Psyllid ID: psy3611


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470--
MLAAVFKKLKTLEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHMSLKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDE
cHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHcccccHHccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHHHHHccccccccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHcccccEEEccccc
cHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHcccccEEEEccccc
MLAAVFKKLKTLEhvempqngiyhVGITALSDAFEENKKLrhlnlndntitykgaiplgqalsklpslAILNLGDCLLKSAGASSIAkyltdnttledvnLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVleddegecsdeeqdeeseeendsdaegdnsnlshndsnhshnasnqshnnsnqshntsnqshmslkTGARLVeldlsdnafgpigVEGLADLLRSSCCFALEElklnnnglgitGCKLLSKALHDCyesskkegspLALKVFIAGRNRLENEGAKMLAAVFKKLKTLErvempqngiyhVGITALSDAFEenknlrhlnlndntitykgaiplgqalsklpslAILNLGDCLLKSAGASSIAkyltdnttledvnLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDE
MLAAVFKKLKTLehvempqngiYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTklkqinvsenqfgEEGVEEMEKLMKSFGMAAALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHMSLKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYEsskkegsplALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTklkqinvsenqfgEEGVEEMEKLMKSFGMAAALVLEDDE
MLAAVFKKLKTLEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLeddegecsdeeqdeeseeendsdaegdnsnlshndsnhshnasnqshnnsnqshntsnqshmsLKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFAleelklnnnglgITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDE
****VFKKLKTLEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKN*********************************************************************************************************RLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYES*****SPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMK******************************************
MLAAVFKKLKTLEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHMSLKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDD*
MLAAVFKKLKTLEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLED**************************SNLSHN****************************SLKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDC********SPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDE
MLAAVFKKLKTLEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHMSLKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLE***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAAVFKKLKTLEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVxxxxxxxxxxxxxxxxxxxxxDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHMSLKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDDE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query472 2.2.26 [Sep-21-2011]
O13066 580 Ran GTPase-activating pro N/A N/A 0.514 0.418 0.491 7e-63
P46060 587 Ran GTPase-activating pro yes N/A 0.521 0.419 0.506 3e-62
P46061 589 Ran GTPase-activating pro yes N/A 0.521 0.417 0.497 9e-61
Q9VIW3 596 Ran GTPase-activating pro yes N/A 0.514 0.407 0.483 2e-54
P34342 960 Ran GTPase-activating pro yes N/A 0.480 0.236 0.459 1e-44
P41391386 Ran GTPase-activating pro yes N/A 0.485 0.593 0.353 1e-24
P11745407 Ran GTPase-activating pro yes N/A 0.362 0.420 0.389 6e-18
Q5DU56 1064 Protein NLRC3 OS=Mus musc no N/A 0.508 0.225 0.289 8e-16
Q7RTR21065 Protein NLRC3 OS=Homo sap no N/A 0.824 0.365 0.243 1e-15
C3VPR6 1915 Protein NLRC5 OS=Mus musc no N/A 0.940 0.231 0.230 8e-15
>sp|O13066|RAGP1_XENLA Ran GTPase-activating protein 1 OS=Xenopus laevis GN=rangap1 PE=2 SV=1 Back     alignment and function desciption
 Score =  241 bits (616), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 173/244 (70%), Gaps = 1/244 (0%)

Query: 221 LKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALH 280
           +  GA+L ELDLSDNAFGP GV G   LL+S  CF L+ELKLNN G+GI G K+L+ AL 
Sbjct: 108 ITAGAQLTELDLSDNAFGPDGVRGFEALLKSPTCFTLQELKLNNCGMGIGGGKILAAALT 167

Query: 281 DCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITA 340
           +C++ S   G PLALKVFIAGRNRLEN+GA  L+  F+ + TLE V MPQNGI H GITA
Sbjct: 168 ECHKKSSAHGKPLALKVFIAGRNRLENDGATALSEAFRLIGTLEEVHMPQNGINHAGITA 227

Query: 341 LSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKY 400
           L+++F+ N  L+ +NLNDNT T KG + + +AL  L  + ++N GDCL++S GA +IA  
Sbjct: 228 LAESFKANSLLKVINLNDNTFTEKGGVAMAEALKTLRQVEVINFGDCLVRSKGAQAIASA 287

Query: 401 LTDNT-TLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKS 459
           L +    L+D+NL+  EI     + L +++++K+ L++++++ N  GEEG E+++++++S
Sbjct: 288 LKEGLHKLKDLNLSYCEIKADAAVSLAESVEDKSDLEKLDLNGNCLGEEGCEQVQEILES 347

Query: 460 FGMA 463
             MA
Sbjct: 348 INMA 351




GTPase activator for the nuclear Ras-related regulatory protein Ran, converting it to the putatively inactive GDP-bound state.
Xenopus laevis (taxid: 8355)
>sp|P46060|RAGP1_HUMAN Ran GTPase-activating protein 1 OS=Homo sapiens GN=RANGAP1 PE=1 SV=1 Back     alignment and function description
>sp|P46061|RAGP1_MOUSE Ran GTPase-activating protein 1 OS=Mus musculus GN=Rangap1 PE=1 SV=2 Back     alignment and function description
>sp|Q9VIW3|RAGP1_DROME Ran GTPase-activating protein OS=Drosophila melanogaster GN=RanGap PE=1 SV=1 Back     alignment and function description
>sp|P34342|RGP2_CAEEL Ran GTPase-activating protein 2 OS=Caenorhabditis elegans GN=ran-2 PE=4 SV=3 Back     alignment and function description
>sp|P41391|RNA1_SCHPO Ran GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rna1 PE=1 SV=1 Back     alignment and function description
>sp|P11745|RNA1_YEAST Ran GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA1 PE=1 SV=2 Back     alignment and function description
>sp|Q5DU56|NLRC3_MOUSE Protein NLRC3 OS=Mus musculus GN=Nlrc3 PE=2 SV=2 Back     alignment and function description
>sp|Q7RTR2|NLRC3_HUMAN Protein NLRC3 OS=Homo sapiens GN=NLRC3 PE=2 SV=2 Back     alignment and function description
>sp|C3VPR6|NLRC5_MOUSE Protein NLRC5 OS=Mus musculus GN=Nlrc5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query472
91078814534 PREDICTED: similar to ran gtpase-activat 0.504 0.445 0.665 3e-81
322796742553 hypothetical protein SINV_13014 [Solenop 0.514 0.439 0.565 3e-68
405976660517 Ran GTPase-activating protein 1 [Crassos 0.533 0.487 0.543 9e-67
332019511 583 Ran GTPase-activating protein 1 [Acromyr 0.493 0.399 0.572 1e-66
158296865 598 AGAP008267-PA [Anopheles gambiae str. PE 0.531 0.419 0.547 9e-66
156555416 587 PREDICTED: ran GTPase-activating protein 0.478 0.385 0.586 2e-65
427785591570 Putative ran gtpase activating protein 1 0.512 0.424 0.551 2e-64
296486973 585 TPA: chondroadherin-like [Bos taurus] 0.521 0.420 0.506 4e-63
158519829 585 ran GTPase-activating protein 1 [Bos tau 0.521 0.420 0.506 5e-63
440893622 640 Ran GTPase-activating protein 1, partial 0.521 0.384 0.506 5e-63
>gi|91078814|ref|XP_970649.1| PREDICTED: similar to ran gtpase-activating protein [Tribolium castaneum] gi|270003723|gb|EFA00171.1| hypothetical protein TcasGA2_TC002993 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  308 bits (790), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 159/239 (66%), Positives = 189/239 (79%), Gaps = 1/239 (0%)

Query: 224 GARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCY 283
           GARL ELD+SDNAFGPIGVEGLA LLRSS C+ALEEL+LNNNGLGITG KLL+ AL DCY
Sbjct: 111 GARLTELDMSDNAFGPIGVEGLAALLRSSSCYALEELRLNNNGLGITGGKLLASALTDCY 170

Query: 284 ESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSD 343
            SSK+ G PL LKVFIAGRNRLENEGAK LA VFK + TLE + MPQNGIYHVGI+ALS+
Sbjct: 171 NSSKETGKPLQLKVFIAGRNRLENEGAKALAEVFKMIGTLEEIAMPQNGIYHVGISALSE 230

Query: 344 AFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYL-T 402
           AF +NKNL+ LNLNDNTI  KGA  + +AL  L  L  +N GDCLLK+AGA S+A  L T
Sbjct: 231 AFTQNKNLQILNLNDNTIGEKGAEAIAKALPHLQQLKEINFGDCLLKTAGAISLANVLKT 290

Query: 403 DNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFG 461
            +  LE++ L  NEI ++GGL LVKAM NK+KLK +N++ NQFGE+G +++E  +K  G
Sbjct: 291 GHANLEELTLGHNEIRLKGGLQLVKAMANKSKLKVLNLNGNQFGEDGRKQIETEIKQIG 349




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322796742|gb|EFZ19175.1| hypothetical protein SINV_13014 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|405976660|gb|EKC41159.1| Ran GTPase-activating protein 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|332019511|gb|EGI59990.1| Ran GTPase-activating protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|158296865|ref|XP_001689011.1| AGAP008267-PA [Anopheles gambiae str. PEST] gi|157014917|gb|EDO63574.1| AGAP008267-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|156555416|ref|XP_001605648.1| PREDICTED: ran GTPase-activating protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|427785591|gb|JAA58247.1| Putative ran gtpase activating protein 1 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|296486973|tpg|DAA29086.1| TPA: chondroadherin-like [Bos taurus] Back     alignment and taxonomy information
>gi|158519829|ref|NP_001103559.1| ran GTPase-activating protein 1 [Bos taurus] gi|158262606|gb|AAI54379.1| Ran GTPase activating protein 1 [Bos taurus] Back     alignment and taxonomy information
>gi|440893622|gb|ELR46319.1| Ran GTPase-activating protein 1, partial [Bos grunniens mutus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query472
UNIPROTKB|P46060 587 RANGAP1 "Ran GTPase-activating 0.533 0.429 0.472 3.3e-61
UNIPROTKB|F1MFD5 585 RANGAP1 "Uncharacterized prote 0.533 0.430 0.472 5.4e-61
UNIPROTKB|F1NIE8 579 RANGAP1 "Uncharacterized prote 0.533 0.435 0.456 4.2e-59
UNIPROTKB|F1PVY6 628 RANGAP1 "Uncharacterized prote 0.533 0.401 0.460 8.8e-59
UNIPROTKB|J9NZ28 641 RANGAP1 "Uncharacterized prote 0.533 0.393 0.460 8.8e-59
UNIPROTKB|O13066 580 rangap1 "Ran GTPase-activating 0.533 0.434 0.456 1.8e-58
MGI|MGI:103071 589 Rangap1 "RAN GTPase activating 0.533 0.427 0.464 1.8e-58
RGD|1310380431 Rangap1 "RAN GTPase activating 0.533 0.584 0.456 3.8e-58
UNIPROTKB|F1MAA5 586 Rangap1 "Protein Rangap1" [Rat 0.533 0.430 0.452 4.2e-57
ZFIN|ZDB-GENE-060929-492 570 rangap1a "RAN GTPase activatin 0.527 0.436 0.446 3.8e-56
UNIPROTKB|P46060 RANGAP1 "Ran GTPase-activating protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 580 (209.2 bits), Expect = 3.3e-61, Sum P(2) = 3.3e-61
 Identities = 120/254 (47%), Positives = 166/254 (65%)

Query:   221 LKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFAXXXXXXXXXXXXITGCKLLSKALH 280
             +  GA+LVELDLSDNAFGP GV+G   LL+SS CF             I G K+L+ AL 
Sbjct:   108 ITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALT 167

Query:   281 DCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITA 340
             +C+  S  +G PLALKVF+AGRNRLEN+GA  LA  F+ + TLE V MPQNGI H GITA
Sbjct:   168 ECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITA 227

Query:   341 LSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKY 400
             L+ AF  N  LR +NLNDNT T KGA+ + + L  L  + ++N GDCL++S GA +IA  
Sbjct:   228 LAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADA 287

Query:   401 LTDNTT-LEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKS 459
             +      L+++NL+  EI     L + +AM +K +L++++++ N  GEEG E+++++++ 
Sbjct:   288 IRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEG 347

Query:   460 FGMAAALV-LEDDE 472
             F MA  L  L DDE
Sbjct:   348 FNMAKVLASLSDDE 361


GO:0005098 "Ran GTPase activator activity" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0048471 "perinuclear region of cytoplasm" evidence=IEA
GO:0000777 "condensed chromosome kinetochore" evidence=IEA
GO:0000922 "spindle pole" evidence=IEA
GO:0031965 "nuclear membrane" evidence=IEA
GO:0000776 "kinetochore" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005643 "nuclear pore" evidence=TAS
GO:0005737 "cytoplasm" evidence=TAS
GO:0000087 "M phase of mitotic cell cycle" evidence=TAS
GO:0000236 "mitotic prometaphase" evidence=TAS
GO:0000278 "mitotic cell cycle" evidence=TAS
GO:0005829 "cytosol" evidence=TAS
GO:0046826 "negative regulation of protein export from nucleus" evidence=IDA
GO:0032853 "positive regulation of Ran GTPase activity" evidence=TAS
UNIPROTKB|F1MFD5 RANGAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIE8 RANGAP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PVY6 RANGAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ28 RANGAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O13066 rangap1 "Ran GTPase-activating protein 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:103071 Rangap1 "RAN GTPase activating protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310380 Rangap1 "RAN GTPase activating protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAA5 Rangap1 "Protein Rangap1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-492 rangap1a "RAN GTPase activating protein 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46060RAGP1_HUMANNo assigned EC number0.50600.52110.4190yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-52
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-26
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 3e-25
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-13
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-12
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-11
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-11
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 5e-10
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
COG5238 388 COG5238, RNA1, Ran GTPase-activating protein (RanG 2e-04
cd00116 319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-04
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 0.002
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
 Score =  179 bits (457), Expect = 1e-52
 Identities = 103/256 (40%), Positives = 149/256 (58%), Gaps = 14/256 (5%)

Query: 219 MSLKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKA 278
             L  G  L ELDLSDNA GP G   L  LLRSS   +L+ELKLNNNGLG  G +LL+K 
Sbjct: 75  QGLTKGCGLQELDLSDNALGPDGCGVLESLLRSS---SLQELKLNNNGLGDRGLRLLAKG 131

Query: 279 LHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGI 338
           L D          P AL+  + GRNRLE    + LA   +  + L+ + +  NGI   GI
Sbjct: 132 LKDL---------PPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLANNGIGDAGI 182

Query: 339 TALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIA 398
            AL++  + N NL  L+LN+N +T +GA  L + L+ L SL +LNLGD  L  AGA+++A
Sbjct: 183 RALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTDAGAAALA 242

Query: 399 K-YLTDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLM 457
              L+ N +L  ++L+CN+I+  G  DL + +  K  L ++++  N+FGEEG + + + +
Sbjct: 243 SALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGNKFGEEGAQLLAESL 302

Query: 458 KSFG-MAAALVLEDDE 472
              G    +L ++DD 
Sbjct: 303 LEPGNELESLWVKDDS 318


LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1). Length = 319

>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 472
KOG1909|consensus382 99.97
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.96
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
KOG1909|consensus382 99.93
KOG4194|consensus 873 99.91
KOG4194|consensus 873 99.91
KOG0444|consensus 1255 99.88
KOG0444|consensus 1255 99.85
KOG0618|consensus 1081 99.82
KOG0472|consensus565 99.79
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.78
KOG4308|consensus478 99.76
KOG0472|consensus565 99.71
KOG4308|consensus478 99.7
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.67
KOG0618|consensus 1081 99.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.61
KOG4341|consensus483 99.55
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.52
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.52
KOG4341|consensus483 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.46
KOG4237|consensus498 99.43
KOG4237|consensus498 99.23
KOG3207|consensus505 99.23
KOG2120|consensus419 99.22
KOG2120|consensus419 99.21
KOG3207|consensus505 99.12
KOG0617|consensus264 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
KOG0617|consensus264 98.95
KOG1259|consensus490 98.89
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
KOG1259|consensus490 98.69
KOG2982|consensus418 98.58
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.46
KOG1947|consensus482 98.42
KOG2982|consensus418 98.41
KOG3665|consensus 699 98.35
KOG1859|consensus 1096 98.33
PLN03150623 hypothetical protein; Provisional 98.23
KOG1947|consensus482 98.18
KOG3665|consensus 699 98.17
KOG1859|consensus 1096 98.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.13
KOG0531|consensus414 98.13
KOG0532|consensus 722 98.09
KOG0532|consensus 722 98.08
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.03
PLN03150623 hypothetical protein; Provisional 98.01
KOG0531|consensus414 98.01
KOG4658|consensus889 97.94
KOG4658|consensus889 97.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.86
KOG4242|consensus553 97.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.33
KOG4579|consensus177 97.31
KOG4579|consensus177 97.31
KOG1644|consensus233 97.3
KOG2123|consensus 388 97.2
KOG4242|consensus553 97.1
KOG2123|consensus388 96.86
PRK15386 426 type III secretion protein GogB; Provisional 96.35
KOG3735|consensus353 96.26
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 96.19
KOG1644|consensus233 96.09
KOG3735|consensus353 96.05
KOG2739|consensus260 95.95
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 95.86
KOG2739|consensus260 95.78
KOG3864|consensus221 95.77
KOG3864|consensus221 95.58
PRK15386 426 type III secretion protein GogB; Provisional 95.53
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.36
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.88
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 91.83
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 90.85
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 86.38
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 85.89
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 85.54
KOG3763|consensus 585 82.93
>KOG1909|consensus Back     alignment and domain information
Probab=99.97  E-value=1.5e-29  Score=227.84  Aligned_cols=299  Identities=39%  Similarity=0.587  Sum_probs=248.6

Q ss_pred             HHHHhhhCCCccEEEecCCcCChhhHHHHHHHHHhchhhH-HhhhccCCCCCCccccchhhhcccCCccccCCCccCCCC
Q psy3611         114 LVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAA-ALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSHND  192 (472)
Q Consensus       114 l~~~l~~~~~L~~L~l~~~~i~~~~~~~l~~~l~~~~~l~-~L~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~  192 (472)
                      +...+....+++.+++++|.++.+....+++.++..+.|+ ..+-+.+.++...++|.                      
T Consensus        22 v~~~~~~~~s~~~l~lsgnt~G~EAa~~i~~~L~~~~~L~~v~~sd~ftGR~~~Ei~e----------------------   79 (382)
T KOG1909|consen   22 VEEELEPMDSLTKLDLSGNTFGTEAARAIAKVLASKKELREVNLSDMFTGRLKDEIPE----------------------   79 (382)
T ss_pred             HHHHhcccCceEEEeccCCchhHHHHHHHHHHHhhcccceeeehHhhhcCCcHHHHHH----------------------
Confidence            3444444455555555555555555555555555555442 23334445555555554                      


Q ss_pred             CCCcccccccccCCCCcccccchhhhhhhhcCCcccEEeCCCCCCChhhHHHHHHHHhccCCCcceEEEeeCCCCChhHH
Q psy3611         193 SNHSHNASNQSHNNSNQSHNTSNQSHMSLKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLGITGC  272 (472)
Q Consensus       193 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~l~~~~~~~L~~L~l~~~~i~~~~~  272 (472)
                                         ....+ ...+..++.|++|+||.|.+++.++..+..++++  |..|++|.|.+|.+++.+.
T Consensus        80 -------------------~L~~l-~~aL~~~~~L~~ldLSDNA~G~~g~~~l~~ll~s--~~~L~eL~L~N~Glg~~ag  137 (382)
T KOG1909|consen   80 -------------------ALKML-SKALLGCPKLQKLDLSDNAFGPKGIRGLEELLSS--CTDLEELYLNNCGLGPEAG  137 (382)
T ss_pred             -------------------HHHHH-HHHHhcCCceeEeeccccccCccchHHHHHHHHh--ccCHHHHhhhcCCCChhHH
Confidence                               22223 3335566799999999999999999999999975  6799999999999999999


Q ss_pred             HHHHHHHHhhcccCcCCCCCcceeEEEcCCCCCChhhHHHHHHHHhcCCCccEEeCCCCCCChhHHHHHHHHHhcCCCcc
Q psy3611         273 KLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALSDAFEENKNLR  352 (472)
Q Consensus       273 ~~l~~~l~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~~~~~~~L~~L~l~~~~i~~~~~~~l~~~l~~~~~L~  352 (472)
                      ..+++++..+. ...+.+..+.|+.+...+|++.+.|+..+...+...++|+.+.++.|.|...|+..+..++..+++|+
T Consensus       138 ~~l~~al~~l~-~~kk~~~~~~Lrv~i~~rNrlen~ga~~~A~~~~~~~~leevr~~qN~I~~eG~~al~eal~~~~~Le  216 (382)
T KOG1909|consen  138 GRLGRALFELA-VNKKAASKPKLRVFICGRNRLENGGATALAEAFQSHPTLEEVRLSQNGIRPEGVTALAEALEHCPHLE  216 (382)
T ss_pred             HHHHHHHHHHH-HHhccCCCcceEEEEeeccccccccHHHHHHHHHhccccceEEEecccccCchhHHHHHHHHhCCcce
Confidence            99999988887 56788899999999999999999999999999999999999999999999999989999999999999


Q ss_pred             EEEccCCCCCcccHHHHHHHhcCCCCCcEEEcCCCCCChHHHHHHHHHhhc-CCCCCEEECcCCCCCchhHHHHHHHHhc
Q psy3611         353 HLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTD-NTTLEDVNLTCNEISVQGGLDLVKAMKN  431 (472)
Q Consensus       353 ~L~l~~n~l~~~~~~~l~~~l~~~~~L~~L~l~~~~i~~~~~~~l~~~l~~-~~~L~~L~L~~n~i~~~~~~~l~~~l~~  431 (472)
                      .|||.+|.++.+|...+++.++.+++|+.|++++|.+.+.|+..+..++.. ++.|+.+.+.+|.|+.+++..+..++..
T Consensus       217 vLdl~DNtft~egs~~LakaL~s~~~L~El~l~dcll~~~Ga~a~~~al~~~~p~L~vl~l~gNeIt~da~~~la~~~~e  296 (382)
T KOG1909|consen  217 VLDLRDNTFTLEGSVALAKALSSWPHLRELNLGDCLLENEGAIAFVDALKESAPSLEVLELAGNEITRDAALALAACMAE  296 (382)
T ss_pred             eeecccchhhhHHHHHHHHHhcccchheeecccccccccccHHHHHHHHhccCCCCceeccCcchhHHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999999999888864 5999999999999999999999999999


Q ss_pred             CCcccEEEccCCCC--ChhHHHHHHHHH
Q psy3611         432 KTKLKQINVSENQF--GEEGVEEMEKLM  457 (472)
Q Consensus       432 ~~~L~~L~l~~n~i--~~~~~~~l~~~l  457 (472)
                      .+.|+.|++++|.+  .+.++..+...+
T Consensus       297 k~dL~kLnLngN~l~e~de~i~ei~~~~  324 (382)
T KOG1909|consen  297 KPDLEKLNLNGNRLGEKDEGIDEIASKF  324 (382)
T ss_pred             chhhHHhcCCcccccccchhHHHHHHhc
Confidence            99999999999999  667777666655



>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4242|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG4242|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3735|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG3735|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
1k5d_C386 Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Compl 9e-20
1yrg_A385 The Crystal Structure Of Rna1p: A New Fold For A Gt 1e-19
>pdb|1K5D|C Chain C, Crystal Structure Of Ran-Gppnhp-Ranbp1-Rangap Complex Length = 386 Back     alignment and structure

Iteration: 1

Score = 94.7 bits (234), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 80/246 (32%), Positives = 119/246 (48%), Gaps = 17/246 (6%) Query: 226 RLVELDLSDNAFGPIGVEGLADLLRSSCCFAXXXXXXXXXXXXITGCKLLSKALHDCYES 285 +L + LSDNAFGP E L D L G K+ ++AL + + Sbjct: 95 KLHTVRLSDNAFGPTAQEPLIDFLSKHTPLEHLYLHNNGLGPQ-AGAKI-ARALQELAVN 152 Query: 286 SKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEMPQNGIYHVGITALS-DA 344 K + +P L+ I GRNRLEN K A F+ + L V+M QNGI GI L + Sbjct: 153 KKAKNAP-PLRSIICGRNRLENGSMKEWAKTFQSHRLLHTVKMVQNGIRPEGIEHLLLEG 211 Query: 345 FEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLT-- 402 + L+ L+L DNT T+ G+ L AL P+L L L DCLL + GA+++ + Sbjct: 212 LAYCQELKVLDLQDNTFTHLGSSALAIALKSWPNLRELGLNDCLLSARGAAAVVDAFSKL 271 Query: 403 DNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQ-----INVSENQFGEEG--VEEMEK 455 +N L+ + L NEI LD V+ +K K + ++ N+F EE V+E+ + Sbjct: 272 ENIGLQTLRLQYNEIE----LDAVRTLKTVIDEKMPDLLFLELNGNRFSEEDDVVDEIRE 327 Query: 456 LMKSFG 461 + + G Sbjct: 328 VFSTRG 333
>pdb|1YRG|A Chain A, The Crystal Structure Of Rna1p: A New Fold For A Gtpase- Activating Protein Length = 385 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-67
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-36
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-36
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-19
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-19
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-52
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-50
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-47
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-38
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-35
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-19
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-41
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-37
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-36
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-35
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-34
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-23
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-23
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-19
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-18
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-12
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-12
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-06
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 9e-21
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-20
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 4e-20
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 5e-18
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-17
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 9e-17
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-17
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 5e-17
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 3e-14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 3e-14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 3e-14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 4e-14
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 4e-08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 4e-08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-15
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-15
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-04
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 5e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-04
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
 Score =  218 bits (557), Expect = 9e-67
 Identities = 100/390 (25%), Positives = 160/390 (41%), Gaps = 58/390 (14%)

Query: 93  NTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMA 152
             ++E  +L  + I+ +    +   +     +K+I +S N  G E               
Sbjct: 3   RFSIEGKSLKLDAITTEDEKSVFAVLLEDDSVKEIVLSGNTIGTEAAR-----------W 51

Query: 153 AALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHN 212
            +  +                             +L           +  S   + +  +
Sbjct: 52  LSENIAS-------------------------KKDLEI---------AEFSDIFTGRVKD 77

Query: 213 TSNQSHMS----LKTGARLVELDLSDNAFGPIGVEGLADLLRSSCCFALEELKLNNNGLG 268
              ++       L    +L  + LSDNAFGP   E L D L       LE L L+NNGLG
Sbjct: 78  EIPEALRLLLQALLKCPKLHTVRLSDNAFGPTAQEPLIDFLSKHTP--LEHLYLHNNGLG 135

Query: 269 ITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVEM 328
                 +++AL +   + K + +P  L+  I GRNRLEN   K  A  F+  + L  V+M
Sbjct: 136 PQAGAKIARALQELAVNKKAKNAP-PLRSIICGRNRLENGSMKEWAKTFQSHRLLHTVKM 194

Query: 329 PQNGIYHVGIT-ALSDAFEENKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDC 387
            QNGI   GI   L +     + L+ L+L DNT T+ G+  L  AL   P+L  L L DC
Sbjct: 195 VQNGIRPEGIEHLLLEGLAYCQELKVLDLQDNTFTHLGSSALAIALKSWPNLRELGLNDC 254

Query: 388 LLKSAGASSIAKYLTD--NTTLEDVNLTCNEISVQGGLDLVKAMKNK-TKLKQINVSENQ 444
           LL + GA+++    +   N  L+ + L  NEI +     L   +  K   L  + ++ N+
Sbjct: 255 LLSARGAAAVVDAFSKLENIGLQTLRLQYNEIELDAVRTLKTVIDEKMPDLLFLELNGNR 314

Query: 445 FGEEG--VEEMEKLMKSFGMAAALVLEDDE 472
           F EE   V+E+ ++  + G      L+D E
Sbjct: 315 FSEEDDVVDEIREVFSTRGRGELDELDDME 344


>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query472
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.98
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.97
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.97
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.91
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.88
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.83
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.8
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.8
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.75
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.74
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.72
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.72
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.72
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.72
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.7
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.7
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 99.7
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.62
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.61
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.58
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.56
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.55
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.52
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.51
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.5
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.5
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.48
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.45
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.42
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.4
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.4
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.4
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.4
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.37
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.35
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.32
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.31
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.31
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.31
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.28
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.28
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.25
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.24
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.24
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.23
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.23
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.22
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.2
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.19
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.19
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.18
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.16
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.15
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.06
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.05
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.02
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.01
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.0
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.0
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.0
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.97
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.94
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.92
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.88
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.88
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.88
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.87
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.79
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.75
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.69
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.42
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.41
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.27
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.24
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.91
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 91.31
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.84
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.95
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.79
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
Probab=100.00  E-value=6.2e-40  Score=330.59  Aligned_cols=412  Identities=19%  Similarity=0.250  Sum_probs=343.3

Q ss_pred             HHHhhhcCCccEEeccCCCcchhhHHHHHHhhhcCCCCCeeeCCCCccCccchHHHHHHhccCC-CCcEEeccCccccch
Q psy3611           3 AAVFKKLKTLEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLP-SLAILNLGDCLLKSA   81 (472)
Q Consensus         3 ~~~~~~~~~L~~L~L~~~~l~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~l~~~~-~L~~L~ls~~~l~~~   81 (472)
                      .+.+..+++|++|++++|.+++.+...++..+..+++|++|++++|.+++.+...+...+.... +|++|++++|.+++.
T Consensus        21 ~~~~~~~~~L~~L~L~~~~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~~L~~L~L~~n~i~~~  100 (461)
T 1z7x_W           21 AELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGA  100 (461)
T ss_dssp             HHHHHHHTTCSEEEEESSCCCHHHHHHHHHHHHTCTTCCEEECTTCCCHHHHHHHHHHTTCSTTCCCCEEECTTSCCBGG
T ss_pred             HHHHhhcCCccEEEccCCCCCHHHHHHHHHHHHhCCCcCEEeCCCCcCChHHHHHHHHHHhhCCCceeEEEccCCCCCHH
Confidence            3568889999999999999998888889999999999999999999986555544444343332 799999999999998


Q ss_pred             hHHHHHHHhhcCCcccEEECcCCccCcchHHHHHHHhhh-CCCccEEEecCCcCChhhHHHHHHHHHhchhhHHhhhccC
Q psy3611          82 GASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKAMKN-KTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAALVLEDD  160 (472)
Q Consensus        82 ~~~~l~~~l~~~~~L~~L~l~~~~i~~~~~~~l~~~l~~-~~~L~~L~l~~~~i~~~~~~~l~~~l~~~~~l~~L~~~~~  160 (472)
                      ++..++..+..+++|++|++++|.+++.+...+...+.. .++|++|++++|.++...+..+...+..++.++.|.+...
T Consensus       101 ~~~~l~~~l~~~~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~L~~n  180 (461)
T 1z7x_W          101 GCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNN  180 (461)
T ss_dssp             GHHHHHHHTTSCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCTTCCEEECCSS
T ss_pred             HHHHHHHHHccCCceeEEECCCCcCchHHHHHHHHHHhcCCCcceEEECCCCCCCHHHHHHHHHHHhhCCCCCEEECcCC
Confidence            888899999999999999999999998777777766543 5689999999999999888888888888888877665432


Q ss_pred             CCCCCccccchhhhcccCCccccCCCccCCCCCCCcccccccccCCCCcccccchhhhhhhhcCCcccEEeCCCCCCChh
Q psy3611         161 EGECSDEEQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHMSLKTGARLVELDLSDNAFGPI  240 (472)
Q Consensus       161 ~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~  240 (472)
                      .-  .+.                                            ....+........+.|++|++++|.++..
T Consensus       181 ~i--~~~--------------------------------------------~~~~l~~~l~~~~~~L~~L~L~~n~l~~~  214 (461)
T 1z7x_W          181 DI--NEA--------------------------------------------GVRVLCQGLKDSPCQLEALKLESCGVTSD  214 (461)
T ss_dssp             BC--HHH--------------------------------------------HHHHHHHHHHHSCCCCCEEECTTSCCBTT
T ss_pred             Cc--chH--------------------------------------------HHHHHHHHHhcCCCCceEEEccCCCCcHH
Confidence            10  000                                            11122222223457999999999999888


Q ss_pred             hHHHHHHHHhccCCCcceEEEeeCCCCChhHHHHHHHHHHhhcccCcCCCCCcceeEEEcCCCCCChhhHHHHHHHHhcC
Q psy3611         241 GVEGLADLLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKL  320 (472)
Q Consensus       241 ~~~~l~~~l~~~~~~~L~~L~l~~~~i~~~~~~~l~~~l~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~~~~~  320 (472)
                      +...++..+.  .+++|++|++++|.+++.+...++..+..         .+++|+.|++++|.+++.++..++..+..+
T Consensus       215 ~~~~l~~~l~--~~~~L~~L~Ls~n~l~~~~~~~l~~~~~~---------~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~  283 (461)
T 1z7x_W          215 NCRDLCGIVA--SKASLRELALGSNKLGDVGMAELCPGLLH---------PSSRLRTLWIWECGITAKGCGDLCRVLRAK  283 (461)
T ss_dssp             HHHHHHHHHH--HCTTCCEEECCSSBCHHHHHHHHHHHHTS---------TTCCCCEEECTTSCCCHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHH--hCCCccEEeccCCcCChHHHHHHHHHHhc---------CCCCceEEECcCCCCCHHHHHHHHHHHhhC
Confidence            8777877765  45799999999999999888888776543         247899999999999999999899999999


Q ss_pred             CCccEEeCCCCCCChhHHHHHHHHHhcC-CCccEEEccCCCCCcccHHHHHHHhcCCCCCcEEEcCCCCCChHHHHHHHH
Q psy3611         321 KTLERVEMPQNGIYHVGITALSDAFEEN-KNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAK  399 (472)
Q Consensus       321 ~~L~~L~l~~~~i~~~~~~~l~~~l~~~-~~L~~L~l~~n~l~~~~~~~l~~~l~~~~~L~~L~l~~~~i~~~~~~~l~~  399 (472)
                      ++|++|++++|.+++.+...++..+... ++|++|++++|.+++.+...++..+..+++|++|++++|.+++.++..+..
T Consensus       284 ~~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~~L~~L~L~~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~i~~~~~~~l~~  363 (461)
T 1z7x_W          284 ESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQ  363 (461)
T ss_dssp             TTCCEEECTTCCCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCSSCCEEECCSSBCHHHHHHHHHH
T ss_pred             CCcceEECCCCCCchHHHHHHHHHhccCCccceeeEcCCCCCchHHHHHHHHHHhhCCCccEEEccCCccccccHHHHHH
Confidence            9999999999999988888888877654 589999999999998888888899999999999999999999988888888


Q ss_pred             Hhhc-CCCCCEEECcCCCCCchhHHHHHHHHhcCCcccEEEccCCCCChhHHHHHHHHHHh-CCceeEEecCCC
Q psy3611         400 YLTD-NTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKS-FGMAAALVLEDD  471 (472)
Q Consensus       400 ~l~~-~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~L~~L~l~~n~i~~~~~~~l~~~l~~-~~~L~~L~l~~~  471 (472)
                      .+.. +++|+.|++++|.+++.|+..++..+..+++|++|++++|++++.+...+.+.+++ ..+|+.|++.+.
T Consensus       364 ~l~~~~~~L~~L~L~~n~i~~~~~~~l~~~l~~~~~L~~L~l~~N~i~~~~~~~l~~~l~~~~~~L~~L~~~~~  437 (461)
T 1z7x_W          364 GLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLEQLVLYDI  437 (461)
T ss_dssp             HHTSTTCCCCEEECTTSCCCHHHHHHHHHHHHHCCCCCEEECCSSSCCHHHHHHHHHHHTSTTCCCCEEECTTC
T ss_pred             HHcCCCCceEEEECCCCCCChhhHHHHHHHHHhCCCccEEECCCCCCCHHHHHHHHHHhccCCcchhheeeccc
Confidence            7775 68999999999999999999999999999999999999999999999999988876 346888776553



>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 472
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-23
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-12
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-12
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-12
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-10
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-11
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-10
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-09
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-09
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-08
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-06
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 5e-10
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 2e-05
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 4e-04
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 9e-04
d1io0a_166 c.10.1.1 (A:) Tropomodulin C-terminal domain {Chic 5e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  100 bits (249), Expect = 1e-23
 Identities = 75/452 (16%), Positives = 167/452 (36%), Gaps = 7/452 (1%)

Query: 12  LEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAIL 71
           ++ +++    +       L       ++ + + L+D  +T      +  AL   P+LA L
Sbjct: 4   IQSLDIQCEELSDARWAELLPLL---QQCQVVRLDDCGLTEARCKDISSALRVNPALAEL 60

Query: 72  NLGDCLLKSAGASSIAKYL-TDNTTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVS 130
           NL    L   G   + + L T +  ++ ++L    ++  G   L   ++    L+++++S
Sbjct: 61  NLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLS 120

Query: 131 ENQFGEEGVEEMEKLMKSFGMAAALVLEDDEGECSDEEQDEESEEENDSDAEGDNSNLSH 190
           +N  G+ G++ + + +         +  +     +   +   S      D +    + + 
Sbjct: 121 DNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNND 180

Query: 191 NDSNHSHNASNQSHNNSNQSHNTSNQSHMSLKTGARLVELDLSDNAFGPIGVEGLADLLR 250
            +            ++  Q      +S        R +   ++  A       G   L  
Sbjct: 181 INEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGD 240

Query: 251 SSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGA 310
                    L   ++ L              C +  +   +  +LK      N L +EGA
Sbjct: 241 VGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEGA 300

Query: 311 KMLAAVFKKLKTLERVEMPQ-NGIYHVGITALSDAFEENKNLRHLNLNDNTITYKGAIPL 369
           ++L     +          +         +  S    +N+ L  L +++N +   G   L
Sbjct: 301 RLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVREL 360

Query: 370 GQALSKL-PSLAILNLGDCLLKSAGASSIAKYLTDNTTLEDVNLTCNEISVQGGLDLVKA 428
            Q L +    L +L L DC +  +  SS+A  L  N +L +++L+ N +   G L LV++
Sbjct: 361 CQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVES 420

Query: 429 MK-NKTKLKQINVSENQFGEEGVEEMEKLMKS 459
           ++     L+Q+ + +  + EE  + ++ L K 
Sbjct: 421 VRQPGCLLEQLVLYDIYWSEEMEDRLQALEKD 452


>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 166 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query472
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.96
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.72
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.65
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.64
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.62
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.58
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.54
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.53
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.47
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.46
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.45
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.38
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.37
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.34
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.31
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.25
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.17
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.12
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.1
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.0
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.98
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.92
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.89
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.43
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.7e-34  Score=284.25  Aligned_cols=430  Identities=17%  Similarity=0.209  Sum_probs=300.7

Q ss_pred             CCccEEeccCCCcchhhHHHHHHhhhcCCCCCeeeCCCCccCccchHHHHHHhccCCCCcEEeccCccccchhHHHHHHH
Q psy3611          10 KTLEHVEMPQNGIYHVGITALSDAFEENKKLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKY   89 (472)
Q Consensus        10 ~~L~~L~L~~~~l~~~~~~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~l~~~~~L~~L~ls~~~l~~~~~~~l~~~   89 (472)
                      ++|+.||++++.+++.++..+.   ..+++++.|+|.+|.+++.+...++.++..+++|++|+|++|.+++.++..+++.
T Consensus         2 ~~l~~ld~~~~~i~~~~~~~l~---~~l~~l~~L~L~~~~i~~~~~~~l~~~L~~~~~L~~LdLs~N~i~~~~~~~l~~~   78 (460)
T d1z7xw1           2 LDIQSLDIQCEELSDARWAELL---PLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQG   78 (460)
T ss_dssp             EEEEEEEEESCCCCHHHHHHHH---HHHTTCSEEEEESSCCCHHHHHHHHHHHHTCTTCCEEECTTCCCHHHHHHHHHHT
T ss_pred             CCCCEEEeeCCcCChHHHHHHH---HhCCCCCEEEeCCCCCCHHHHHHHHHHHhcCCCCCEEECcCCcCChHHHHHHHHH
Confidence            4789999999999997765544   4458889999999999988888888999999999999999999999888888887


Q ss_pred             hhcC-CcccEEECcCCccCcchHHHHHHHhhhCCCccEEEecCCcCChhhHHHHHHHHHhchhhHH-hhhccCCCCCCcc
Q psy3611          90 LTDN-TTLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFGMAAA-LVLEDDEGECSDE  167 (472)
Q Consensus        90 l~~~-~~L~~L~l~~~~i~~~~~~~l~~~l~~~~~L~~L~l~~~~i~~~~~~~l~~~l~~~~~l~~-L~~~~~~~~~~~~  167 (472)
                      +... .+|++|++++|.+++.+...++..+..+++|++|++++|.+++.++..+...+........ ...... ......
T Consensus        79 l~~~~~~L~~L~L~~n~it~~~~~~l~~~l~~~~~L~~L~L~~N~i~~~~~~~l~~~l~~~~~~~~~~~~~~~-~~~~~~  157 (460)
T d1z7xw1          79 LQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYC-SLSAAS  157 (460)
T ss_dssp             TCSTTCCCCEEECTTSCCBGGGHHHHHHHTTSCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTS-CCBGGG
T ss_pred             HhcCCCCCCEEECCCCCccccccccccchhhccccccccccccccchhhhhhhhhhccccccccccccccccc-ccchhh
Confidence            7643 5799999999999999998999999999999999999999988877777665433211100 000000 000000


Q ss_pred             ccchhhhcccCCccccCCCccCCCCCCCcccccccccCCCCcccccchhhhhhhhcCCcccEEeCCCCCCChhhHHHHHH
Q psy3611         168 EQDEESEEENDSDAEGDNSNLSHNDSNHSHNASNQSHNNSNQSHNTSNQSHMSLKTGARLVELDLSDNAFGPIGVEGLAD  247 (472)
Q Consensus       168 i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~  247 (472)
                      .....       ........+....+...          .......................+.+..+.+...+...+..
T Consensus       158 ~~~~~-------~~l~~~~~~~~~~ls~~----------~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~  220 (460)
T d1z7xw1         158 CEPLA-------SVLRAKPDFKELTVSNN----------DINEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCG  220 (460)
T ss_dssp             HHHHH-------HHHHHCTTCCEEECCSS----------BCHHHHHHHHHHHHHHSCCCCCEEECTTSCCBTTHHHHHHH
T ss_pred             hcccc-------ccccccccccccccccc----------ccccccccccccccccccccccccccccccccchhhhcccc
Confidence            00000       00000000000000000          00000011122222334456778888888887666666666


Q ss_pred             HHhccCCCcceEEEeeCCCCChhHHHHHHHHHHhhcccCcCCCCCcceeEEEcCCCCCChhhHHHHHHHHhcCCCccEEe
Q psy3611         248 LLRSSCCFALEELKLNNNGLGITGCKLLSKALHDCYESSKKEGSPLALKVFIAGRNRLENEGAKMLAAVFKKLKTLERVE  327 (472)
Q Consensus       248 ~l~~~~~~~L~~L~l~~~~i~~~~~~~l~~~l~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~~~~~~~L~~L~  327 (472)
                      .+...  +.++.++++++.+.+.+..........         ....++.+++++|.+.......+..++..++.++.++
T Consensus       221 ~l~~~--~~~~~l~~~~n~~~~~~~~~~~~~~~~---------~~~~l~~l~l~~n~i~~~~~~~~~~~l~~~~~l~~l~  289 (460)
T d1z7xw1         221 IVASK--ASLRELALGSNKLGDVGMAELCPGLLH---------PSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELS  289 (460)
T ss_dssp             HHHHC--TTCCEEECCSSBCHHHHHHHHHHHHTS---------TTCCCCEEECTTSCCCHHHHHHHHHHHHHCTTCCEEE
T ss_pred             ccccc--ccccccchhhccccccccchhhccccc---------ccccccccccccccccccccccccccccccccccccc
Confidence            55433  468888888887766555443333222         1357888888888888777666777777788888888


Q ss_pred             CCCCCCChhHHHHHHHHHhc-CCCccEEEccCCCCCcccHHHHHHHhcCCCCCcEEEcCCCCCChHHHHHHHHHhhc-CC
Q psy3611         328 MPQNGIYHVGITALSDAFEE-NKNLRHLNLNDNTITYKGAIPLGQALSKLPSLAILNLGDCLLKSAGASSIAKYLTD-NT  405 (472)
Q Consensus       328 l~~~~i~~~~~~~l~~~l~~-~~~L~~L~l~~n~l~~~~~~~l~~~l~~~~~L~~L~l~~~~i~~~~~~~l~~~l~~-~~  405 (472)
                      +++|.+++.++..+...+.. ...|+.++++++.++++++..++..+..+++|++|++++|.+++.|+..++..+.. ++
T Consensus       290 l~~n~i~~~~~~~l~~~l~~~~~~L~~l~l~~~~l~~~~~~~l~~~~~~~~~L~~L~Ls~N~i~~~g~~~l~~~l~~~~~  369 (460)
T d1z7xw1         290 LAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGS  369 (460)
T ss_dssp             CTTCCCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHHHHCSSCCEEECCSSBCHHHHHHHHHHHHTSTTC
T ss_pred             cccccccccccchhhccccccccccccccccccchhhhhhhhcccccccccchhhhheeeecccCcccchhhhhhhcccC
Confidence            88888888777777776654 45688888888888877777777777777888888888888888777777777753 57


Q ss_pred             CCCEEECcCCCCCchhHHHHHHHHhcCCcccEEEccCCCCChhHHHHHHHHHHhCC-ceeEEecCCC
Q psy3611         406 TLEDVNLTCNEISVQGGLDLVKAMKNKTKLKQINVSENQFGEEGVEEMEKLMKSFG-MAAALVLEDD  471 (472)
Q Consensus       406 ~L~~L~L~~n~i~~~~~~~l~~~l~~~~~L~~L~l~~n~i~~~~~~~l~~~l~~~~-~L~~L~l~~~  471 (472)
                      .|+.|+|++|.|++.|+..++.++..+++|++|++++|+|++.|+..+.+.++... .|+.|++.++
T Consensus       370 ~L~~L~Ls~n~i~~~~~~~l~~~l~~~~~L~~L~Ls~N~i~~~g~~~l~~~l~~~~~~L~~l~l~~~  436 (460)
T d1z7xw1         370 VLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLEQLVLYDI  436 (460)
T ss_dssp             CCCEEECTTSCCCHHHHHHHHHHHHHCCCCCEEECCSSSCCHHHHHHHHHHHTSTTCCCCEEECTTC
T ss_pred             CCCEEECCCCCCChHHHHHHHHHHhcCCCCCEEECCCCcCCHHHHHHHHHHHHhCCCccCEEECCCC
Confidence            78888888888888888888888888888888888888888888888888777666 5888887654



>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure