Psyllid ID: psy3966

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--
MSYNYGSSSSSDSSDSDSFKTVSIKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKPPSLLELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKYRIPLLQYLCSSRCITNSPNVMYGDVKNEDMMKKVLLG
cccccccccccccccccccccccccEEEccccccccccHHHHHccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccHHHccccccEEEccccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHccccccccccccccccccccHHHHHcccccccccEEEccccccccccHHHHccccccEEEccccccccccccccccccccHHHHcccccccccccHHHcccHHHHHHHHHHcccccccccccccccccEEEEEEEEccccccccHHHHcccccccccccccccccccccccHHHcccc
cccccccccccccccccccccccHHHHcccccHHEEccccccccccccHHHHccHHcccEEEccccccccccHHHHHHHcccEEEccccccccccHHHccccEEEEEccccccccccccHHHHHHHcccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHHcccccEEEccccccccccHHHHHHccccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHHHHHHHHHHcEEEccccccccccHHHHHHHcccEEEcccccccccccHHHHcccHHHHHEcccccccccccHHHccccHHHHHHHHHcccccccccccccccccccccEEEEccccccccHHHHccccHHcccccccccccccHHHHHHHHHcc
msynygsssssdssdsdsfktvsiktldfsyssldseTLATQIEllpnndynkkpenIDTLLLYHnnlsffpdnaskftnlrsldlsnnrithlpqaitnfplSTLIARNNlltaeslpkdmsnlknlkvfnlsgnqleqfpiqildiptlkylylgnnslnhvPREINKLCKLHVLslggnsltdipdtfGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITLKClselslrdnplvIRFVsdmtykppslLELASRTLKVHeidysqehlpQNLVQYLESahhcvnpkckgvffdnrieHIKFVDfcgkyripllqylcssrcitnspnvmygdvkneDMMKKVLLG
msynygsssssdssdsdsFKTVSIKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITLKCLSEKLKSLLLhnnklrtlpTEIITLkclselslrdNPLVIRFVSDMTYKPPSLLELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKYRIPLLQYLCSsrcitnspnvmygdvknedmmkkvllg
MSYNYGsssssdssdsdsFKTVSIKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITlkclseklkslllhnnklRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKPPSLLELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKYRIPLLQYLCSSRCITNSPNVMYGDVKNEDMMKKVLLG
***********************IKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKPPSLLELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKYRIPLLQYLCSSRCITNSPNVMYGD*************
MSYNYGSSSSSDSSDSDSFKTVSIKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKPPSLLELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKYRIPLLQYLCSSRC*****************MKKVLLG
*******************KTVSIKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKPPSLLELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKYRIPLLQYLCSSRCITNSPNVMYGDVKNEDMMKKVLLG
*****G********DSDSFKTVSIKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKPPSLLELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKYRIPLLQYLCSSRCITNSP*VMYGDVKNEDM***VLLG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYNYGSSSSSDSSDSDSFKTVSIKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKPPSLLELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKYRIPLLQYLCSSRCITNSPNVMYGDVKNEDMMKKVLLG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query392 2.2.26 [Sep-21-2011]
Q32NT4350 Leucine-rich repeat-conta N/A N/A 0.793 0.888 0.438 2e-68
A4IHG1349 Leucine-rich repeat-conta yes N/A 0.790 0.888 0.432 5e-66
Q96CX6371 Leucine-rich repeat-conta yes N/A 0.803 0.849 0.424 1e-62
Q3UGP9366 Leucine-rich repeat-conta yes N/A 0.788 0.844 0.422 2e-61
Q9Y4C4 1052 Malignant fibrous histioc no N/A 0.558 0.208 0.345 3e-25
Q3V1N1 1048 Malignant fibrous histioc no N/A 0.548 0.205 0.340 4e-25
B0M0P8 2356 Ras guanine nucleotide ex yes N/A 0.543 0.090 0.377 2e-24
Q9BTT6524 Leucine-rich repeat-conta no N/A 0.515 0.385 0.373 2e-24
Q5ZLN0 603 Leucine-rich repeat-conta no N/A 0.558 0.363 0.377 4e-23
Q80VQ1524 Leucine-rich repeat-conta no N/A 0.515 0.385 0.387 1e-22
>sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 Back     alignment and function desciption
 Score =  259 bits (662), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 152/347 (43%), Positives = 205/347 (59%), Gaps = 36/347 (10%)

Query: 54  KPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAI-TNFPLSTLIARNNL 112
           K +++  +LL HN L   P   + F +L  LD+SNN + ++ + I     L TL+A+NN 
Sbjct: 32  KRKDVQQILLPHNRLVVLPPLVASFIHLHLLDISNNNMVYIGEEILGLTKLKTLLAKNNR 91

Query: 113 LTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLC 172
           L   S PK+M  ++ L+V NLSGN+ E+ P Q L IPTLK L LG N L  +P EI  L 
Sbjct: 92  LDEFSFPKEMGGMR-LEVLNLSGNRFEEIPDQFLQIPTLKSLSLGGNRLKSIPAEIENLI 150

Query: 173 KLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRT 232
            L  L LGGN ++ IP    +L  L  L+L DN+++S+P  ++ +  L+SL LHNN L  
Sbjct: 151 SLEFLYLGGNFISSIPSELANLPYLSYLVLCDNRIQSIPPQLAQVHSLRSLSLHNNLLTY 210

Query: 233 LPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKP 292
           LP EI++           L+H                L ELSLR NPLV+RFV D+TY P
Sbjct: 211 LPREILS-----------LVH----------------LHELSLRGNPLVVRFVRDLTYTP 243

Query: 293 PSLLELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFC 352
           P+LLELA RT+K H I Y    LP+NL++YL+ A  C NPKC GV+FD  +  IKFVDFC
Sbjct: 244 PTLLELAGRTIKSHGIPYCPWELPENLLRYLDLASKCPNPKCSGVYFDCCVRQIKFVDFC 303

Query: 353 GKYRIPLLQYLCSSRCITNSPNVMYGDVKNED-------MMKKVLLG 392
           GKYR+PL+ YLCS  C +   +  + +  +ED        M+KVLLG
Sbjct: 304 GKYRLPLMHYLCSPECSSPCGSTSHSESDSEDEVNVAARRMQKVLLG 350

Xenopus laevis (taxid: 8355)
>sp|A4IHG1|LRC58_XENTR Leucine-rich repeat-containing protein 58 OS=Xenopus tropicalis GN=lrrc58 PE=2 SV=1 Back     alignment and function description
>sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 Back     alignment and function description
>sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 Back     alignment and function description
>sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 Back     alignment and function description
>sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
193669290362 PREDICTED: leucine-rich repeat-containin 0.910 0.986 0.528 1e-110
380012454388 PREDICTED: leucine-rich repeat-containin 0.839 0.847 0.539 1e-103
328788137347 PREDICTED: leucine-rich repeat-containin 0.839 0.948 0.536 1e-102
307183838348 Leucine-rich repeat-containing protein 5 0.834 0.939 0.534 1e-102
383847867347 PREDICTED: leucine-rich repeat-containin 0.846 0.956 0.535 1e-101
307197002347 Leucine-rich repeat-containing protein 5 0.849 0.959 0.527 3e-99
332018302348 Leucine-rich repeat-containing protein 5 0.854 0.962 0.537 1e-98
322802762402 hypothetical protein SINV_03581 [Solenop 0.793 0.773 0.558 1e-98
340718794347 PREDICTED: leucine-rich repeat-containin 0.844 0.953 0.523 2e-97
350396113347 PREDICTED: leucine-rich repeat-containin 0.844 0.953 0.520 3e-97
>gi|193669290|ref|XP_001952250.1| PREDICTED: leucine-rich repeat-containing protein 58-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  406 bits (1043), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/388 (52%), Positives = 273/388 (70%), Gaps = 31/388 (7%)

Query: 5   YGSSSSSDSSDSDSFKTVSIKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLY 64
           YGS+S S  SD+      SIKT+D +Y  LD +T+   ++ +       +P+ IDT+LL 
Sbjct: 6   YGSTSESSDSDAPIDDGSSIKTMDLNYLLLDGDTIQKHLDEMCKR---SRPDGIDTMLLN 62

Query: 65  HNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSN 124
           HN +   P   ++F +LR LD+SNNR+TH+P  +   PL+TL+A+NNL+  +  PK+   
Sbjct: 63  HNAMLSLPPAINRFQHLRVLDISNNRLTHVPDFVARLPLTTLVAKNNLIDDDGFPKEFGC 122

Query: 125 LKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSL 184
             +LKV N+SGN+L  FP Q+L + TL+YLY+G+N+L  +P++INKL +L  L LGGN L
Sbjct: 123 SAHLKVLNISGNRLSHFPKQLLSVTTLEYLYMGSNNLVEIPKDINKLIRLKFLCLGGNHL 182

Query: 185 TDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIITLKCLS 244
           +D+P T G L  L+AL LSDN LESLP +I+NLK                          
Sbjct: 183 SDVPVTLGMLDNLKALNLSDNSLESLPPAIANLK-------------------------- 216

Query: 245 EKLKSLLLHNNKLRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKPPSLLELASRTLK 304
             LKSL+LH N+LRTLP EII+LKCL+ELSLRDNPLV+RFVSDMT+ PPSLLEL++R++K
Sbjct: 217 -HLKSLMLHKNRLRTLPIEIISLKCLTELSLRDNPLVVRFVSDMTHNPPSLLELSARSVK 275

Query: 305 VHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKYRIPLLQYLC 364
           ++ + Y +  LP NL++YL SAHHCVNPKCKGVFFD+R+EHIKFVDFCGKYRIPLLQYLC
Sbjct: 276 INNVQYGERDLPYNLIEYLSSAHHCVNPKCKGVFFDDRVEHIKFVDFCGKYRIPLLQYLC 335

Query: 365 SSRCITNSPNVMYGDVKNEDMMKKVLLG 392
           SS+CI N  N++ GD  + +MM+KVLLG
Sbjct: 336 SSKCIVNHRNIL-GDSTDSNMMRKVLLG 362

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380012454|ref|XP_003690298.1| PREDICTED: leucine-rich repeat-containing protein 58-like [Apis florea] Back     alignment and taxonomy information
>gi|328788137|ref|XP_394765.2| PREDICTED: leucine-rich repeat-containing protein 58-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307183838|gb|EFN70476.1| Leucine-rich repeat-containing protein 58 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383847867|ref|XP_003699574.1| PREDICTED: leucine-rich repeat-containing protein 58-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307197002|gb|EFN78377.1| Leucine-rich repeat-containing protein 58 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332018302|gb|EGI58907.1| Leucine-rich repeat-containing protein 58 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322802762|gb|EFZ22974.1| hypothetical protein SINV_03581 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340718794|ref|XP_003397848.1| PREDICTED: leucine-rich repeat-containing protein 58-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350396113|ref|XP_003484445.1| PREDICTED: leucine-rich repeat-containing protein 58-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
ZFIN|ZDB-GENE-050309-29351 lrrc58b "leucine rich repeat c 0.839 0.937 0.380 7e-54
MGI|MGI:2443542366 Lrrc58 "leucine rich repeat co 0.724 0.775 0.418 3.6e-50
MGI|MGI:2442313524 Lrrc1 "leucine rich repeat con 0.487 0.364 0.392 4.1e-28
UNIPROTKB|Q9BTT6524 LRRC1 "Leucine-rich repeat-con 0.487 0.364 0.382 2.5e-26
UNIPROTKB|A6QLV3 582 SHOC2 "Leucine-rich repeat pro 0.551 0.371 0.316 4.7e-25
UNIPROTKB|Q9UQ13 582 SHOC2 "Leucine-rich repeat pro 0.551 0.371 0.316 4.7e-25
UNIPROTKB|F2Z5G0 582 SHOC2 "Uncharacterized protein 0.551 0.371 0.316 4.7e-25
UNIPROTKB|Q5RAV5 582 SHOC2 "Leucine-rich repeat pro 0.551 0.371 0.316 4.7e-25
RGD|1308146 582 Shoc2 "soc-2 (suppressor of cl 0.461 0.310 0.347 1.3e-24
MGI|MGI:1927197 582 Shoc2 "soc-2 (suppressor of cl 0.461 0.310 0.342 1.6e-24
ZFIN|ZDB-GENE-050309-29 lrrc58b "leucine rich repeat containing 58b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 557 (201.1 bits), Expect = 7.0e-54, P = 7.0e-54
 Identities = 131/344 (38%), Positives = 192/344 (55%)

Query:    58 IDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFP-LSTLIARNNLLTAE 116
             +D   L  +NLS    +  +  + + L L  NR+T L ++I+ F  L  L   NN L+  
Sbjct:    14 LDLSRLNLSNLSLDSVSEKRRKDTKQLYLCYNRMTFLAESISLFSNLEFLDISNNTLSV- 72

Query:   117 SLPKDMSNLKNLKVFNLSGNQLEQFPI-QILDIPTLKYLYLGNNSLNHVPREINKLCKLH 175
              + +D++ L  LK      N+L +F + +      L+ L    N    +P +  +L +L 
Sbjct:    73 -ICEDITRLTKLKTLIAKNNRLNEFSLPKHFGSMQLEVLNFSGNRFEEMPTQCLQLLRLQ 131

Query:   176 VLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPT 235
              LSLGGN L  IP     L +LE L L  NQ+ ++PA ++NL  L  L+L +N+++++P 
Sbjct:   132 SLSLGGNRLKSIPAEIESLTRLELLYLGGNQISTIPAELANLPGLSYLVLCDNRIQSVPP 191

Query:   236 EIITXXXXXXXXXXXXXXXXXXRTLPTEIITLKCLSELSLRDNPLVIRFVSDMTYKPPSL 295
             ++                      LP EI++L  L ELSLR NPLV+RFV DMTY PPSL
Sbjct:   192 QLNRLYSLRSLSLHNNLLTY----LPREILSLVHLQELSLRGNPLVVRFVKDMTYDPPSL 247

Query:   296 LELASRTLKVHEIDYSQEHLPQNLVQYLESAHHCVNPKCKGVFFDNRIEHIKFVDFCGKY 355
             LEL+ RT+K   + YS + LP +LV YL++A  C NPKC GV+FD+ + HIKFVDFCGKY
Sbjct:   248 LELSGRTIKSKNLLYSHKDLPSHLVTYLDTASKCPNPKCAGVYFDSCVRHIKFVDFCGKY 307

Query:   356 RIPLLQYLCSSRCITNSPNVMYGDVKNED-------MMKKVLLG 392
             R+PL+ YLCS  C +   +    D  ++D        +++VLLG
Sbjct:   308 RLPLMHYLCSPECTSPCSSNPQSDADSDDDHSVPVDRLQRVLLG 351
GO:0005575 "cellular_component" evidence=ND
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
MGI|MGI:2443542 Lrrc58 "leucine rich repeat containing 58" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2442313 Lrrc1 "leucine rich repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTT6 LRRC1 "Leucine-rich repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLV3 SHOC2 "Leucine-rich repeat protein SHOC-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UQ13 SHOC2 "Leucine-rich repeat protein SHOC-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5G0 SHOC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAV5 SHOC2 "Leucine-rich repeat protein SHOC-2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|1308146 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1927197 Shoc2 "soc-2 (suppressor of clear) homolog (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96CX6LRC58_HUMANNo assigned EC number0.42400.80350.8490yesN/A
Q3UGP9LRC58_MOUSENo assigned EC number0.42270.78820.8442yesN/A
A4IHG1LRC58_XENTRNo assigned EC number0.43220.79080.8882yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-15
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-15
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-14
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 4e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-13
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-09
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 1e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information 
 Score = 76.5 bits (188), Expect = 2e-15
 Identities = 81/236 (34%), Positives = 112/236 (47%), Gaps = 9/236 (3%)

Query: 40  ATQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAIT 99
            + I  L  ++       + +L L  N L        + TNL SLDL NN IT +P  I 
Sbjct: 77  PSGISSLDGSENLLNLLPLPSLDLNLNRLRSNISELLELTNLTSLDLDNNNITDIPPLIG 136

Query: 100 NFP--LSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLG 157
                L  L   +N    ESLP  + NL NLK  +LS N L   P  + ++  L  L L 
Sbjct: 137 LLKSNLKELDLSDN--KIESLPSPLRNLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLS 194

Query: 158 NNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNL 217
            N ++ +P EI  L  L  L L  NS+ ++  +  +L  L  L LS+N+LE LP SI NL
Sbjct: 195 GNKISDLPPEIELLSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNL 254

Query: 218 KMLKSLLLHNNKLRTLPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITLKCLSEL 273
             L++L L NN++    + I +L  L+  L+ L L  N L      I  L  L EL
Sbjct: 255 SNLETLDLSNNQI----SSISSLGSLT-NLRELDLSGNSLSNALPLIALLLLLLEL 305

Length = 394
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 392
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG0444|consensus 1255 99.94
KOG0444|consensus 1255 99.94
KOG4194|consensus 873 99.94
KOG4194|consensus 873 99.94
KOG0472|consensus 565 99.92
KOG0472|consensus 565 99.91
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.87
KOG0618|consensus 1081 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
KOG0617|consensus264 99.83
KOG0618|consensus 1081 99.81
KOG0617|consensus264 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.77
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.75
KOG4237|consensus498 99.71
KOG4237|consensus498 99.64
KOG0532|consensus 722 99.6
KOG1909|consensus382 99.56
KOG0532|consensus 722 99.55
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.51
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.5
KOG1259|consensus490 99.39
KOG1259|consensus490 99.39
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.38
KOG3207|consensus505 99.38
KOG3207|consensus505 99.37
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.33
KOG1909|consensus382 99.29
KOG0531|consensus414 99.21
KOG0531|consensus414 99.11
KOG2982|consensus418 98.88
KOG4658|consensus889 98.84
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.83
KOG1859|consensus 1096 98.81
KOG1859|consensus 1096 98.79
KOG4658|consensus889 98.79
KOG4579|consensus177 98.74
PLN03150623 hypothetical protein; Provisional 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.73
PLN03150623 hypothetical protein; Provisional 98.71
KOG2120|consensus419 98.69
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.67
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.67
KOG4579|consensus177 98.58
KOG2120|consensus419 98.54
KOG2982|consensus418 98.45
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.39
PRK15386 426 type III secretion protein GogB; Provisional 98.39
KOG1644|consensus233 98.3
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.29
KOG1644|consensus233 98.26
KOG3665|consensus 699 98.18
PRK15386 426 type III secretion protein GogB; Provisional 98.18
KOG3665|consensus 699 98.17
KOG4341|consensus483 97.89
KOG2739|consensus260 97.59
KOG2123|consensus388 97.59
KOG4341|consensus483 97.52
KOG2739|consensus260 97.41
KOG2123|consensus 388 97.3
KOG4308|consensus478 97.16
KOG4308|consensus478 97.14
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.6
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.31
KOG1947|consensus482 96.28
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.96
KOG0473|consensus326 95.67
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.49
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.8
KOG1947|consensus482 94.41
smart0037026 LRR Leucine-rich repeats, outliers. 94.03
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.03
smart0037026 LRR Leucine-rich repeats, outliers. 93.2
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.2
KOG0473|consensus326 93.0
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.47
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 90.03
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.14
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.84
KOG4242|consensus553 83.93
KOG4242|consensus553 82.58
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.95  E-value=1.1e-26  Score=246.87  Aligned_cols=258  Identities=33%  Similarity=0.480  Sum_probs=161.6

Q ss_pred             cccCCCCCCCccccccccEEEeecCCCCchhhHhhhhcccCCcCCCCCCCccEEEccCCCCC-CCCcccc-CCCCCCEEE
Q psy3966           8 SSSSDSSDSDSFKTVSIKTLDFSYSSLDSETLATQIELLPNNDYNKKPENIDTLLLYHNNLS-FFPDNAS-KFTNLRSLD   85 (392)
Q Consensus         8 ~~~~~~~~~~~~~~~~L~~LdLs~n~l~~~~~~~~~~~l~~~~~~~~~~~L~~L~L~~n~l~-~i~~~l~-~l~~L~~L~   85 (392)
                      .|.|..|+.    ..+++.|||++|.+++.. +..+         ..+++|+.|+|++|+++ .+|..+. .+++|++|+
T Consensus        59 ~w~gv~c~~----~~~v~~L~L~~~~i~~~~-~~~~---------~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~  124 (968)
T PLN00113         59 LWQGITCNN----SSRVVSIDLSGKNISGKI-SSAI---------FRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLN  124 (968)
T ss_pred             cCcceecCC----CCcEEEEEecCCCccccC-ChHH---------hCCCCCCEEECCCCccCCcCChHHhccCCCCCEEE
Confidence            355555543    236888888888876632 2222         23567888888888776 5666543 777777777


Q ss_pred             ccCCcCCcCCccccCccchhhhhhcCCCCCCCCCccCCCCCCCcEEeccCCCCc-ccCccccCCcCCcEEECCCCCCC-c
Q psy3966          86 LSNNRITHLPQAITNFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLE-QFPIQILDIPTLKYLYLGNNSLN-H  163 (392)
Q Consensus        86 Ls~n~l~~l~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n~l~-~l~~~l~~l~~L~~L~l~~n~l~-~  163 (392)
                      +++|+++...+...+.+|++|++++|.+.+ .+|..++++++|++|++++|.+. .+|..+.++++|++|++++|.+. .
T Consensus       125 Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~-~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~  203 (968)
T PLN00113        125 LSNNNFTGSIPRGSIPNLETLDLSNNMLSG-EIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQ  203 (968)
T ss_pred             CcCCccccccCccccCCCCEEECcCCcccc-cCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCc
Confidence            777777632222236667777777777664 56666677777777777777665 55666666777777777777665 4


Q ss_pred             CchhhcCCCCccEEEccCCCCc-ccchhhcCCcCCCEEEccCCCCC-CcchhhhCCcccceeeccCCcCC-CCChhhHhh
Q psy3966         164 VPREINKLCKLHVLSLGGNSLT-DIPDTFGDLYQLEALILSDNQLE-SLPASISNLKMLKSLLLHNNKLR-TLPTEIITL  240 (392)
Q Consensus       164 l~~~l~~~~~L~~L~l~~n~l~-~l~~~l~~l~~L~~L~L~~n~l~-~l~~~l~~l~~L~~L~L~~n~l~-~~~~~~~~~  240 (392)
                      +|..+.++++|++|++++|.+. .+|..++.+++|++|++++|.++ .+|..+..+++|+.|++++|.+. .+|..+..+
T Consensus       204 ~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l  283 (968)
T PLN00113        204 IPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSL  283 (968)
T ss_pred             CChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhc
Confidence            5666666667777777766666 45666666666666666666665 45556666666666666666665 344444433


Q ss_pred             hcccccCcEEEccCCCCC-CCCccccCCCCCCEEeCcCCCCcccc
Q psy3966         241 KCLSEKLKSLLLHNNKLR-TLPTEIITLKCLSELSLRDNPLVIRF  284 (392)
Q Consensus       241 ~~~~~~L~~L~l~~n~l~-~l~~~l~~l~~L~~L~l~~N~l~~~~  284 (392)
                      .    +|+.|++++|.++ .+|..+..+++|++|++++|.+++..
T Consensus       284 ~----~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~  324 (968)
T PLN00113        284 Q----KLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKI  324 (968)
T ss_pred             c----CcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcC
Confidence            2    5666666666554 44555555555555555555555443

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG4242|consensus Back     alignment and domain information
>KOG4242|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 3e-10
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 3e-09
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-06
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-09
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 3e-09
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 9e-09
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-08
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 2e-08
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 9e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 3e-06
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 4e-06
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 4e-06
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-06
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-05
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 1e-05
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 1e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 1e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 1e-05
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-05
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 2e-05
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-05
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 2e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 2e-05
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 2e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 2e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 2e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 2e-05
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-05
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 3e-05
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 3e-05
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 3e-05
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 3e-05
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 4e-05
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 7e-04
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 5e-05
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 5e-05
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 8e-05
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-04
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 8e-05
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 9e-05
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 9e-05
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 2e-04
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 2e-04
4aw4_A311 Engineered Variant Of Listeria Monocytogenes Inlb I 3e-04
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 3e-04
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 3e-04
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 3e-04
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 3e-04
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 5e-04
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 6e-04
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 7e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 8e-04
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 56/116 (48%), Gaps = 8/116 (6%)
Query: 124 NLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSLGGNS 183
           +L NL++FN+S N        I     L  LYL  NSL  +P EI  L  L VL L  N 
Sbjct: 230 DLSNLQIFNISAN--------IFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNR 281
Query: 184 LTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIIT 239
           LT +P   G  +QL+     DN + +LP    NL  L+ L +  N L     +I+T
Sbjct: 282 LTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQFLKILT 337
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|4AW4|A Chain A, Engineered Variant Of Listeria Monocytogenes Inlb Internalin Domain With An Additional Leucine Rich Repeat Inserted Length = 311 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-42
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-33
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-42
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-42
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-40
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-41
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-36
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-38
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-31
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-38
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-34
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-37
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-35
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-34
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-35
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-34
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-34
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-31
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-30
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-29
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-26
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-33
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-34
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-34
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-31
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-34
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-29
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-24
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-32
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-31
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-28
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-26
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-30
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-29
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-29
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-27
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-27
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-27
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-23
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-23
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-22
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-22
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-17
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-21
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-20
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-13
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-17
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-16
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-15
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-10
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 5e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  154 bits (392), Expect = 4e-44
 Identities = 58/253 (22%), Positives = 95/253 (37%), Gaps = 18/253 (7%)

Query: 41  TQIELLPNNDYNKKPENIDTLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITN 100
             ++   +   +        L L    L  FPD A + ++L+ + +    +  LP  +  
Sbjct: 66  RALKATADLLEDATQPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQ 125

Query: 101 FP-LSTLIARNNLLTAESLPKDMSNLKNLKVFNLSG-NQLEQFPIQILDIPT-------- 150
           F  L TL    N L   +LP  +++L  L+  ++    +L + P  +             
Sbjct: 126 FAGLETLTLARNPLR--ALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLV 183

Query: 151 -LKYLYLGNNSLNHVPREINKLCKLHVLSLGGNSLTDIPDTFGDLYQLEALILSD-NQLE 208
            L+ L L    +  +P  I  L  L  L +  + L+ +      L +LE L L     L 
Sbjct: 184 NLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALR 243

Query: 209 SLPASISNLKMLKSL-LLHNNKLRTLPTEIITLKCLSEKLKSLLLHNNKLRTLPTEIITL 267
           + P        LK L L   + L TLP +I  L  L EKL   L     L  LP+ I  L
Sbjct: 244 NYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQL-EKLD--LRGCVNLSRLPSLIAQL 300

Query: 268 KCLSELSLRDNPL 280
                + +  +  
Sbjct: 301 PANCIILVPPHLQ 313
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.87
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.82
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.74
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.71
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.59
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.37
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.15
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.91
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.91
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.84
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.83
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.78
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.18
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.17
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.86
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.92
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.97  E-value=1.7e-30  Score=240.04  Aligned_cols=254  Identities=25%  Similarity=0.323  Sum_probs=181.4

Q ss_pred             ccCCCCCCCccccccccEEEeecCCCCch-hhHhhhhcccCCcCCCCCCCccEEEccC-CCCC-CCCccccCCCCCCEEE
Q psy3966           9 SSSDSSDSDSFKTVSIKTLDFSYSSLDSE-TLATQIELLPNNDYNKKPENIDTLLLYH-NNLS-FFPDNASKFTNLRSLD   85 (392)
Q Consensus         9 ~~~~~~~~~~~~~~~L~~LdLs~n~l~~~-~~~~~~~~l~~~~~~~~~~~L~~L~L~~-n~l~-~i~~~l~~l~~L~~L~   85 (392)
                      |.|+.|+... ...++++|||++|.+++. .++..+.         .+++|++|++++ |.+. .+|..++++++|++|+
T Consensus        38 w~gv~C~~~~-~~~~l~~L~L~~~~l~~~~~~~~~l~---------~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~  107 (313)
T 1ogq_A           38 WLGVLCDTDT-QTYRVNNLDLSGLNLPKPYPIPSSLA---------NLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLY  107 (313)
T ss_dssp             STTEEECCSS-SCCCEEEEEEECCCCSSCEECCGGGG---------GCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEE
T ss_pred             CcceEeCCCC-CCceEEEEECCCCCccCCcccChhHh---------CCCCCCeeeCCCCCcccccCChhHhcCCCCCEEE
Confidence            6666665432 124789999999998751 1233332         467899999995 8777 7888889999999999


Q ss_pred             ccCCcCC-cCCcccc-CccchhhhhhcCCCCCCCCCccCCCCCCCcEEeccCCCCc-ccCccccCCc-CCcEEECCCCCC
Q psy3966          86 LSNNRIT-HLPQAIT-NFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLE-QFPIQILDIP-TLKYLYLGNNSL  161 (392)
Q Consensus        86 Ls~n~l~-~l~~~~~-~~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n~l~-~l~~~l~~l~-~L~~L~l~~n~l  161 (392)
                      +++|.++ .+|..+. +.+|++|++++|.+++ .+|..+..+++|++|++++|.++ .+|..+..++ +|++|++++|.+
T Consensus       108 Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~-~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l  186 (313)
T 1ogq_A          108 ITHTNVSGAIPDFLSQIKTLVTLDFSYNALSG-TLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRL  186 (313)
T ss_dssp             EEEECCEEECCGGGGGCTTCCEEECCSSEEES-CCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEE
T ss_pred             CcCCeeCCcCCHHHhCCCCCCEEeCCCCccCC-cCChHHhcCCCCCeEECcCCcccCcCCHHHhhhhhcCcEEECcCCee
Confidence            9999988 6776665 7777777777777765 56777777777777777777777 6676777766 777777777777


Q ss_pred             C-cCchhhcCCCCccEEEccCCCCcc-cchhhcCCcCCCEEEccCCCCCCcchhhhCCcccceeeccCCcCC-CCChhhH
Q psy3966         162 N-HVPREINKLCKLHVLSLGGNSLTD-IPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLR-TLPTEII  238 (392)
Q Consensus       162 ~-~l~~~l~~~~~L~~L~l~~n~l~~-l~~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~L~~n~l~-~~~~~~~  238 (392)
                      + .+|..+..++ |++|++++|.++. .|..+..+++|++|++++|.++..+..+..+++|++|++++|.++ .+|..+.
T Consensus       187 ~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~  265 (313)
T 1ogq_A          187 TGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLT  265 (313)
T ss_dssp             EEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGG
T ss_pred             eccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeecCcccccCCCCEEECcCCcccCcCChHHh
Confidence            6 5666666665 7777777777773 455677777777777777777755555666777777777777776 5665555


Q ss_pred             hhhcccccCcEEEccCCCCC-CCCccccCCCCCCEEeCcCCC
Q psy3966         239 TLKCLSEKLKSLLLHNNKLR-TLPTEIITLKCLSELSLRDNP  279 (392)
Q Consensus       239 ~~~~~~~~L~~L~l~~n~l~-~l~~~l~~l~~L~~L~l~~N~  279 (392)
                      .+.    +|+.|++++|.++ .+|.. ..+++|+.+++++|+
T Consensus       266 ~l~----~L~~L~Ls~N~l~~~ip~~-~~l~~L~~l~l~~N~  302 (313)
T 1ogq_A          266 QLK----FLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNK  302 (313)
T ss_dssp             GCT----TCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSS
T ss_pred             cCc----CCCEEECcCCcccccCCCC-ccccccChHHhcCCC
Confidence            443    6777777777776 55554 667777777777776
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 392
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 68.5 bits (166), Expect = 3e-13
 Identities = 41/196 (20%), Positives = 82/196 (41%), Gaps = 13/196 (6%)

Query: 60  TLLLYHNNLSFFPDNASKFTNLRSLDLSNNRITHLPQAITNFPLSTLIARNNLLTAESLP 119
           +L+  +N +S         TNL  L L+ N++  +    +   L+ L   NN ++  +  
Sbjct: 201 SLIATNNQISDITPL-GILTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLA-- 257

Query: 120 KDMSNLKNLKVFNLSGNQLEQFPIQILDIPTLKYLYLGNNSLNHVPREINKLCKLHVLSL 179
             +S L  L    L  NQ+                   N         I+ L  L  L+L
Sbjct: 258 -PLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQ--LEDISPISNLKNLTYLTL 314

Query: 180 GGNSLTDIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLRTLPTEIIT 239
             N+++DI      L +L+ L  ++N++  +  S++NL  +  L   +N++    +++  
Sbjct: 315 YFNNISDISP-VSSLTKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQI----SDLTP 368

Query: 240 LKCLSEKLKSLLLHNN 255
           L  L+ ++  L L++ 
Sbjct: 369 LANLT-RITQLGLNDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.84
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.68
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.61
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.48
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.43
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.35
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.02
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.97
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.94  E-value=1.8e-27  Score=217.44  Aligned_cols=256  Identities=25%  Similarity=0.295  Sum_probs=196.2

Q ss_pred             cccCCCCCCCccccccccEEEeecCCCCchh-hHhhhhcccCCcCCCCCCCccEEEccC-CCCC-CCCccccCCCCCCEE
Q psy3966           8 SSSSDSSDSDSFKTVSIKTLDFSYSSLDSET-LATQIELLPNNDYNKKPENIDTLLLYH-NNLS-FFPDNASKFTNLRSL   84 (392)
Q Consensus         8 ~~~~~~~~~~~~~~~~L~~LdLs~n~l~~~~-~~~~~~~l~~~~~~~~~~~L~~L~L~~-n~l~-~i~~~l~~l~~L~~L   84 (392)
                      .|.|+.|+.+.. -.++++|||+++.+.+.. ++..+.         .+++|++|+|++ |+++ .+|..++++++|++|
T Consensus        37 ~w~gv~C~~~~~-~~~v~~L~L~~~~l~g~~~lp~~l~---------~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L  106 (313)
T d1ogqa_          37 TWLGVLCDTDTQ-TYRVNNLDLSGLNLPKPYPIPSSLA---------NLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYL  106 (313)
T ss_dssp             CSTTEEECCSSS-CCCEEEEEEECCCCSSCEECCGGGG---------GCTTCSEEEEEEETTEESCCCGGGGGCTTCSEE
T ss_pred             cCCCeEEeCCCC-cEEEEEEECCCCCCCCCCCCChHHh---------cCccccccccccccccccccccccccccccchh
Confidence            477777776432 246999999999988642 444444         468999999987 7777 799999999999999


Q ss_pred             EccCCcCCcCCccc-c-CccchhhhhhcCCCCCCCCCccCCCCCCCcEEeccCCCCc-ccCccccCCcCC-cEEECCCCC
Q psy3966          85 DLSNNRITHLPQAI-T-NFPLSTLIARNNLLTAESLPKDMSNLKNLKVFNLSGNQLE-QFPIQILDIPTL-KYLYLGNNS  160 (392)
Q Consensus        85 ~Ls~n~l~~l~~~~-~-~~~L~~L~l~~n~~~~~~~~~~~~~l~~L~~L~l~~n~l~-~l~~~l~~l~~L-~~L~l~~n~  160 (392)
                      +|++|++..++... . ...|++++++.|.+.. .+|..+.+++.++++++++|.+. .+|..+..+..+ +.+++++|+
T Consensus       107 ~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~-~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~  185 (313)
T d1ogqa_         107 YITHTNVSGAIPDFLSQIKTLVTLDFSYNALSG-TLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNR  185 (313)
T ss_dssp             EEEEECCEEECCGGGGGCTTCCEEECCSSEEES-CCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSE
T ss_pred             hhccccccccccccccchhhhcccccccccccc-cCchhhccCcccceeecccccccccccccccccccccccccccccc
Confidence            99999998655443 3 7778888888888775 67788888888888888888887 677777776665 778888888


Q ss_pred             CCc-CchhhcCCCCccEEEccCCCCc-ccchhhcCCcCCCEEEccCCCCCCcchhhhCCcccceeeccCCcCC-CCChhh
Q psy3966         161 LNH-VPREINKLCKLHVLSLGGNSLT-DIPDTFGDLYQLEALILSDNQLESLPASISNLKMLKSLLLHNNKLR-TLPTEI  237 (392)
Q Consensus       161 l~~-l~~~l~~~~~L~~L~l~~n~l~-~l~~~l~~l~~L~~L~L~~n~l~~l~~~l~~l~~L~~L~L~~n~l~-~~~~~~  237 (392)
                      ++. .|..+..+. ...++++.+... .+|..+..+++++.+++++|.+...+..+..+++|+.|++++|+++ .+|..+
T Consensus       186 l~~~~~~~~~~l~-~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l  264 (313)
T d1ogqa_         186 LTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGL  264 (313)
T ss_dssp             EEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGG
T ss_pred             ccccccccccccc-ccccccccccccccccccccccccccccccccccccccccccccccccccccCccCeecccCChHH
Confidence            773 455555554 446888877766 4566677888888888888888765666777888888888888887 778777


Q ss_pred             HhhhcccccCcEEEccCCCCC-CCCccccCCCCCCEEeCcCCCC
Q psy3966         238 ITLKCLSEKLKSLLLHNNKLR-TLPTEIITLKCLSELSLRDNPL  280 (392)
Q Consensus       238 ~~~~~~~~~L~~L~l~~n~l~-~l~~~l~~l~~L~~L~l~~N~l  280 (392)
                      ..++    +|++|++++|+++ .+|. +.++++|+.+++++|+.
T Consensus       265 ~~L~----~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~  303 (313)
T d1ogqa_         265 TQLK----FLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKC  303 (313)
T ss_dssp             GGCT----TCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSE
T ss_pred             hCCC----CCCEEECcCCcccccCCC-cccCCCCCHHHhCCCcc
Confidence            6654    7888888888887 6664 56778888888888874
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure