATGFT******************************************************************************************************************V************************************************************************************TLMNVKLNQISDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRE*****PPAWIASARLEEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLE******************************EIWLAAVKL************************RVMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEP********VDALKKCEHDPHVLLAVSKLFWCENKNQKCHRSGSRRCMGVKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVKKRCLAAEPKHGENWCRVAKNVSNWKLPRETILSLVAK******

*****HKGYSEYSVSK***********TVVDPKGYLTDLQSMIPT***************************GYVAGVGRGATGFTTRSDIG***********************************NFDEFNGYGGSLFNKDPYDKDDEEADMIYEEID********************************FSDLKRGLVTVSMDEWKNEGQV************************APLGYVAGVGRGATGF*******************************************FDEFNGYGGSLFNKDPYDKDDEEADMIYEEID********************************FSDLKRGLVTVSMDEWKNVPEV*****************PLPDSVLR****************************MLTPSGDLDLRKMGQ**********************VDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAGAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARASAPTPRVMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCHRSGSRRCMGVKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVKKRCLAAEPKHGENWCRVAKNVSNWKLPRETILSLVAKDLPIPI

************SVSKLKTQLAYVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPAR******************************DSNFDEFNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNEGQVVGQAIPPPPIPLVNRNKKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPAR******************************DSNFDEFNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNVPEVGDARNRKQRNPRAEKFTPLPDSVLRGNLGGESTGAIDPNSGLMSQIPGTATPGMLTPSGDLDLRKMGQARNTLMNVKLNQISDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAGAFQANPNSEEIWLAAVKLESENNEYERARRLLAK*********VMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPRP*********LKKCEHDPHVLLAVSKLFWCENKN************GVKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVKKRCLAAEPKHGENWCRVAKNVSNWKLPRETILSLVAKDLPIPI

******KGYSEYSVSKLKTQLAYVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSKHFMGVPAPLGYVAGVGRGATGFTTRSDIGP*********************************SNFDEFNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNEGQVVGQAIPPPPIPLVNRNKKHFMGVPAPLGYVAGVGRGATGFTTRSDIGP*********************************SNFDEFNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNVPEVGDARNRKQRNPRAEKFTPLPDSVLRGNLG******************************DLDLRKMGQARNTLMNVKLNQISDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAGAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARASAPTPRVMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCHRSGSRRCMGVKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVKKRCLAAEPKHGENWCRVAKNVSNWKLPRETILSLVAKDLPIP*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SLGKGHKGYSEYSVSKLKTQLAYVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKDEEEDDEEDLNDSNFDEFNGYGGSLFNKDPYDKDDEEADMIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFSDLKRGLVTVSMDEWKNEGQVVGQAIPPPPIPLVNRNKKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKDEEEDDEEDLNDSNFDEFNGYGGSLFNKDPYDKDDEEADMIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFSDLKRGLVTVSMDEWKNVPEVGDARNRKQRNPRAEKFTPLPDSVLRGNLGGESTGAIDPNSGLMSQIPGTATPGMLTPSGDLDLRKMGQARNTLMNVKLNQISDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPNSEEIWLAxxxxxxxxxxxxxxxxxxxxxxxxAPTPRVMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCHRSGSRRCMGVKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVKKRCLAAEPKHGENWCRVAKNVSNWKLPRETILSLVAKDLPIPI

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1278	2.2.26 [Sep-21-2011]
Q91YR7		941	Pre-mRNA-processing facto	yes	N/A	0.715	0.971	0.616	0.0
A1A5S1		941	Pre-mRNA-processing facto	yes	N/A	0.715	0.971	0.615	0.0
O94906		941	Pre-mRNA-processing facto	yes	N/A	0.715	0.971	0.609	0.0
Q2KJJ0		941	Pre-mRNA-processing facto	yes	N/A	0.715	0.971	0.615	0.0
Q5RCC2		941	Pre-mRNA-processing facto	yes	N/A	0.715	0.971	0.604	0.0
Q12381		906	Pre-mRNA-splicing factor	yes	N/A	0.693	0.977	0.402	0.0
P19735		899	Pre-mRNA-splicing factor	yes	N/A	0.671	0.954	0.257	3e-77
Q5K654		677	Pre-mRNA-splicing factor	N/A	N/A	0.355	0.670	0.253	1e-19
Q54VF4		1304	TPR-containing protein DD	no	N/A	0.346	0.339	0.218	1e-17
Q7SGD2		695	Pre-mRNA-splicing factor	N/A	N/A	0.354	0.651	0.241	5e-17

>sp\|Q91YR7\|PRP6_MOUSE Pre-mRNA-processing factor 6 OS=Mus musculus GN=Prpf6 PE=2 SV=1	Back alignment and function desciption

 Score = 1251 bits (3236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/1065 (61%), Positives = 781/1065 (73%), Gaps = 151/1065 (14%)

Query: 227  VNRNKKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKDEE 286
            +N+ KK F+G+PAPLGYV G+GRGATGFTTRSDIGPARDAND  DDRHA P KR   D+ 
Sbjct: 1    MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQM 60

Query: 287  EDDE------EDLNDSNFDEFNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYR 340
            + ++      EDLND+N+DEFNGY GSLF+  PY+KDDEEAD IY  +DKRMDE+RK+ R
Sbjct: 61   KKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERR 120

Query: 341  EKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNVPEVGDARNRKQRNPRAEKFT 400
            E+R +EE+E+YR ERPKIQQQFSDLKR L  V+ +EW ++PEVGDARN++QRNPR EK T
Sbjct: 121  EQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLT 180

Query: 401  PLPDSVLRGNL-GGESTGAIDPN------------SGLMSQIPGTATPGMLTP-SGDLDL 446
            P+PDS    +L  GE+  ++DP              GL +  PG  TPG++TP +G+LD+
Sbjct: 181  PVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM 240

Query: 447  RKMGQARNTLMNVKLNQISDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKS 506
            RK+GQARNTLM+++L+Q+SDSV GQTVVDPKGYLTDL SMIPT+GGDINDIKKARLLLKS
Sbjct: 241  RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKS 300

Query: 507  VRETNPNHPPAWIASARLEEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARA 566
            VRETNP+HPPAWIASARLEEVTGK+Q ARNLIMKG E    SED+WLEAARLQP DTA+A
Sbjct: 301  VRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKA 360

Query: 567  VIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDAR 626
            V+AQAVRH+P SVRI+I+AA+LET+ +AK+RV RKALEH+PNSVRLWKAAVELE+PEDAR
Sbjct: 361  VVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDAR 420

Query: 627  ILLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNN 686
            I+LSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDR IW TAAKLEEA+GN 
Sbjct: 421  IMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT 480

Query: 687  AMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRK 746
             MV+KIIDRA++SL ANGVEINRE W ++A E ++AGSV TCQA++RA+IG G+E+EDRK
Sbjct: 481  QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRK 540

Query: 747  HTWMEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKA 806
            HTWMEDA+SC    A ECARAIYA AL  FP                             
Sbjct: 541  HTWMEDADSCVAHNALECARAIYAYALQVFP----------------------------- 571

Query: 807  VAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMG 866
                             +KKS+WLRAAYFEKNHGTRESLE LLQ+AVAHCPK+EVL    
Sbjct: 572  -----------------SKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVL---- 610

Query: 867  AKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAGA 926
                WL G                  ++  WLA         +   AR +LA A      
Sbjct: 611  ----WLMG------------------AKSKWLAG--------DVPAARSILALA------ 634

Query: 927  FQANPNSEEIWLAAVKLESENNEYERARRLLAKARASAPTPRVMIQSAKLEWCLDNLERA 986
            FQANPNSEEIWLAAVKLESENNEYERARRLLAKAR+SAPT RV ++S KLEW L N+  A
Sbjct: 635  FQANPNSEEIWLAAVKLESENNEYERARRLLAKARSSAPTARVFMKSVKLEWVLGNISAA 694

Query: 987  LQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEE 1046
             +L +EA++ + DF KLWMMKGQIEEQ  L++KA + ++Q +KKCPHS PLW++L+ LEE
Sbjct: 695  QELCEEALRHYEDFPKLWMMKGQIEEQGELMEKAREAYNQGLKKCPHSTPLWLLLSRLEE 754

Query: 1047 RRKMLIKARSVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILW 1106
            +   L +AR++LEK RL+NP    LWL ++R+E RAGLK+IANT+MAKALQECPN+GILW
Sbjct: 755  KIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLMAKALQECPNSGILW 814

Query: 1107 AEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCHRSGSRRCMGVKTK 1166
            +EA+FLE RPQRKTKSVDALKKCEHDPHVLLAV+KLFW                      
Sbjct: 815  SEAVFLEARPQRKTKSVDALKKCEHDPHVLLAVAKLFW---------------------- 852

Query: 1167 SVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIING 1226
                                    E K  K REWF+RTVKID DLGDAWA+FYKFE+ +G
Sbjct: 853  -----------------------SERKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHG 889

Query: 1227 TEETQAEVKKRCLAAEPKHGENWCRVAKNVSNWKLPRETILSLVA 1271
            TEE Q EV+KRC  AEP+HGE WC V+K+++NW+     IL LVA
Sbjct: 890  TEEQQEEVRKRCENAEPRHGELWCAVSKDITNWQRKIGEILVLVA 934

Involved in pre-mRNA splicing. May act in the tri-snRNP complex as a bridging factor between U5 and U4/U6 snRNPs in the late step of spliceosome assembly. May be necessary for tri-snRNP formation (By similarity). Enhances dihydrotestosterone-induced transactivation activity of AR, as well as dexamethasone-induced transactivation activity of NR3C1, but does not affect estrogen-induced transactivation.
Mus musculus (taxid: 10090)

>sp\|A1A5S1\|PRP6_RAT Pre-mRNA-processing factor 6 OS=Rattus norvegicus GN=Prpf6 PE=2 SV=1	Back alignment and function description

>sp\|O94906\|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens GN=PRPF6 PE=1 SV=1	Back alignment and function description

>sp\|Q2KJJ0\|PRP6_BOVIN Pre-mRNA-processing factor 6 OS=Bos taurus GN=PRPF6 PE=2 SV=1	Back alignment and function description

>sp\|Q5RCC2\|PRP6_PONAB Pre-mRNA-processing factor 6 OS=Pongo abelii GN=PRPF6 PE=2 SV=1	Back alignment and function description

>sp\|Q12381\|PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp1 PE=1 SV=1	Back alignment and function description

>sp\|P19735\|PRP6_YEAST Pre-mRNA-splicing factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP6 PE=1 SV=1	Back alignment and function description

>sp\|Q5K654\|CLF1_PARBR Pre-mRNA-splicing factor CLF1 OS=Paracoccidioides brasiliensis GN=CLF1 PE=3 SV=1	Back alignment and function description

>sp\|Q54VF4\|Y8236_DICDI TPR-containing protein DDB_G0280363 OS=Dictyostelium discoideum GN=DDB_G0280363 PE=4 SV=2	Back alignment and function description

>sp\|Q7SGD2\|CLF1_NEUCR Pre-mRNA-splicing factor clf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=clf-1 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1278
242015374		935	pre-mRNA splicing factor, putative [Pedi	0.724	0.990	0.727	0.0
193669389		930	PREDICTED: pre-mRNA-processing factor 6-	0.724	0.995	0.727	0.0
332019094		931	Pre-mRNA-processing factor 6 [Acromyrmex	0.723	0.992	0.721	0.0
383849872		931	PREDICTED: pre-mRNA-processing factor 6-	0.724	0.994	0.714	0.0
350406586		931	PREDICTED: pre-mRNA-processing factor 6-	0.724	0.994	0.725	0.0
380015840		931	PREDICTED: pre-mRNA-processing factor 6-	0.724	0.994	0.725	0.0
110761280		931	PREDICTED: pre-mRNA-processing factor 6-	0.724	0.994	0.725	0.0
340721426		931	PREDICTED: LOW QUALITY PROTEIN: pre-mRNA	0.723	0.992	0.724	0.0
357615829		961	hypothetical protein KGM_05241 [Danaus p	0.748	0.995	0.700	0.0
195496397		931	GE19580 [Drosophila yakuba] gi\|194181778	0.721	0.990	0.690	0.0

>gi\|242015374\|ref\|XP_002428334.1\| pre-mRNA splicing factor, putative [Pediculus humanus corporis] gi\|212512930\|gb\|EEB15596.1\| pre-mRNA splicing factor, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

 Score = 1511 bits (3912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 773/1063 (72%), Positives = 851/1063 (80%), Gaps = 137/1063 (12%)

Query: 222  PPIPLVNRNKKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRK 281
            P   LVNRNKKHF+GVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHA P KRK
Sbjct: 4    PHAALVNRNKKHFLGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAPPSKRK 63

Query: 282  KKDEEEDDEEDLNDSNFDEFNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYRE 341
            KKDEEE++EEDLNDSN+DEF+GYGGSLF+KDPYDKDDEEAD IYE IDKRMDEKRK+YRE
Sbjct: 64   KKDEEEEEEEDLNDSNYDEFSGYGGSLFSKDPYDKDDEEADQIYEAIDKRMDEKRKEYRE 123

Query: 342  KRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNVPEVGDARNRKQRNPRAEKFTP 401
            KRL++ELERYRQERPKIQQQFSDLKRGL++V+ DEW+NVPEVGDARNRK RNPRAEKFTP
Sbjct: 124  KRLKDELERYRQERPKIQQQFSDLKRGLISVTEDEWRNVPEVGDARNRKLRNPRAEKFTP 183

Query: 402  LPDSVLRGNLGGESTGAIDPNSGLMSQIP------GTATPGMLTPSGDLDLRKMGQARNT 455
            LPDSVL  N+ GES  +IDP SGL S  P      G +TPGMLTP+GDLDLRK+GQARNT
Sbjct: 184  LPDSVLSRNMAGESATSIDPTSGLASTFPSGNATPGFSTPGMLTPTGDLDLRKIGQARNT 243

Query: 456  LMNVKLNQISDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHP 515
            LMNVKL+Q+SDSV GQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHP
Sbjct: 244  LMNVKLSQVSDSVEGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHP 303

Query: 516  PAWIASARLEEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHI 575
            PAWIASARLEEVTGKVQAARNLIMKGCE N  SEDLWLEAARLQP DTARAVIAQAVRHI
Sbjct: 304  PAWIASARLEEVTGKVQAARNLIMKGCEVNPKSEDLWLEAARLQPPDTARAVIAQAVRHI 363

Query: 576  PTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVEC 635
            PTSVRIWI+AADLE ET AKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVEC
Sbjct: 364  PTSVRIWIRAADLEAETNAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVEC 423

Query: 636  CPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDR 695
            CPT+V+LWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEA+GN  MVDKIIDR
Sbjct: 424  CPTNVDLWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEANGNKHMVDKIIDR 483

Query: 696  ALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAES 755
            A+SSLSANGVEINREHWFKEA+EAEKAGSVHTCQ +IRA+IG GVE+EDRKH W+EDAE 
Sbjct: 484  AISSLSANGVEINREHWFKEAMEAEKAGSVHTCQVVIRAVIGQGVEEEDRKHAWLEDAEM 543

Query: 756  CANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEV 815
            CA+QGA+ECA                   RA Y                   AH      
Sbjct: 544  CASQGAFECA-------------------RAIY-------------------AHA----- 560

Query: 816  LWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGD 875
               +    ++KSIWLRAAYFEK HGTRESLE LLQ+AVAHCPKSEVLWLMGAKSK     
Sbjct: 561  ---LSTFPSEKSIWLRAAYFEKAHGTRESLEALLQRAVAHCPKSEVLWLMGAKSK----- 612

Query: 876  VPAARGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAGAFQANPNSEE 935
                                 WLA             AR +LA A      FQANPNSEE
Sbjct: 613  ---------------------WLAG--------NVSAARSILALA------FQANPNSEE 637

Query: 936  IWLAAVKLESENNEYERARRLLAKARASAPTPRVMIQSAKLEWCLDNLERALQLLDEAIK 995
            IWLAAVKLESEN+EYERARRLLA ARASAP+PRV+++SAKLEW L++L++A +LL+EAIK
Sbjct: 638  IWLAAVKLESENSEYERARRLLANARASAPSPRVLMKSAKLEWALNDLDKAHKLLEEAIK 697

Query: 996  VFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKAR 1055
            +FPD+ KLW+MKGQIEEQ+N++DKA +T++  IKKCP SVP+W +LANLEERR +L +AR
Sbjct: 698  MFPDYPKLWLMKGQIEEQQNMVDKALETYNLGIKKCPSSVPIWRLLANLEERRGLLTRAR 757

Query: 1056 SVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPR 1115
            SVLEKGRLRNP  AELWL AIR+E RAGLKDIAN +MAKALQECPN+GILWAEAIF+E R
Sbjct: 758  SVLEKGRLRNPKNAELWLEAIRIESRAGLKDIANNLMAKALQECPNSGILWAEAIFMESR 817

Query: 1116 PQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCHRSGSRRCMGVKTKSVDALKKCE 1175
            PQRKTKSVDALKKCEHDP+VLLAVSKLFWCE K QKC                       
Sbjct: 818  PQRKTKSVDALKKCEHDPNVLLAVSKLFWCERKLQKC----------------------- 854

Query: 1176 HDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVK 1235
                                  REWFNRTVK+D DLGDAWAYFY+FE++NGTEETQ++VK
Sbjct: 855  ----------------------REWFNRTVKVDQDLGDAWAYFYQFELLNGTEETQSDVK 892

Query: 1236 KRCLAAEPKHGENWCRVAKNVSNWKLPRETILSLVAKDLPIPI 1278
            KRC+AAEP HGE WC+V+KN+ NWK   E ILSLVAK LP+P+
Sbjct: 893  KRCVAAEPHHGEFWCQVSKNIRNWKYSTEVILSLVAKQLPVPV 935

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|193669389\|ref\|XP_001951091.1\| PREDICTED: pre-mRNA-processing factor 6-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|332019094\|gb\|EGI59622.1\| Pre-mRNA-processing factor 6 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|383849872\|ref\|XP_003700558.1\| PREDICTED: pre-mRNA-processing factor 6-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|350406586\|ref\|XP_003487820.1\| PREDICTED: pre-mRNA-processing factor 6-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|380015840\|ref\|XP_003691902.1\| PREDICTED: pre-mRNA-processing factor 6-like [Apis florea]	Back alignment and taxonomy information

>gi\|110761280\|ref\|XP_623891.2\| PREDICTED: pre-mRNA-processing factor 6-like [Apis mellifera]	Back alignment and taxonomy information

>gi\|340721426\|ref\|XP_003399121.1\| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing factor 6-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|357615829\|gb\|EHJ69854.1\| hypothetical protein KGM_05241 [Danaus plexippus]	Back alignment and taxonomy information

>gi\|195496397\|ref\|XP_002095677.1\| GE19580 [Drosophila yakuba] gi\|194181778\|gb\|EDW95389.1\| GE19580 [Drosophila yakuba]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1278
FB\|FBgn0036828		931	CG6841 [Drosophila melanogaste	0.521	0.715	0.708	5.2e-255
ZFIN\|ZDB-GENE-030131-2575		944	prpf6 "PRP6 pre-mRNA processin	0.520	0.704	0.629	2e-221
UNIPROTKB\|F1N9U0		945	PRPF6 "Uncharacterized protein	0.460	0.623	0.646	8.8e-205
UNIPROTKB\|Q2KJJ0		941	PRPF6 "Pre-mRNA-processing fac	0.460	0.625	0.646	1.8e-204
UNIPROTKB\|E2RPW8		941	PRPF6 "Uncharacterized protein	0.460	0.625	0.646	1.8e-204
MGI\|MGI:1922946		941	Prpf6 "PRP6 pre-mRNA splicing	0.460	0.625	0.644	3.8e-204
RGD\|1307103		941	Prpf6 "PRP6 pre-mRNA processin	0.460	0.625	0.644	3.8e-204
UNIPROTKB\|O94906		941	PRPF6 "Pre-mRNA-processing fac	0.460	0.625	0.644	4.9e-204
UNIPROTKB\|I3L7Q4		783	PRPF6 "Uncharacterized protein	0.502	0.819	0.528	5e-203
DICTYBASE\|DDB_G0272374		1014	prpf6 "pre-mRNA processing fac	0.519	0.654	0.428	2.1e-180

FB\|FBgn0036828 CG6841 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 2455 (869.3 bits), Expect = 5.2e-255, P = 5.2e-255
 Identities = 482/680 (70%), Positives = 544/680 (80%)

Query:   226 LVNRNKKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPV-KRKKKX 284
             + NRNKKHF+GVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHA P  KRKKK 
Sbjct:     9 IANRNKKHFLGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAPPATKRKKKD 68

Query:   285 XXXXXXXXXXXXXXXXXXGYGGSLFNKDPYDKDDEEADMIYEEIDXXXXXXXXXXXXXXX 344
                               GY GSLF+KDPYDKDDEEAD IY+ ID               
Sbjct:    69 EEEEEDEDLNDSNYDEFSGYSGSLFSKDPYDKDDEEADAIYDSIDKRMDEKRKEYRDRRL 128

Query:   345 XXXXXXXXXXXPKIQQQFSDLKRGLVTVSMDEWKNVPEVGDARNRKQRNPRAEKFTPLPD 404
                        PKIQQQFSDLKR L +V+ +EW  +PEVGD+RNRKQRNPRAEKFTPLPD
Sbjct:   129 REDLERYRQERPKIQQQFSDLKRSLASVTSEEWSTIPEVGDSRNRKQRNPRAEKFTPLPD 188

Query:   405 SVLRGNLGGESTGAIDPNSGLMSQIPGTATPGMLTPSGDLDLRKMGQARNTLMNVKLNQI 464
             S++  NLGGES+  +DP+SGL S +PG ATPGMLTP+GDLDLRK+GQARNTLMNVKL+Q+
Sbjct:   189 SLISRNLGGESSSTLDPSSGLASMVPGVATPGMLTPTGDLDLRKIGQARNTLMNVKLSQV 248

Query:   465 SDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARL 524
             SDSV GQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARL
Sbjct:   249 SDSVTGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARL 308

Query:   525 EEVTGKVQAARNLIMKGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIK 584
             EEVTGKVQ ARNLIM+GCE N  SEDLWLEAARLQP DTA+AVIAQA RHIPTSVRIWIK
Sbjct:   309 EEVTGKVQMARNLIMRGCEMNIQSEDLWLEAARLQPPDTAKAVIAQAARHIPTSVRIWIK 368

Query:   585 AADLETETKAKRRVYRKALEHIPNSVRLWKAAVELEDPEDARILLSRAVECCPTSVELWL 644
             AADLE+ETKAKRRV+RKALEHIPNSVRLWKAAVELE+P+DARILLSRAVECC TSVELWL
Sbjct:   369 AADLESETKAKRRVFRKALEHIPNSVRLWKAAVELENPDDARILLSRAVECCNTSVELWL 428

Query:   645 ALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDRALSSLSANG 704
             ALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEA+GN  MV+KIIDR+L+SL+ NG
Sbjct:   429 ALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEANGNIHMVEKIIDRSLTSLTVNG 488

Query:   705 VEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYEC 764
             VEINR+ WF+EAIEAEK+G+V+ CQ++++A+IG GVE+EDRK TW++DAE CA + A+EC
Sbjct:   489 VEINRDQWFQEAIEAEKSGAVNCCQSIVKAVIGIGVEEEDRKQTWIDDAEFCAKENAFEC 548

Query:   765 ARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSN 824
             ARA+YA AL  FPSKKSIWLRAAYFEKNHGTRESLE LLQ+AVAHCPKSE+LWLMGAKS 
Sbjct:   549 ARAVYAHALQIFPSKKSIWLRAAYFEKNHGTRESLEALLQRAVAHCPKSEILWLMGAKSK 608

Query:   825 KKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILS 884
                 W+         G   +   +L  A    P SE +WL   K +    +   AR +L+
Sbjct:   609 ----WMA--------GDVPAARGILSLAFQANPNSEDIWLAAVKLESENSEYERARRLLA 656

Query:   885 LAFQANPNSEEIWLAAVKLE 904
              A  + P +  + + + +LE
Sbjct:   657 KARGSAP-TPRVMMKSARLE 675

GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS

GO:0005684 "U2-type spliceosomal complex" evidence=ISS

GO:0005682 "U5 snRNP" evidence=ISS

GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS

GO:0005634 "nucleus" evidence=IC

GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP

GO:0071013 "catalytic step 2 spliceosome" evidence=IDA

GO:0071011 "precatalytic spliceosome" evidence=IDA

GO:0022008 "neurogenesis" evidence=IMP

ZFIN\|ZDB-GENE-030131-2575 prpf6 "PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N9U0 PRPF6 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2KJJ0 PRPF6 "Pre-mRNA-processing factor 6" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RPW8 PRPF6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:1922946 Prpf6 "PRP6 pre-mRNA splicing factor 6 homolog (yeast)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1307103 Prpf6 "PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|O94906 PRPF6 "Pre-mRNA-processing factor 6" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|I3L7Q4 PRPF6 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0272374 prpf6 "pre-mRNA processing factor 6" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q2KJJ0	PRP6_BOVIN	No assigned EC number	0.6159	0.7151	0.9713	yes	N/A
Q12381	PRP1_SCHPO	No assigned EC number	0.4023	0.6932	0.9779	yes	N/A
Q5RCC2	PRP6_PONAB	No assigned EC number	0.6046	0.7151	0.9713	yes	N/A
O94906	PRP6_HUMAN	No assigned EC number	0.6093	0.7151	0.9713	yes	N/A
Q91YR7	PRP6_MOUSE	No assigned EC number	0.6169	0.7151	0.9713	yes	N/A
A1A5S1	PRP6_RAT	No assigned EC number	0.6159	0.7151	0.9713	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		1278
pfam06424		131	pfam06424, PRP1_N, PRP1 splicing factor, N-termina	8e-57
pfam06424		131	pfam06424, PRP1_N, PRP1 splicing factor, N-termina	6e-52
TIGR02917		899	TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system	1e-10
TIGR02917		899	TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system	2e-10
TIGR02917		899	TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system	7e-09
COG0457		291	COG0457, NrfG, FOG: TPR repeat [General function p	5e-08
cd00189		100	cd00189, TPR, Tetratricopeptide repeat domain; typ	4e-07
COG0457		291	COG0457, NrfG, FOG: TPR repeat [General function p	4e-05
cd00189		100	cd00189, TPR, Tetratricopeptide repeat domain; typ	5e-05
TIGR00540		367	TIGR00540, TPR_hemY_coli, heme biosynthesis-associ	5e-05
COG3063		250	COG3063, PilF, Tfp pilus assembly protein PilF [Ce	6e-05
COG4783		484	COG4783, COG4783, Putative Zn-dependent protease,	1e-04
COG4783		484	COG4783, COG4783, Putative Zn-dependent protease,	1e-04
TIGR02917		899	TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system	3e-04
smart00386		33	smart00386, HAT, HAT (Half-A-TPR) repeats	3e-04
smart00386		33	smart00386, HAT, HAT (Half-A-TPR) repeats	4e-04
cd00189		100	cd00189, TPR, Tetratricopeptide repeat domain; typ	0.001
pfam08424		324	pfam08424, NRDE-2, NRDE-2, necessary for RNA inter	0.001
TIGR02917		899	TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system	0.002
smart00386		33	smart00386, HAT, HAT (Half-A-TPR) repeats	0.002
COG5191		435	COG5191, COG5191, Uncharacterized conserved protei	0.002
cd00189		100	cd00189, TPR, Tetratricopeptide repeat domain; typ	0.003
PRK11788		389	PRK11788, PRK11788, tetratricopeptide repeat prote	0.003

>gnl\|CDD\|203444 pfam06424, PRP1_N, PRP1 splicing factor, N-terminal	Back alignment and domain information

 Score =  192 bits (489), Expect = 8e-57
 Identities = 83/151 (54%), Positives = 101/151 (66%), Gaps = 20/151 (13%)

Query: 239 APLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKDEEEDDEEDLNDSNF 298
           AP GYVAG+GRGATGFTTRSDIGPARD  D               DEE++D +   D   
Sbjct: 1   APPGYVAGLGRGATGFTTRSDIGPARDGVD-------------IDDEEDEDPKRYQD--- 44

Query: 299 DEFNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKI 358
               G    LF+   YD +DEEAD IYE ID+RMDE+RK  RE++ +EE+E+YR+E PKI
Sbjct: 45  ----GDNEGLFSDGKYDDEDEEADRIYESIDERMDERRKKRREQKEKEEIEKYREENPKI 100

Query: 359 QQQFSDLKRGLVTVSMDEWKNVPEVGDARNR 389
           QQQF+DLKR L TV+ DEW N+PEVGD   +
Sbjct: 101 QQQFADLKRNLATVTEDEWANIPEVGDYTRK 131

This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression). This domain is specific to the N terminus of the RNA splicing factor encoded by prp1. It is involved in mRNA splicing and possibly also poly(A)and RNA nuclear export and cell cycle progression. Length = 131

>gnl\|CDD\|203444 pfam06424, PRP1_N, PRP1 splicing factor, N-terminal	Back alignment and domain information

>gnl\|CDD\|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>gnl\|CDD\|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>gnl\|CDD\|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>gnl\|CDD\|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here

Back alignment and domain information

>gnl\|CDD\|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|233013 TIGR00540, TPR_hemY_coli, heme biosynthesis-associated TPR protein	Back alignment and domain information

>gnl\|CDD\|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>gnl\|CDD\|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>gnl\|CDD\|214642 smart00386, HAT, HAT (Half-A-TPR) repeats	Back alignment and domain information

>gnl\|CDD\|214642 smart00386, HAT, HAT (Half-A-TPR) repeats	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|219834 pfam08424, NRDE-2, NRDE-2, necessary for RNA interference	Back alignment and domain information

>gnl\|CDD\|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>gnl\|CDD\|214642 smart00386, HAT, HAT (Half-A-TPR) repeats	Back alignment and domain information

>gnl\|CDD\|227518 COG5191, COG5191, Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|236983 PRK11788, PRK11788, tetratricopeptide repeat protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1278
KOG0495\|consensus		913		100.0
KOG0495\|consensus		913		100.0
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	100.0
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	100.0
PF06424		133	PRP1_N: PRP1 splicing factor, N-terminal; InterPro	100.0
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	100.0
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	100.0
KOG4626\|consensus		966		100.0
KOG4626\|consensus		966		100.0
PF06424		133	PRP1_N: PRP1 splicing factor, N-terminal; InterPro	100.0
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	100.0
KOG2002\|consensus		1018		100.0
KOG2002\|consensus		1018		100.0
KOG1915\|consensus		677		100.0
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	100.0
KOG1915\|consensus		677		100.0
PLN03077		857	Protein ECB2; Provisional	100.0
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.98
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.97
KOG2047\|consensus		835		99.97
KOG2047\|consensus		835		99.97
PLN03077		857	Protein ECB2; Provisional	99.96
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.95
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.95
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.95
KOG2076\|consensus		895		99.95
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.95
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	99.94
KOG1127\|consensus		1238		99.93
KOG0547\|consensus		606		99.93
KOG2076\|consensus		895		99.92
PLN03218		1060	maturation of RBCL 1; Provisional	99.92
KOG0547\|consensus		606		99.91
PLN03218		1060	maturation of RBCL 1; Provisional	99.91
PRK14574		822	hmsH outer membrane protein; Provisional	99.91
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	99.9
KOG1173\|consensus		611		99.9
KOG1155\|consensus		559		99.89
KOG1127\|consensus		1238		99.89
PRK14574		822	hmsH outer membrane protein; Provisional	99.89
KOG2003\|consensus		840		99.89
KOG1155\|consensus		559		99.88
KOG2003\|consensus		840		99.87
KOG1173\|consensus		611		99.87
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.87
KOG4162\|consensus		799		99.87
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.86
KOG1126\|consensus		638		99.86
KOG4162\|consensus		799		99.86
KOG1126\|consensus		638		99.85
KOG1174\|consensus		564		99.83
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.82
KOG0548\|consensus		539		99.81
KOG1156\|consensus		700		99.81
KOG0624\|consensus		504		99.8
KOG0548\|consensus		539		99.8
KOG1156\|consensus		700		99.8
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.8
KOG1174\|consensus		564		99.8
KOG0624\|consensus		504		99.78
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	99.77
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	99.77
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	99.75
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	99.72
PRK12370		553	invasion protein regulator; Provisional	99.72
PRK12370		553	invasion protein regulator; Provisional	99.7
KOG1129\|consensus		478		99.7
PRK11189		296	lipoprotein NlpI; Provisional	99.69
KOG2376\|consensus		652		99.68
KOG1129\|consensus		478		99.67
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	99.66
PRK11189		296	lipoprotein NlpI; Provisional	99.66
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.65
KOG1125\|consensus		579		99.65
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	99.65
KOG1125\|consensus		579		99.65
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.64
KOG1914\|consensus		656		99.63
KOG2376\|consensus		652		99.62
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.62
KOG3785\|consensus		557		99.6
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.59
KOG3785\|consensus		557		99.59
PLN02789		320	farnesyltranstransferase	99.58
PLN02789		320	farnesyltranstransferase	99.57
KOG0550\|consensus		486		99.56
KOG0550\|consensus		486		99.53
KOG1914\|consensus		656		99.52
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	99.51
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	99.51
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	99.51
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	99.49
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	99.45
KOG1840\|consensus		508		99.44
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	99.43
KOG1258\|consensus		577		99.39
KOG1840\|consensus		508		99.39
KOG2396\|consensus		568		99.38
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	99.36
COG5107		660	RNA14 Pre-mRNA 3'-end processing (cleavage and pol	99.36
KOG2396\|consensus		568		99.35
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	99.33
KOG1070\|consensus		1710		99.32
KOG1258\|consensus		577		99.32
KOG1070\|consensus		1710		99.31
KOG3060\|consensus		289		99.3
PRK14720		906	transcript cleavage factor/unknown domain fusion p	99.29
PRK04841		903	transcriptional regulator MalT; Provisional	99.28
PRK15359		144	type III secretion system chaperone protein SscB;	99.27
PRK15359		144	type III secretion system chaperone protein SscB;	99.26
PRK14720		906	transcript cleavage factor/unknown domain fusion p	99.25
COG5107		660	RNA14 Pre-mRNA 3'-end processing (cleavage and pol	99.25
KOG3060\|consensus		289		99.24
KOG4340\|consensus		459		99.21
PRK10370		198	formate-dependent nitrite reductase complex subuni	99.21
KOG1128\|consensus		777		99.2
KOG1128\|consensus		777		99.19
PRK04841		903	transcriptional regulator MalT; Provisional	99.15
KOG3617\|consensus		1416		99.15
PRK10370		198	formate-dependent nitrite reductase complex subuni	99.11
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	99.1
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	99.09
KOG3617\|consensus		1416		99.09
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	99.08
TIGR02552		135	LcrH_SycD type III secretion low calcium response	99.06
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	99.04
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	99.04
KOG4340\|consensus		459		99.0
TIGR02552		135	LcrH_SycD type III secretion low calcium response	98.98
COG4783		484	Putative Zn-dependent protease, contains TPR repea	98.97
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	98.92
KOG3616\|consensus		1636		98.91
KOG0553\|consensus		304		98.89
COG4783		484	Putative Zn-dependent protease, contains TPR repea	98.89
KOG1130\|consensus		639		98.87
KOG2300\|consensus		629		98.85
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	98.8
KOG2053\|consensus		932		98.78
KOG1130\|consensus		639		98.77
COG3898		531	Uncharacterized membrane-bound protein [Function u	98.75
KOG0553\|consensus		304		98.75
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	98.75
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	98.74
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	98.73
KOG2053\|consensus		932		98.72
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	98.71
COG3898		531	Uncharacterized membrane-bound protein [Function u	98.68
KOG0128\|consensus		881		98.66
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	98.64
KOG0128\|consensus		881		98.63
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	98.6
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	98.59
KOG2471\|consensus		696		98.59
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	98.59
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	98.58
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	98.58
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	98.57
KOG3616\|consensus		1636		98.57
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.56
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	98.53
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	98.52
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	98.52
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.49
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.48
KOG3081\|consensus		299		98.48
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.48
COG0457		291	NrfG FOG: TPR repeat [General function prediction	98.47
COG0457		291	NrfG FOG: TPR repeat [General function prediction	98.47
KOG2300\|consensus		629		98.46
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	98.46
PRK11906		458	transcriptional regulator; Provisional	98.45
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	98.44
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	98.44
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.42
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	98.42
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.42
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	98.4
KOG3081\|consensus		299		98.39
KOG1941\|consensus		518		98.36
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.35
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	98.35
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	98.34
COG4105		254	ComL DNA uptake lipoprotein [General function pred	98.33
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	98.33
PRK10803		263	tol-pal system protein YbgF; Provisional	98.32
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	98.31
KOG0543\|consensus		397		98.3
KOG0543\|consensus		397		98.3
KOG1941\|consensus		518		98.3
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.29
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	98.28
PRK11906		458	transcriptional regulator; Provisional	98.28
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.28
PRK10803		263	tol-pal system protein YbgF; Provisional	98.25
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	98.23
PRK15331		165	chaperone protein SicA; Provisional	98.21
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.21
COG4105		254	ComL DNA uptake lipoprotein [General function pred	98.16
PRK15331		165	chaperone protein SicA; Provisional	98.14
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	98.11
COG4700		251	Uncharacterized protein conserved in bacteria cont	98.1
COG4700		251	Uncharacterized protein conserved in bacteria cont	98.09
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	98.08
PF12688		120	TPR_5: Tetratrico peptide repeat	98.07
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	98.06
PF12688		120	TPR_5: Tetratrico peptide repeat	98.04
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	98.03
KOG0985\|consensus		1666		97.96
PF13371		73	TPR_9: Tetratricopeptide repeat	97.94
PF08424		321	NRDE-2: NRDE-2, necessary for RNA interference; In	97.92
PF13371		73	TPR_9: Tetratricopeptide repeat	97.9
KOG2471\|consensus		696		97.9
KOG4648\|consensus		536		97.89
KOG4234\|consensus		271		97.89
KOG0985\|consensus		1666		97.86
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	97.86
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	97.84
KOG4648\|consensus		536		97.83
KOG4234\|consensus		271		97.83
PF13512		142	TPR_18: Tetratricopeptide repeat	97.79
PF08424		321	NRDE-2: NRDE-2, necessary for RNA interference; In	97.76
PF13512		142	TPR_18: Tetratricopeptide repeat	97.74
KOG1586\|consensus		288		97.73
KOG1585\|consensus		308		97.71
KOG1586\|consensus		288		97.68
KOG2796\|consensus		366		97.61
KOG2796\|consensus		366		97.59
KOG1585\|consensus		308		97.56
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	97.55
PF04184		539	ST7: ST7 protein; InterPro: IPR007311 The ST7 (for	97.55
PF13428		44	TPR_14: Tetratricopeptide repeat	97.51
KOG0530\|consensus		318		97.48
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	97.47
PF02259		352	FAT: FAT domain; InterPro: IPR003151 The FAT domai	97.47
KOG4507\|consensus		886		97.45
PF07079		549	DUF1347: Protein of unknown function (DUF1347); In	97.44
PF13428		44	TPR_14: Tetratricopeptide repeat	97.38
PF04184		539	ST7: ST7 protein; InterPro: IPR007311 The ST7 (for	97.33
PF13281		374	DUF4071: Domain of unknown function (DUF4071)	97.33
KOG4555\|consensus		175		97.31
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	97.3
KOG0890\|consensus		2382		97.28
KOG4555\|consensus		175		97.27
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	97.26
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	97.25
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	97.25
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	97.19
KOG0530\|consensus		318		97.13
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	97.1
KOG4507\|consensus		886		97.07
PF02259		352	FAT: FAT domain; InterPro: IPR003151 The FAT domai	97.06
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	97.05
KOG2041\|consensus		1189		97.05
KOG2610\|consensus		491		97.0
COG5191		435	Uncharacterized conserved protein, contains HAT (H	96.95
KOG2610\|consensus		491		96.95
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	96.94
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	96.93
PF07079		549	DUF1347: Protein of unknown function (DUF1347); In	96.91
KOG1464\|consensus		440		96.87
COG3118		304	Thioredoxin domain-containing protein [Posttransla	96.84
KOG2041\|consensus		1189		96.83
PF13431		34	TPR_17: Tetratricopeptide repeat	96.82
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	96.73
KOG4642\|consensus		284		96.71
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	96.71
PF13281		374	DUF4071: Domain of unknown function (DUF4071)	96.69
COG3118		304	Thioredoxin domain-containing protein [Posttransla	96.66
PF13431		34	TPR_17: Tetratricopeptide repeat	96.49
KOG4642\|consensus		284		96.34
PF03704		146	BTAD: Bacterial transcriptional activator domain;	96.29
KOG1550\|consensus		552		96.25
KOG0890\|consensus		2382		96.21
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	96.18
COG5191		435	Uncharacterized conserved protein, contains HAT (H	96.11
KOG0545\|consensus		329		96.06
KOG0376\|consensus		476		96.03
KOG0545\|consensus		329		96.02
PF03704		146	BTAD: Bacterial transcriptional activator domain;	96.02
PF04910		360	Tcf25: Transcriptional repressor TCF25; InterPro:	95.97
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	95.92
PF04910		360	Tcf25: Transcriptional repressor TCF25; InterPro:	95.9
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	95.8
KOG1464\|consensus		440		95.79
PRK15180		831	Vi polysaccharide biosynthesis protein TviD; Provi	95.76
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	95.66
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	95.64
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	95.47
KOG0376\|consensus		476		95.46
COG5159		421	RPN6 26S proteasome regulatory complex component [	95.25
KOG1308\|consensus		377		95.12
KOG1463\|consensus		411		95.04
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	94.87
KOG2422\|consensus		665		94.68
KOG3824\|consensus		472		94.6
COG0790		292	FOG: TPR repeat, SEL1 subfamily [General function	94.49
KOG0551\|consensus		390		94.45
KOG1538\|consensus		1081		94.44
COG0790		292	FOG: TPR repeat, SEL1 subfamily [General function	94.38
KOG1550\|consensus		552		94.28
KOG0551\|consensus		390		94.22
KOG1538\|consensus		1081		93.77
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	93.69
KOG3824\|consensus		472		93.64
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	93.62
COG5159		421	RPN6 26S proteasome regulatory complex component [	93.62
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	93.47
KOG3807\|consensus		556		93.28
PF14853		53	Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe	93.06
KOG2422\|consensus		665		93.05
PRK10941		269	hypothetical protein; Provisional	92.85
smart00386		33	HAT HAT (Half-A-TPR) repeats. Present in several R	92.74
PRK11619		644	lytic murein transglycosylase; Provisional	92.62
PF04781		111	DUF627: Protein of unknown function (DUF627); Inte	92.61
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	92.47
KOG1308\|consensus		377		92.34
PRK10941		269	hypothetical protein; Provisional	92.34
PF08311		126	Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro	92.21
PF14561		90	TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S	92.0
smart00386		33	HAT HAT (Half-A-TPR) repeats. Present in several R	91.95
KOG1463\|consensus		411		91.94
PF09613		160	HrpB1_HrpK: Bacterial type III secretion protein (	91.92
COG4649		221	Uncharacterized protein conserved in bacteria [Fun	91.77
COG4649		221	Uncharacterized protein conserved in bacteria [Fun	90.65
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	90.43
PF14561		90	TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S	90.38
KOG3783\|consensus		546		90.27
COG1747		711	Uncharacterized N-terminal domain of the transcrip	90.27
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	89.99
PF08311		126	Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro	89.95
PF09613		160	HrpB1_HrpK: Bacterial type III secretion protein (	89.84
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	89.71
COG3629		280	DnrI DNA-binding transcriptional activator of the	89.55
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	89.35
PF04781		111	DUF627: Protein of unknown function (DUF627); Inte	89.16
PRK15180		831	Vi polysaccharide biosynthesis protein TviD; Provi	89.09
COG3914		620	Spy Predicted O-linked N-acetylglucosamine transfe	88.82
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	88.38
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	88.23
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	88.12
PRK11619		644	lytic murein transglycosylase; Provisional	87.51
COG4976		287	Predicted methyltransferase (contains TPR repeat)	87.39
COG3914		620	Spy Predicted O-linked N-acetylglucosamine transfe	87.21
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	87.18
KOG0889\|consensus		3550		87.09
KOG1920\|consensus		1265		86.96
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	86.57
COG1747		711	Uncharacterized N-terminal domain of the transcrip	86.33
PF14853		53	Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe	86.17
KOG0529\|consensus		421		85.74
COG4976		287	Predicted methyltransferase (contains TPR repeat)	85.42
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	85.37
TIGR02561		153	HrpB1_HrpK type III secretion protein HrpB1/HrpK.	85.3
PF02184		32	HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107	84.32
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	84.25
COG4941		415	Predicted RNA polymerase sigma factor containing a	84.11
KOG4422\|consensus		625		84.09
KOG2581\|consensus		493		83.49
KOG4814\|consensus		872		83.08
TIGR02561		153	HrpB1_HrpK type III secretion protein HrpB1/HrpK.	83.06
KOG3783\|consensus		546		82.97
PF15015		569	NYD-SP12_N: Spermatogenesis-associated, N-terminal	82.93
KOG0292\|consensus		1202		82.7
KOG1920\|consensus		1265		82.69
PF11207		203	DUF2989: Protein of unknown function (DUF2989); In	82.33
KOG2066\|consensus		846		81.61
KOG3807\|consensus		556		81.47
KOG2581\|consensus		493		81.41
PF02184		32	HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107	81.16
PF04840		319	Vps16_C: Vps16, C-terminal region; InterPro: IPR00	80.83
PF07720		36	TPR_3: Tetratricopeptide repeat; InterPro: IPR0117	80.74

>KOG0495\|consensus	Back alignment and domain information

Probab=100.00  E-value=4e-156  Score=1296.57  Aligned_cols=900  Identities=68%  Similarity=1.102  Sum_probs=843.8

Q ss_pred             cccccCCCCCCCCCccCCCCCCCCccccCCCccCCCCCCCCcccccccccccCCCcccccccccCCCCCCCCCCCcccCC
Q psy3224          61 KSKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKDEEEDDEEDLNDSNFDEFNGYGGSLF  140 (1278)
Q Consensus        61 ~~~~f~~~~~p~~yv~g~grga~gf~t~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  140 (1278)
                      .+++||+||||+|||||||||||||||||||||||++++.+ ...++|.++.    .++|++|+++.+||||+||++|||
T Consensus        13 ~r~~Fl~~~pP~gYVaGlGRGATGFTTRsdigpArd~~~~~-~~~~~~~~~~----~e~d~e~~~~~~ydefeg~~~~lf   87 (913)
T KOG0495|consen   13 PRPDFLGMPPPSGYVAGLGRGATGFTTRSDIGPARDAPDLP-SGKAAPEKRK----SEDDEEDDNDINYDEFEGNDGSLF   87 (913)
T ss_pred             CCccccCCCCCCCcCCCcCCCccCccchhhcCcccCCcccC-CCccchhhhh----ccchhhhcccCCccccccccchhh
Confidence            78999999999999999999999999999999999887655 2333343332    234447899999999999999999


Q ss_pred             CCCCCCCChHHHHHHHHHHhHHHHHhhhHHHHHHHHHHHHHHHhcCCchhhhhhhhhhhcccCChHHhhcccccccccCC
Q psy3224         141 NKDPYDKDDEEADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNEGQVVGQAIP  220 (1278)
Q Consensus       141 ~~~~~~~~d~ead~i~~~~d~~~~~~r~~~~~~~~~~~~~~~~~~~~~i~~qf~~lkr~l~~~~~~~w~~~~~~~~~~~~  220 (1278)
                      +++|||+||+|||+||++||.|||+|||+|||+++++++|+||.+||||||||+||||+|++||+|||.+||+       
T Consensus        88 a~~pyD~eDeEAd~Iy~sid~rld~rrK~rre~k~ke~iE~y~~e~pkv~~QFaDLKr~LatvTe~EW~~IPE-------  160 (913)
T KOG0495|consen   88 ASAPYDDEDEEADAIYDSIDLRLDERRKERREKKLKEEIEKYRKENPKVQQQFADLKRKLATVTEDEWDSIPE-------  160 (913)
T ss_pred             cCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccChhHHHHHHHHHHHHhhcCHHHhhcCCc-------
Confidence            9999999999999999999999999999999999999999999999999999999999999999999987433       


Q ss_pred             CCCCcccccCCCCCCCCCCCCCCcCCCCCCcccccccccCCCCCCCCCCCcccccccccccccCcccccccccCCCCCcc
Q psy3224         221 PPPIPLVNRNKKHFMGVPAPLGYVAGVGRGATGFTTRSDIGPARDANDVSDDRHAAPVKRKKKDEEEDDEEDLNDSNFDE  300 (1278)
Q Consensus       221 ~~~~~~~~~~~~~~~~~~~p~~~~~~~~r~~~~~~t~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  300 (1278)
                                                                                                      
T Consensus       161 --------------------------------------------------------------------------------  160 (913)
T KOG0495|consen  161 --------------------------------------------------------------------------------  160 (913)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cCCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHhhcCchhhhhhhhhhhccCcCChHhhhcC
Q psy3224         301 FNGYGGSLFNKDPYDKDDEEADMIYEEIDKRMDEKRKDYREKRLREELERYRQERPKIQQQFSDLKRGLVTVSMDEWKNV  380 (1278)
Q Consensus       301 ~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~l~~~l~~~~~~~w~~~  380 (1278)
                                                                                                      
T Consensus       161 --------------------------------------------------------------------------------  160 (913)
T KOG0495|consen  161 --------------------------------------------------------------------------------  160 (913)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CccccchhcccccccccccccCCcchhccCC-CCCCcccccCCCCCccCCCCCCCCCCCCCCcccchHHhHHHHHhHhhh
Q psy3224         381 PEVGDARNRKQRNPRAEKFTPLPDSVLRGNL-GGESTGAIDPNSGLMSQIPGTATPGMLTPSGDLDLRKMGQARNTLMNV  459 (1278)
Q Consensus       381 ~~~g~~~~~~~~~~~~~~~~~~~ds~~~~~~-~~~~~t~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~di~kar~~l~~~  459 (1278)
                        +||+|+|++|+++..||+++|||++.+.+ .++..+++||+||+.|++.+.    +     .+...+|++||..|+++
T Consensus       161 --vgD~r~r~krn~r~Ekf~p~pds~~~~~~~~~~~~~~ld~~~g~etp~~~g----~-----~t~~~kig~ar~~l~~~  229 (913)
T KOG0495|consen  161 --VGDYRNRNKRNPRAEKFTPVPDSLLASAINENEDSSSLDPEGGLETPLQSG----Q-----MTPGVKIGQARNTLMDM  229 (913)
T ss_pred             --ccchhhhhhccchhhhcCCCchHHHHHhcccCccccccCccCCccCCCcCC----C-----cCccchhhHHHHHHHhh
Confidence              33333444444455778888888888877 577789999999998887551    1     22344999999999999


Q ss_pred             hhhhccCCCcCCCcCChhhhHhhhhccCCCcccccchHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhcCCHHHHHHHHH
Q psy3224         460 KLNQISDSVVGQTVVDPKGYLTDLQSMIPTYGGDINDIKKARLLLKSVRETNPNHPPAWIASARLEEVTGKVQAARNLIM  539 (1278)
Q Consensus       460 ~l~~~~~sv~~~~~~~~~g~ia~a~~~l~~~~~~~g~~~~A~~~l~~~l~~~P~~~~~wl~~arl~~~~g~~~~A~~~l~  539 (1278)
                      +|+++++||++++..||+||++.+.+.+-...+.++|+++||.+++++.+.||+||.+|+..||++...|++..|+.++.
T Consensus       230 kl~qvsdsvtgqtvvDpkgYLtdL~sm~p~~~~dl~DikKaR~llKSvretnP~hp~gWIAsArLEEvagKl~~Ar~~I~  309 (913)
T KOG0495|consen  230 KLNQVSDSVTGQTVVDPKGYLTDLNSMIPTSGGDLEDIKKARLLLKSVRETNPKHPPGWIASARLEEVAGKLSVARNLIM  309 (913)
T ss_pred             hhhhccccCCCCcccCchHHHhHHHhcCCCccCcHHHHHHHHHHHHHHHhcCCCCCchHHHHHHHHHHhhHHHHHHHHHH
Confidence            99999999999999999999999999888889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCHHHHHHHHhcCCchHHHHHHHHHHHhCCCCHHHHHHHHHchhhHHHHHHHHHHHHHhCCCCHHHHHHHHhc
Q psy3224         540 KGCEENQTSEDLWLEAARLQPVDTARAVIAQAVRHIPTSVRIWIKAADLETETKAKRRVYRKALEHIPNSVRLWKAAVEL  619 (1278)
Q Consensus       540 ~al~~~P~s~~lwl~~a~L~~~~~A~~~l~kaL~~~P~s~~lw~~~~~le~~~~~A~~ll~rAle~~P~s~~Lw~al~~l  619 (1278)
                      ++|+.||+|.++||++++|+.++.|+.++.+|+.++|+|+.+|++++.|+.+..+..+++++||+.+|+|+.||++.+.+
T Consensus       310 ~GCe~cprSeDvWLeaiRLhp~d~aK~vvA~Avr~~P~Sv~lW~kA~dLE~~~~~K~RVlRKALe~iP~sv~LWKaAVel  389 (913)
T KOG0495|consen  310 KGCEECPRSEDVWLEAIRLHPPDVAKTVVANAVRFLPTSVRLWLKAADLESDTKNKKRVLRKALEHIPRSVRLWKAAVEL  389 (913)
T ss_pred             HHHhhCCchHHHHHHHHhcCChHHHHHHHHHHHHhCCCChhhhhhHHhhhhHHHHHHHHHHHHHHhCCchHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHhCCCCHHHHHHHHHhcCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh
Q psy3224         620 EDPEDARILLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRQIWTTAAKLEEAHGNNAMVDKIIDRALSS  699 (1278)
Q Consensus       620 ~~~e~A~~~l~kal~~~P~~~~~w~~la~l~~~~~A~~~l~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~il~~al~~  699 (1278)
                      ++.+.|+.+|.+|++++|.+.++|++|++|+.|++|.++++++.+..|.++.+|+..+.+.+.+|+.+...+|+.+.+..
T Consensus       390 E~~~darilL~rAveccp~s~dLwlAlarLetYenAkkvLNkaRe~iptd~~IWitaa~LEE~ngn~~mv~kii~rgl~~  469 (913)
T KOG0495|consen  390 EEPEDARILLERAVECCPQSMDLWLALARLETYENAKKVLNKAREIIPTDREIWITAAKLEEANGNVDMVEKIIDRGLSE  469 (913)
T ss_pred             cChHHHHHHHHHHHHhccchHHHHHHHHHHHHHHHHHHHHHHHHhhCCCChhHHHHHHHHHHhcCCHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhCCccccHHHHHHHHHHHHHcCChhHHHHHHHHHHhcCCCccchHhhHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC
Q psy3224         700 LSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAIIGYGVEQEDRKHTWMEDAESCANQGAYECARAIYAQALATFPSK  779 (1278)
Q Consensus       700 ~~~~~~~~~~~~~l~~A~~~~~~g~~~~A~~i~~~~l~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~P~~  779 (1278)
                      +..+|+..+++.|+..|+.|...|...+|.+|+..++..+.+..+....|+.-++.+...+.++-|+.+|..+++.+|..
T Consensus       470 L~~ngv~i~rdqWl~eAe~~e~agsv~TcQAIi~avigigvEeed~~~tw~~da~~~~k~~~~~carAVya~alqvfp~k  549 (913)
T KOG0495|consen  470 LQANGVEINRDQWLKEAEACEDAGSVITCQAIIRAVIGIGVEEEDRKSTWLDDAQSCEKRPAIECARAVYAHALQVFPCK  549 (913)
T ss_pred             HhhcceeecHHHHHHHHHHHhhcCChhhHHHHHHHHHhhccccchhHhHHhhhHHHHHhcchHHHHHHHHHHHHhhccch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCchHHHHHhhcccchHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCc
Q psy3224         780 KSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKS  859 (1278)
Q Consensus       780 ~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~~~~~~~~~~~l~~a~l~~~~g~~~~A~~~~~~al~~~P~~  859 (1278)
                      ..+|...+.+...+|..++                                              ...++++++..+|..
T Consensus       550 ~slWlra~~~ek~hgt~Es----------------------------------------------l~Allqkav~~~pka  583 (913)
T KOG0495|consen  550 KSLWLRAAMFEKSHGTRES----------------------------------------------LEALLQKAVEQCPKA  583 (913)
T ss_pred             hHHHHHHHHHHHhcCcHHH----------------------------------------------HHHHHHHHHHhCCcc
Confidence            8888877777777766665                                              666778888888888


Q ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHHhhhhhhcCCCcHHHHHH
Q psy3224         860 EVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAGAFQANPNSEEIWLA  939 (1278)
Q Consensus       860 ~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la~l~~~~g~~~~A~~~l~~al~~~~~l~~~p~~~~~~~~  939 (1278)
                      +.+|++++..++..|+...|+.++.++++.+|++.++|+....++.                                  
T Consensus       584 e~lwlM~ake~w~agdv~~ar~il~~af~~~pnseeiwlaavKle~----------------------------------  629 (913)
T KOG0495|consen  584 EILWLMYAKEKWKAGDVPAARVILDQAFEANPNSEEIWLAAVKLEF----------------------------------  629 (913)
T ss_pred             hhHHHHHHHHHHhcCCcHHHHHHHHHHHHhCCCcHHHHHHHHHHhh----------------------------------
Confidence            9999999999999999999999999999999999999999998887                                  


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCChHHHHHHHHHHHHHcCCHHH
Q psy3224         940 AVKLESENNEYERARRLLAKARASAPTPRVMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMMKGQIEEQKNLLDK 1019 (1278)
Q Consensus       940 la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la~~~~~~g~~~~ 1019 (1278)
                            ...++++|+.+|.++....|+..+|+..+.+.+.+++.++|+.+++++++.+|++..+|+.+|+++.+.++.+.
T Consensus       630 ------en~e~eraR~llakar~~sgTeRv~mKs~~~er~ld~~eeA~rllEe~lk~fp~f~Kl~lmlGQi~e~~~~ie~  703 (913)
T KOG0495|consen  630 ------ENDELERARDLLAKARSISGTERVWMKSANLERYLDNVEEALRLLEEALKSFPDFHKLWLMLGQIEEQMENIEM  703 (913)
T ss_pred             ------ccccHHHHHHHHHHHhccCCcchhhHHHhHHHHHhhhHHHHHHHHHHHHHhCCchHHHHHHHhHHHHHHHHHHH
Confidence                  56667777777777777889999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHC
Q psy3224        1020 AHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNCAELWLAAIRVEIRAGLKDIANTMMAKALQEC 1099 (1278)
Q Consensus      1020 A~~~~~~al~~~p~~~~~~~~la~l~~~~g~~~~A~~~l~kal~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~kal~~~ 1099 (1278)
                      |+..|...++.||+++.+|..++.+..+.|...+|+.+|+++...+|++..+|+..++++.+.|+.++|..++.++|+.|
T Consensus       704 aR~aY~~G~k~cP~~ipLWllLakleEk~~~~~rAR~ildrarlkNPk~~~lwle~Ir~ElR~gn~~~a~~lmakALQec  783 (913)
T KOG0495|consen  704 AREAYLQGTKKCPNSIPLWLLLAKLEEKDGQLVRARSILDRARLKNPKNALLWLESIRMELRAGNKEQAELLMAKALQEC  783 (913)
T ss_pred             HHHHHHhccccCCCCchHHHHHHHHHHHhcchhhHHHHHHHHHhcCCCcchhHHHHHHHHHHcCCHHHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcHHHHHHHHhccCCCCChhHHHHHHHHhccCcchhhhhhhhhhhhcccccccccCccccccccchhhhhhhhCCCCHH
Q psy3224        1100 PNAGILWAEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCHRSGSRRCMGVKTKSVDALKKCEHDPH 1179 (1278)
Q Consensus      1100 P~~~~~~~~~~~~~~~~~~~~~A~~~l~k~~~~p~~~~~~~~l~~~~~~~~~A~~~~~~~~~~~~~~a~~~l~~~p~~~~ 1179 (1278)
                      |+++.+|...+.+..+.++..+++++|++|.+||+                                             
T Consensus       784 p~sg~LWaEaI~le~~~~rkTks~DALkkce~dph---------------------------------------------  818 (913)
T KOG0495|consen  784 PSSGLLWAEAIWLEPRPQRKTKSIDALKKCEHDPH---------------------------------------------  818 (913)
T ss_pred             CccchhHHHHHHhccCcccchHHHHHHHhccCCch---------------------------------------------
Confidence            99999999999999999999999999999999999                                             


Q ss_pred             HHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCChhHHHHHHHHHHHhCCHHHHHHHHHHHHHhCCCCcchhhhhhhccccC
Q psy3224        1180 VLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGTEETQAEVKKRCLAAEPKHGENWCRVAKNVSNW 1259 (1278)
Q Consensus      1180 ~l~~lg~~~~~~g~~~~A~~~~~kal~~~P~~~d~~~~l~~~~~~~G~~~~A~~~l~ka~~~~P~~~~~w~~~~k~~~~~ 1259 (1278)
                      ++..+|.+||...++++|++||.++++.+|+++|+|.+++.++..+|+.++-.+++.+|...+|.||+.|+.+.|++.||
T Consensus       819 Vllaia~lfw~e~k~~kar~Wf~Ravk~d~d~GD~wa~fykfel~hG~eed~kev~~~c~~~EP~hG~~W~avSK~i~n~  898 (913)
T KOG0495|consen  819 VLLAIAKLFWSEKKIEKAREWFERAVKKDPDNGDAWAWFYKFELRHGTEEDQKEVLKKCETAEPTHGELWQAVSKDIKNW  898 (913)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHccCCccchHHHHHHHHHHHhCCHHHHHHHHHHHhccCCCCCcHHHHHhhhHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHhhC
Q psy3224        1260 KLPRETILSLVAKDL 1274 (1278)
Q Consensus      1260 ~~~~~~~l~~~~~~~ 1274 (1278)
                      +++++|||..+...+
T Consensus       899 ~~t~~eiL~~~~n~l  913 (913)
T KOG0495|consen  899 RKTPEEILLLVVNDL  913 (913)
T ss_pred             cCCHHHHHHHHhccC
Confidence            999999999998654

>KOG0495\|consensus	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PF06424 PRP1_N: PRP1 splicing factor, N-terminal; InterPro: IPR010491 This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression)	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>PF06424 PRP1_N: PRP1 splicing factor, N-terminal; InterPro: IPR010491 This domain is specific to the N-terminal part of the prp1 splicing factor, which is involved in mRNA splicing (and possibly also poly(A)+ RNA nuclear export and cell cycle progression)	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>KOG1915\|consensus	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG1915\|consensus	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG2047\|consensus	Back alignment and domain information

>KOG2047\|consensus	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>KOG2076\|consensus	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG1127\|consensus	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>KOG2076\|consensus	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>KOG1155\|consensus	Back alignment and domain information

>KOG1127\|consensus	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>KOG1155\|consensus	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>KOG1174\|consensus	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG0548\|consensus	Back alignment and domain information

>KOG1156\|consensus	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>KOG0548\|consensus	Back alignment and domain information

>KOG1156\|consensus	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG1174\|consensus	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>KOG1129\|consensus	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>KOG2376\|consensus	Back alignment and domain information

>KOG1129\|consensus	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG1125\|consensus	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1125\|consensus	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG1914\|consensus	Back alignment and domain information

>KOG2376\|consensus	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>KOG1914\|consensus	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG1258\|consensus	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>KOG2396\|consensus	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification]	Back alignment and domain information

>KOG2396\|consensus	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>KOG1070\|consensus	Back alignment and domain information

>KOG1258\|consensus	Back alignment and domain information

>KOG1070\|consensus	Back alignment and domain information

>KOG3060\|consensus	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification]	Back alignment and domain information

>KOG3060\|consensus	Back alignment and domain information

>KOG4340\|consensus	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>KOG1128\|consensus	Back alignment and domain information

>KOG1128\|consensus	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG3617\|consensus	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>KOG3617\|consensus	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG4340\|consensus	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG3616\|consensus	Back alignment and domain information

>KOG0553\|consensus	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>KOG2300\|consensus	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>KOG2053\|consensus	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>COG3898 Uncharacterized membrane-bound protein [Function unknown]	Back alignment and domain information

>KOG0553\|consensus	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>KOG2053\|consensus	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>COG3898 Uncharacterized membrane-bound protein [Function unknown]	Back alignment and domain information

>KOG0128\|consensus	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>KOG0128\|consensus	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2471\|consensus	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>KOG3616\|consensus	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG3081\|consensus	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>KOG2300\|consensus	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>KOG3081\|consensus	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG0543\|consensus	Back alignment and domain information

>KOG0543\|consensus	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0985\|consensus	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>KOG2471\|consensus	Back alignment and domain information

>KOG4648\|consensus	Back alignment and domain information

>KOG4234\|consensus	Back alignment and domain information

>KOG0985\|consensus	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>KOG4648\|consensus	Back alignment and domain information

>KOG4234\|consensus	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>KOG1586\|consensus	Back alignment and domain information

>KOG1585\|consensus	Back alignment and domain information

>KOG1586\|consensus	Back alignment and domain information

>KOG2796\|consensus	Back alignment and domain information

>KOG2796\|consensus	Back alignment and domain information

>KOG1585\|consensus	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>KOG0530\|consensus	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases	Back alignment and domain information

>KOG4507\|consensus	Back alignment and domain information

>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene	Back alignment and domain information

>PF13281 DUF4071: Domain of unknown function (DUF4071)	Back alignment and domain information

>KOG4555\|consensus	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>KOG0890\|consensus	Back alignment and domain information

>KOG4555\|consensus	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>KOG0530\|consensus	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>KOG4507\|consensus	Back alignment and domain information

>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>KOG2041\|consensus	Back alignment and domain information

>KOG2610\|consensus	Back alignment and domain information

>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only]	Back alignment and domain information

>KOG2610\|consensus	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length	Back alignment and domain information

>KOG1464\|consensus	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2041\|consensus	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG4642\|consensus	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PF13281 DUF4071: Domain of unknown function (DUF4071)	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>KOG4642\|consensus	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>KOG1550\|consensus	Back alignment and domain information

>KOG0890\|consensus	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only]	Back alignment and domain information

>KOG0545\|consensus	Back alignment and domain information

>KOG0376\|consensus	Back alignment and domain information

>KOG0545\|consensus	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ]	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ]	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG1464\|consensus	Back alignment and domain information

>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0376\|consensus	Back alignment and domain information

>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1308\|consensus	Back alignment and domain information

>KOG1463\|consensus	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>KOG2422\|consensus	Back alignment and domain information

>KOG3824\|consensus	Back alignment and domain information

>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only]	Back alignment and domain information

>KOG0551\|consensus	Back alignment and domain information

>KOG1538\|consensus	Back alignment and domain information

>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only]	Back alignment and domain information

>KOG1550\|consensus	Back alignment and domain information

>KOG0551\|consensus	Back alignment and domain information

>KOG1538\|consensus	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>KOG3824\|consensus	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>KOG3807\|consensus	Back alignment and domain information

>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A	Back alignment and domain information

>KOG2422\|consensus	Back alignment and domain information

>PRK10941 hypothetical protein; Provisional	Back alignment and domain information

>smart00386 HAT HAT (Half-A-TPR) repeats	Back alignment and domain information

>PRK11619 lytic murein transglycosylase; Provisional	Back alignment and domain information

>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>KOG1308\|consensus	Back alignment and domain information

>PRK10941 hypothetical protein; Provisional	Back alignment and domain information

>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division	Back alignment and domain information

>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B	Back alignment and domain information

>smart00386 HAT HAT (Half-A-TPR) repeats	Back alignment and domain information

>KOG1463\|consensus	Back alignment and domain information

>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia	Back alignment and domain information

>COG4649 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG4649 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B	Back alignment and domain information

>KOG3783\|consensus	Back alignment and domain information

>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division	Back alignment and domain information

>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms]	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function	Back alignment and domain information

>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional	Back alignment and domain information

>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PRK11619 lytic murein transglycosylase; Provisional	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>KOG0889\|consensus	Back alignment and domain information

>KOG1920\|consensus	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown]	Back alignment and domain information

>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A	Back alignment and domain information

>KOG0529\|consensus	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK	Back alignment and domain information

>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription]	Back alignment and domain information

>KOG4422\|consensus	Back alignment and domain information

>KOG2581\|consensus	Back alignment and domain information

>KOG4814\|consensus	Back alignment and domain information

>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK	Back alignment and domain information

>KOG3783\|consensus	Back alignment and domain information

>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal	Back alignment and domain information

>KOG0292\|consensus	Back alignment and domain information

>KOG1920\|consensus	Back alignment and domain information

>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed	Back alignment and domain information

>KOG2066\|consensus	Back alignment and domain information

>KOG3807\|consensus	Back alignment and domain information

>KOG2581\|consensus	Back alignment and domain information

>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing	Back alignment and domain information

>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones []	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1278
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	1e-47
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	4e-43
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	2e-36
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	2e-36
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	4e-31
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	1e-20
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	5e-12
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	3e-04
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	1e-30
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	8e-28
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	3e-24
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	2e-20
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	7e-18
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	7e-08
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	1e-27
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	6e-24
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	4e-18
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	3e-04
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	2e-18
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	2e-11
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	5e-11
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	3e-15
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	1e-14
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	1e-05
2gw1_A		514	Mitochondrial precursor proteins import receptor;	1e-14
2gw1_A		514	Mitochondrial precursor proteins import receptor;	2e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-04
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	2e-12
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	3e-11
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	2e-08
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	9e-08
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	2e-05
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	3e-05
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	1e-04
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	1e-11
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	2e-11
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	4e-09
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	1e-08
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	3e-08
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	3e-05
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	1e-04
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	4e-11
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	8e-09
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	4e-04
3ugm_A		1047	TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan	5e-11
3ugm_A		1047	TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan	8e-11
3ugm_A		1047	TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan	2e-10
3ugm_A		1047	TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan	5e-09
3ugm_A		1047	TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan	2e-07
3ugm_A		1047	TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan	2e-07
3ugm_A		1047	TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan	9e-07
3ugm_A		1047	TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan	4e-04
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	5e-11
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	3e-08
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	1e-05
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	1e-04
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	1e-04
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	2e-04
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	6e-04
3tax_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	1e-10
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	2e-10
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	3e-05
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	5e-10
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	2e-05
3v6t_A		499	DHAX3; tandem repeats, DNA specific binding protei	1e-08
3v6t_A		499	DHAX3; tandem repeats, DNA specific binding protei	3e-08
3v6t_A		499	DHAX3; tandem repeats, DNA specific binding protei	5e-07
3v6t_A		499	DHAX3; tandem repeats, DNA specific binding protei	6e-07
3v6t_A		499	DHAX3; tandem repeats, DNA specific binding protei	1e-04
3v6t_A		499	DHAX3; tandem repeats, DNA specific binding protei	2e-04
4g1t_A		472	Interferon-induced protein with tetratricopeptide	1e-08
4g1t_A		472	Interferon-induced protein with tetratricopeptide	7e-08
4g1t_A		472	Interferon-induced protein with tetratricopeptide	1e-06
4g1t_A		472	Interferon-induced protein with tetratricopeptide	4e-06
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	3e-08
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	9e-08
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	2e-04
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	4e-08
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	7e-08
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	7e-08
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	2e-05
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	6e-08
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	5e-07
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	2e-06
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	1e-06
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	9e-06
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	2e-06
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	5e-06
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	9e-05
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	8e-06
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	2e-04
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	9e-06
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	6e-04
3u4t_A		272	TPR repeat-containing protein; structural genomics	9e-06
3u4t_A		272	TPR repeat-containing protein; structural genomics	2e-05
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	1e-05
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	2e-05
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	2e-05
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	3e-05
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	4e-04
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	2e-05
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	3e-05
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	3e-04
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	3e-05
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	2e-04
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	4e-05
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	5e-05
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	9e-05
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	1e-04
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	2e-04
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	3e-04
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	4e-04
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	5e-04
2kat_A		115	Uncharacterized protein; NESG, structure, structur	6e-04

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530	Back alignment and structure

 Score =  178 bits (452), Expect = 1e-47
 Identities = 68/532 (12%), Positives = 152/532 (28%), Gaps = 71/532 (13%)

Query: 628  LLSRAVECCPTSVELWLALARL---ETYENARKVLNKARENIPTDRQIWTTAAKLEEAHG 684
            +  + +E  P  ++ W  L R    +  + ARK   +     P+  + W    + E    
Sbjct: 1    MAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAK 60

Query: 685  NNAMVDKIIDRALSSLSANGVEINREHWFKEAIEAEKAGSVHTCQALIRAI--IGYGVEQ 742
            N   V+K+  R L  +    +      + +E      +      QA   A+  IG  +  
Sbjct: 61   NYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMS 120

Query: 743  EDRKHTWMEDAESC------ANQGAYECARAIYAQALAT-FPSKKSIWLRAAYFEKNHGT 795
                  ++   +        A        R +Y +       + + +W     +E+    
Sbjct: 121  YQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINI 180

Query: 796  RESLETLLQKAVAHCPKSEVLWLMGAK-------------------SNKKSIWLRAAYFE 836
              + + +  ++  +     V                          + +  +W +   +E
Sbjct: 181  HLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWE 240

Query: 837  KNHGTRESLETLLQK--------AVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQ 888
            K++  R   +TL+ K         +        +W   A+    +  + A +G       
Sbjct: 241  KSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKG------- 293

Query: 889  ANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAGAFQANPNSEEIWLAAVKLESENN 948
                  ++  A +  +   N YERA   L               +  ++ A    E    
Sbjct: 294  ------DMNNAKLFSDEAANIYERAISTL------------LKKNMLLYFAYADYEESRM 335

Query: 949  EYERARRLLAKARASAP--TPRVMIQSAKLEWCLDNLERALQLLDEAIKVFPDFAKLWMM 1006
            +YE+   +  +  A        V IQ  K     + ++    +  +A +       +++ 
Sbjct: 336  KYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVYVT 395

Query: 1007 KGQIEEQ-KNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRN 1065
               +E         A   F   +KK        +   +           R + E+     
Sbjct: 396  AALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSG 455

Query: 1066 P----NCAELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLE 1113
                    E+W   +  E   G       +  +              A+ ++
Sbjct: 456  SLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFREEYEGKETALLVD 507

PyMOL of 2ooe

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568	Back alignment and structure

>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047	Back alignment and structure

>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047	Back alignment and structure

>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047	Back alignment and structure

>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047	Back alignment and structure

>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047	Back alignment and structure

>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047	Back alignment and structure

>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047	Back alignment and structure

>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359	Back alignment and structure

>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208	Back alignment and structure

>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499	Back alignment and structure

>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499	Back alignment and structure

>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499	Back alignment and structure

>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499	Back alignment and structure

>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499	Back alignment and structure

>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382

Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1278
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	100.0
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	100.0
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	100.0
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	100.0
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	100.0
2gw1_A		514	Mitochondrial precursor proteins import receptor;	100.0
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.97
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	99.97
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	99.97
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.97
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.97
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.97
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.97
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.96
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.96
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	99.95
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	99.94
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.94
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.94
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.94
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.93
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.93
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.92
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.91
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.91
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.91
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	99.91
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.9
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.9
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.9
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	99.89
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.89
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.87
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.86
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.86
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	99.86
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	99.85
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	99.85
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.85
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.85
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	99.84
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	99.84
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.84
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.84
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	99.84
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	99.84
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.83
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.82
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.82
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.81
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.8
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.8
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.8
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	99.8
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.8
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.79
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.79
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.79
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.79
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.79
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.78
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.77
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.77
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.76
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.76
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.75
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.73
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.73
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.72
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.71
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.7
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.7
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.69
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.68
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	99.68
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	99.67
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	99.66
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.66
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	99.66
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.65
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.64
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	99.63
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.63
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	99.63
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.62
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.62
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	99.61
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	99.6
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	99.59
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	99.58
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	99.58
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	99.58
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	99.57
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	99.56
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	99.55
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.55
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	99.54
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	99.54
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	99.53
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.52
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	99.49
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	99.48
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	99.48
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	99.44
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	99.43
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	99.43
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	99.42
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.42
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	99.42
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	99.42
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	99.42
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.41
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	99.41
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	99.38
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	99.37
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.36
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	99.35
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	99.35
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	99.33
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	99.33
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	99.33
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	99.32
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	99.28
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	99.28
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	99.28
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	99.26
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.26
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	99.25
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	99.25
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	99.24
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	99.24
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	99.23
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	99.23
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	99.22
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	99.22
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.22
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	99.19
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	99.18
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	99.18
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	99.18
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	99.17
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	99.16
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	99.15
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	99.15
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	99.15
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	99.14
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	99.13
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	99.12
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	99.12
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	99.12
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	99.12
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.1
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	99.09
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	99.09
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	99.08
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	99.08
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	99.08
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	99.07
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	99.07
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	99.05
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	99.05
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	99.05
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	99.03
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	99.03
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	99.02
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	99.02
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	99.01
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	99.0
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	99.0
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	98.99
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	98.99
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	98.98
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	98.97
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	98.97
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	98.96
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.96
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	98.94
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	98.94
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	98.94
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	98.92
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	98.91
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	98.9
3k9i_A		117	BH0479 protein; putative protein binding protein,	98.89
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	98.89
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	98.88
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	98.86
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	98.8
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.8
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	98.78
3k9i_A		117	BH0479 protein; putative protein binding protein,	98.78
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.77
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	98.77
2kat_A		115	Uncharacterized protein; NESG, structure, structur	98.63
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	98.58
2l6j_A		111	TPR repeat-containing protein associated with HSP;	98.54
2l6j_A		111	TPR repeat-containing protein associated with HSP;	98.5
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	98.5
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	98.47
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	98.47
2kat_A		115	Uncharacterized protein; NESG, structure, structur	98.44
4h7y_A		161	Dual specificity protein kinase TTK; mitotic check	98.44
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	98.39
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	98.35
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	98.34
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	98.34
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	98.31
4h7y_A		161	Dual specificity protein kinase TTK; mitotic check	98.3
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.26
1klx_A		138	Cysteine rich protein B; structural genomics, heli	98.24
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	98.22
1klx_A		138	Cysteine rich protein B; structural genomics, heli	98.21
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	98.13
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	98.11
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.05
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	98.02
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	97.88
1pc2_A		152	Mitochondria fission protein; unknown function; NM	97.81
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	97.75
1pc2_A		152	Mitochondria fission protein; unknown function; NM	97.68
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	97.52
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	97.28
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	97.24
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	97.09
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	96.99
1nzn_A		126	CGI-135 protein, fission protein FIS1P; TPR, unkno	96.82
1nzn_A		126	CGI-135 protein, fission protein FIS1P; TPR, unkno	96.61
1qsa_A		618	Protein (soluble lytic transglycosylase SLT70); al	96.58
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	96.38
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	96.35
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	96.05
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	95.4
1qsa_A		618	Protein (soluble lytic transglycosylase SLT70); al	95.15
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	94.93
1y8m_A		144	FIS1; mitochondria, unknown function; NMR {Sacchar	94.86
3lpz_A		336	GET4 (YOR164C homolog); protein targeting, tail-an	94.85
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	94.69
4gns_B		754	Protein CSD3, chitin biosynthesis protein CHS6; FN	94.63
3o48_A		134	Mitochondria fission 1 protein; tetratricopeptide	94.48
1y8m_A		144	FIS1; mitochondria, unknown function; NMR {Sacchar	94.25
3o48_A		134	Mitochondria fission 1 protein; tetratricopeptide	94.15
1zbp_A		273	Hypothetical protein VPA1032; alpha-beta protein,	93.86
4gns_B		754	Protein CSD3, chitin biosynthesis protein CHS6; FN	93.12
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	92.78
4ady_A		963	RPN2, 26S proteasome regulatory subunit RPN2; prot	92.59
2wpv_A		312	GET4, UPF0363 protein YOR164C; golgi-ER traffickin	92.12
3spa_A		1134	Mtrpol, DNA-directed RNA polymerase, mitochondrial	92.07
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	91.95
3kae_A		242	CDC27, possible protein of nuclear scaffold; tetra	91.79
3spa_A		1134	Mtrpol, DNA-directed RNA polymerase, mitochondrial	91.51
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	91.49
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	90.96
1zbp_A		273	Hypothetical protein VPA1032; alpha-beta protein,	90.54
2ff4_A		388	Probable regulatory protein EMBR; winged-helix, te	90.42
3kae_A		242	CDC27, possible protein of nuclear scaffold; tetra	88.28
3esl_A		202	Checkpoint serine/threonine-protein kinase BUB1; m	87.79
2ff4_A		388	Probable regulatory protein EMBR; winged-helix, te	87.63
4b4t_S		523	RPN3, 26S proteasome regulatory subunit RPN3; hydr	86.58
4b4t_S		523	RPN3, 26S proteasome regulatory subunit RPN3; hydr	86.27
4fhn_B		1139	Nucleoporin NUP120; protein complex,structural pro	85.63
4fhn_B		1139	Nucleoporin NUP120; protein complex,structural pro	85.54
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	82.42
3esl_A		202	Checkpoint serine/threonine-protein kinase BUB1; m	82.16
4ady_A		963	RPN2, 26S proteasome regulatory subunit RPN2; prot	82.13
1ya0_A		497	SMG-7 transcript variant 2; alpha-helical repeat,	81.93
1ya0_A		497	SMG-7 transcript variant 2; alpha-helical repeat,	80.62

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

Probab=100.00  E-value=5.6e-35  Score=347.39  Aligned_cols=384  Identities=14%  Similarity=0.115  Sum_probs=286.9

Q ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCchHHHHHhhcccchHHHHH
Q psy3224         751 EDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIWL  830 (1278)
Q Consensus       751 ~la~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~~~~~~~~~~~l  830 (1278)
                      .+|..+...|++++|+..|.+++..+|++..++..++.++...|++++|                               
T Consensus         4 ~~a~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~a-------------------------------   52 (388)
T 1w3b_A            4 ELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRS-------------------------------   52 (388)
T ss_dssp             THHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHH-------------------------------
T ss_pred             hHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHH-------------------------------
Confidence            3577788889999999999999999999998888888888888877774                               


Q ss_pred             HHHHHHHhcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCcH
Q psy3224         831 RAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNEY  910 (1278)
Q Consensus       831 ~~a~l~~~~g~~~~A~~~~~~al~~~P~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la~l~~~~g~~  910 (1278)
                                     ...++.+++.+|.+..+|..+|.++...|++++|+..|++++...|++..+|..++.++...|++
T Consensus        53 ---------------~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~  117 (388)
T 1w3b_A           53 ---------------AHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDM  117 (388)
T ss_dssp             ---------------HHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCS
T ss_pred             ---------------HHHHHHHHhcCCCchHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCH
Confidence                           44455555556666666666666666666666666666666666666666666666666666666


Q ss_pred             HHHHHHHHHHHHhhhhhhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-HHHHHHHHHHHHHcCCHHHHHHH
Q psy3224         911 ERARRLLAKARAQAGAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARASAPT-PRVMIQSAKLEWCLDNLERALQL  989 (1278)
Q Consensus       911 ~~A~~~l~~al~~~~~l~~~p~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~-~~~~~~la~~~~~~g~~~~A~~~  989 (1278)
                      ++|+..|++++      ..+|++..++..++.++...|++++|+..|++++...|+ ..+|..++.++...|++++|+..
T Consensus       118 ~~A~~~~~~al------~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~  191 (388)
T 1w3b_A          118 EGAVQAYVSAL------QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHH  191 (388)
T ss_dssp             SHHHHHHHHHH------HHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHH
T ss_pred             HHHHHHHHHHH------HhCCCcHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHH
Confidence            66666666665      556666666666666666666777777777777666664 56677777777777777777777


Q ss_pred             HHHHHHhCCChHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCH
Q psy3224         990 LDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNCA 1069 (1278)
Q Consensus       990 l~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~l~~~~g~~~~A~~~l~kal~~~p~~~ 1069 (1278)
                      |++++..+|++..++..+|.++...|++++|+..|.+++...|+++.++..++.++...|++++|+..|++++..+|+++
T Consensus       192 ~~~al~~~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~  271 (388)
T 1w3b_A          192 FEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFP  271 (388)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCH
T ss_pred             HHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCH
Confidence            77777777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHHHCCCcHHHHHHHHhccCCCCChhHHHHHHHHhccCcchhhhhhhhhhhhccc
Q psy3224        1070 ELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENKN 1149 (1278)
Q Consensus      1070 ~~~~~l~~~~~~~g~~~~A~~~~~kal~~~P~~~~~~~~~~~~~~~~~~~~~A~~~l~k~~~~p~~~~~~~~l~~~~~~~ 1149 (1278)
                      .+|..++.++...|++++|+..|+++++.+|++..+|..++.++...|++++|+..++++.                   
T Consensus       272 ~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al-------------------  332 (388)
T 1w3b_A          272 DAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKAL-------------------  332 (388)
T ss_dssp             HHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHT-------------------
T ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHH-------------------
Confidence            7777777777777777777777777777777777777777777777777777777776552                   


Q ss_pred             ccccccCccccccccchhhhhhhhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCChhHHHHHHHHHHHhCC
Q psy3224        1150 QKCHRSGSRRCMGVKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGT 1227 (1278)
Q Consensus      1150 ~~A~~~~~~~~~~~~~~a~~~l~~~p~~~~~l~~lg~~~~~~g~~~~A~~~~~kal~~~P~~~d~~~~l~~~~~~~G~ 1227 (1278)
                                            +..|+++.++..+|.+|...|++++|+.+|+++++++|+++++|..++.++..+|+
T Consensus       333 ----------------------~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          333 ----------------------EVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             ----------------------TSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             ----------------------hcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHhHHHHHHHccC
Confidence                                  12344555888899999999999999999999999999999999999998887764

PyMOL of 1w3b

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A	Back alignment and structure

>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A	Back alignment and structure

>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A*	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A*	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae}	Back alignment and structure

>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A	Back alignment and structure

>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A	Back alignment and structure

>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1	Back alignment and structure

>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N	Back alignment and structure

>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A	Back alignment and structure

>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens}	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi}	Back alignment and structure

>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens}	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1	Back alignment and structure

>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A*	Back alignment and structure

>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi}	Back alignment and structure

>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae}	Back alignment and structure

>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A*	Back alignment and structure

>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-}	Back alignment and structure

>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-}	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae}	Back alignment and structure

>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N	Back alignment and structure

>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1278
d2onda1		308	a.118.8.7 (A:242-549) Cleavage stimulation factor	4e-18
d2onda1		308	a.118.8.7 (A:242-549) Cleavage stimulation factor	6e-17
d2onda1		308	a.118.8.7 (A:242-549) Cleavage stimulation factor	6e-15
d2onda1		308	a.118.8.7 (A:242-549) Cleavage stimulation factor	2e-14
d2onda1		308	a.118.8.7 (A:242-549) Cleavage stimulation factor	4e-11
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	3e-16
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	2e-15
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	1e-12
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	2e-12
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	4e-12
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	1e-07
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	3e-07
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	2e-06
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	5e-04
d1w3ba_		388	a.118.8.1 (A:) O-GlcNAc transferase p110 subunit,	5e-04
d1zbpa1		264	e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V	1e-10
d1zbpa1		264	e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V	3e-05
d1zbpa1		264	e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V	5e-05
d1zbpa1		264	e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V	4e-04
d1zbpa1		264	e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V	8e-04
d1ya0a1		497	a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T	8e-09
d1ya0a1		497	a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T	4e-04
d1xnfa_		259	a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli	3e-06
d1fcha_		323	a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting	4e-06
d1fcha_		323	a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting	1e-04
d2h6fa1		315	a.118.6.1 (A:55-369) Protein farnesyltransferase a	4e-06
d2h6fa1		315	a.118.6.1 (A:55-369) Protein farnesyltransferase a	6e-06
d1dcea1		334	a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr	2e-05
d1dcea1		334	a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr	3e-04
d1hz4a_		366	a.118.8.2 (A:) Transcription factor MalT domain II	3e-05
d2c2la1		201	a.118.8.1 (A:24-224) STIP1 homology and U box-cont	8e-05
d1nzna_		122	a.118.8.1 (A:) Mitochondria fission protein Fis1 {	0.002

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308	Back information, alignment and structure


class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 84.6 bits (208), Expect = 4e-18
 Identities = 38/289 (13%), Positives = 82/289 (28%), Gaps = 40/289 (13%)

Query: 828  IWLRAAYFEKNHGTRESLETLLQ--------KAVAHCPKSEVLWLMGAKSKWLAGDVPAA 879
            +W +   +EK++  R   +TL+         + +        +W   A+    +  + A 
Sbjct: 10   MWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAE 69

Query: 880  RGILSLAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARAQAGAFQANPNSEEIWLA 939
            +G +               A +  +   N YERA   L               +  ++ A
Sbjct: 70   KGDM-------------NNAKLFSDEAANIYERAISTL------------LKKNMLLYFA 104

Query: 940  AVKLESENNEYERARRLLAKARA--SAPTPRVMIQSAKLEWCLDNLERALQLLDEAIKVF 997
                E    +YE+   +  +  A        V IQ  K     + ++    +  +A +  
Sbjct: 105  YADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDA 164

Query: 998  PDFAKLWMMKGQIEEQKNL-LDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARS 1056
                 +++    +E   +     A   F   +KK        +   +           R 
Sbjct: 165  RTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRV 224

Query: 1057 VLEKGRLRNP----NCAELWLAAIRVEIRAGLKDIANTMMAKALQECPN 1101
            + E+             E+W   +  E   G       +  +       
Sbjct: 225  LFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFRE 273

PyMOL of d2onda1

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1278
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	100.0
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	100.0
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.89
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.88
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	99.78
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	99.75
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	99.75
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	99.74
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	99.72
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	99.68
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	99.68
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	99.64
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.64
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.61
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.32
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.3
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.28
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	99.27
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	99.24
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.22
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	99.21
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	99.21
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	99.17
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	99.17
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	99.16
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	99.06
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	99.04
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.04
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.02
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	99.02
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	98.99
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	98.95
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	98.95
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	98.93
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	98.93
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	98.93
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	98.93
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	98.91
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.87
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	98.87
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	98.86
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	98.86
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	98.83
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.79
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	98.44
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	98.4
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	98.4
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	98.3
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	98.21
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	98.15
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	97.97
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	97.95
d1qsaa1		450	70 KDa soluble lytic transglycosylase (SLT70), sup	97.77
d1qsaa1		450	70 KDa soluble lytic transglycosylase (SLT70), sup	97.75
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	97.22
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	97.07
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	96.97
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	96.86
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	96.84
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	96.84

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.8e-32  Score=317.62  Aligned_cols=385  Identities=14%  Similarity=0.125  Sum_probs=306.1

Q ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCchHHHHHhhcccchHHHH
Q psy3224         750 MEDAESCANQGAYECARAIYAQALATFPSKKSIWLRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSNKKSIW  829 (1278)
Q Consensus       750 ~~la~~~~~~g~~~~A~~~~~~al~~~P~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~~~~~~~~~~~  829 (1278)
                      +.+|..+.+.|++++|+.+|+++++.+|++..+|..++.++...|++++                               
T Consensus         3 l~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~-------------------------------   51 (388)
T d1w3ba_           3 MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDR-------------------------------   51 (388)
T ss_dssp             CTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHH-------------------------------
T ss_pred             HHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHH-------------------------------
Confidence            3578888899999999999999999999999999999988888888877                               


Q ss_pred             HHHHHHHHhcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCc
Q psy3224         830 LRAAYFEKNHGTRESLETLLQKAVAHCPKSEVLWLMGAKSKWLAGDVPAARGILSLAFQANPNSEEIWLAAVKLESENNE  909 (1278)
Q Consensus       830 l~~a~l~~~~g~~~~A~~~~~~al~~~P~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~~~~~~~~la~l~~~~g~  909 (1278)
                                     |+..|+++++.+|++..+|..+|.++...|++++|+..+..++...|.....+............
T Consensus        52 ---------------A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  116 (388)
T d1w3ba_          52 ---------------SAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGD  116 (388)
T ss_dssp             ---------------HHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSC
T ss_pred             ---------------HHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccccccccccccccccccccccccccccccccc
Confidence                           55555556666666666677777777777777777777777777777766666666666666666


Q ss_pred             HHHHHHHHHHHHHhhhhhhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-HHHHHHHHHHHHHcCCHHHHHH
Q psy3224         910 YERARRLLAKARAQAGAFQANPNSEEIWLAAVKLESENNEYERARRLLAKARASAPT-PRVMIQSAKLEWCLDNLERALQ  988 (1278)
Q Consensus       910 ~~~A~~~l~~al~~~~~l~~~p~~~~~~~~la~~~~~~g~~~~A~~~l~~al~~~p~-~~~~~~la~~~~~~g~~~~A~~  988 (1278)
                      ...+........      ...+................+....+...+.+.+...|+ ...+..++.++...|++++|..
T Consensus       117 ~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~  190 (388)
T d1w3ba_         117 MEGAVQAYVSAL------QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIH  190 (388)
T ss_dssp             SSHHHHHHHHHH------HHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHH
T ss_pred             cccccccccccc------ccccccccccccccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHH
Confidence            666655555554      555666666666666666777777777777777777775 5777777777778888888888


Q ss_pred             HHHHHHHhCCChHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC
Q psy3224         989 LLDEAIKVFPDFAKLWMMKGQIEEQKNLLDKAHDTFSQAIKKCPHSVPLWIMLANLEERRKMLIKARSVLEKGRLRNPNC 1068 (1278)
Q Consensus       989 ~l~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~l~~~~g~~~~A~~~l~kal~~~p~~ 1068 (1278)
                      .++++++.+|+++.+|..+|.++...|++++|+..|.+++...|.+...+..+|.++...|++++|+..|+++++++|++
T Consensus       191 ~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~  270 (388)
T d1w3ba_         191 HFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHF  270 (388)
T ss_dssp             HHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSC
T ss_pred             HHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCC
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHHCCCcHHHHHHHHhccCCCCChhHHHHHHHHhccCcchhhhhhhhhhhhcc
Q psy3224        1069 AELWLAAIRVEIRAGLKDIANTMMAKALQECPNAGILWAEAIFLEPRPQRKTKSVDALKKCEHDPHVLLAVSKLFWCENK 1148 (1278)
Q Consensus      1069 ~~~~~~l~~~~~~~g~~~~A~~~~~kal~~~P~~~~~~~~~~~~~~~~~~~~~A~~~l~k~~~~p~~~~~~~~l~~~~~~ 1148 (1278)
                      +.+|..++.++...|++++|+..+.+++...|.+...+..++.++...|++++|+..|+++                   
T Consensus       271 ~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~a-------------------  331 (388)
T d1w3ba_         271 PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKA-------------------  331 (388)
T ss_dssp             HHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHH-------------------
T ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHHHHHHHHHHH-------------------
Confidence            8888888888888888888888888888888888888888888888888888888877765                   


Q ss_pred             cccccccCccccccccchhhhhhhhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCChhHHHHHHHHHHHhCC
Q psy3224        1149 NQKCHRSGSRRCMGVKTKSVDALKKCEHDPHVLLAVSKLFWCENKNQKCREWFNRTVKIDPDLGDAWAYFYKFEIINGT 1227 (1278)
Q Consensus      1149 ~~~A~~~~~~~~~~~~~~a~~~l~~~p~~~~~l~~lg~~~~~~g~~~~A~~~~~kal~~~P~~~d~~~~l~~~~~~~G~ 1227 (1278)
                                            ++.+|+++.+++.+|.+|...|++++|+.+|+++++++|+++++|.+++.++.++|+
T Consensus       332 ----------------------l~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         332 ----------------------LEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             ----------------------TTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             ----------------------HHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence                                  123455666889999999999999999999999999999999999999999998886

PyMOL of d1w3ba_

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure