Psyllid ID: psy5570

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-----

MYLGIHPGAFSRVPYHGAHSSQHIRAPGPEQRHAPCISHIVTLTSYISIPQVFTLARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGPLHTPLADVAVVALVHNDLRGAATSIGEQPIKGLVDPKRGARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSFSGRFAFKNHGIYDHLDRSQCLPIRYVDDNNKITEDYPMNPNGSPGKRERKKKTGRYLGKYGHGAVQKGMPFKDYHGKTGRVFNVTQHAVGVIVNKRVRTRIIPKSAEKISSSVSRKTCLAQFYVADGKLSCQLYQRSADMGLGVPFNIASYSLLTYMIAHVTGLQRTSNMTNSKGYRRGTRDLFSRPFRRHGTIPLSVYMKVYKVGDIVDIKCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVAFNSNSLVFFQCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVALQEVNQKLGQIGLLFIYFIVQRTKLCIVQRHEVGLAFDEWDLEYYTDIFRNKLKRNPTSVECFDLAQSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMNARCADEEYNSLVTRIGPKYQYQPVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVISIAVLREEGINGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQLNKFIARSDTFSFGVCNGCQLMNLLGWFSVSTQARQPYIKSRVRCPPLKKEKSGVNITRLSITLNFSTSDTLSWLLDSNTNVTVSALSWAFMVNVSSFPAHFMILVILRKKREHDLDTLQGHLYF

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccEEccEEEccccccccccccccEEEEEEccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHccccccccccccccccEEEcccccccccccccHHHHHHHHHHccccEEEEccccEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEEcccccccccccccEEEEEEEEccEEHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccccEEEEcccccHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEcccccccccccEEEEEEEEccEEEEcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHccccEEEEEHHHHHcccccccccccEEEccccccccccccccccccHHcccHHHHHHHHHHHcccccEEEccccHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccEEEEEcccEEEcccccccccccEEEEEEcccccccccccccccc

cEEEEccccHccccHHHHHHHHHHccccEEEEEccccccEEEcccccccccHHHccccccccccccccccccHHHHHHHHHcccHHcccEEEEEEcccccccHEEHHccccccccccccEEEEEccccccccHHHHccccccEEEEccHHHHHHHHHHHHHHHHHccHHHHHHcEEcHHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEEcccccccccccccccccccccHHHHHcccccccccccccccccccccccccccEEEEEEccEEEEEEEccEEEEEccccHHHHcccccccHHEEEEEEEccEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcccEcccccccccccccccccHccccccccccccHHHHccEcccccEEEEEEcccccccccEEEEEccHHHHHHccccccEEEEEEccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEcHccccHHHHHHHHHHHccEEEcccHHHHHHHHHHHccccccEEEEEEEEEEccccccccccEEEEEccccEEccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccEEEEEEEcHHcccccccccccccEEcccccHHcHHHHHHcccccHEEEEEccccccHHHHHHHHHHccccEEEEcHHHHHcccccHHHccEEEEcccccccccccccccHHHHHHccHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHccccccccccEEcEEEEEEEEcccccccccEEEEEEEEcccccHHHHHcccccEEHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHccccccc

mylgihpgafsrvpyhgahssqhirapgpeqrhapcishivtltsyisipqvftlarapgfpttahtppniSVLQALNNVMRLVSVGskrfltnkVDRCVTGLiaqqqcvgplhtplADVAVVALVHNDLrgaatsigeqpikglvdpkrgARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSfsgrfafknhgiydhldrsqclpiryvddnnkitedypmnpngspgkrerkkktgrylgkyghgavqkgmpfkdyhgktgrvfnVTQHAVGVIVNKRVRTRIIPKSAEKISSSVSRKTCLAQFYVADGKLSCQLYQrsadmglgvpfniASYSLLTYMIAHVTglqrtsnmtnskgyrrgtrdlfsrpfrrhgtiplsVYMKVYKVGDIVDIKCAESFYDRmtecvysspltsfnhgikpdpwfyvdvmgkgkvafnsNSLVFFQCAESFYDrmtecvysspltsfnhgikpdpwfyvdvmgKGKVALQEVNQKLGQIGLLFIYFIVQRTKLCIVQRHEVGLAFDEWDLEYYTDIFRnklkrnptsvecfdlaqsnsehsrHWFFKISVAvnnepvlnedlgTLFLIWERTSYELEKLQMNARCADEEYNSLVtrigpkyqyqpvrddivGATLGkkvtrigpkyqyqpvrddivgaTLGKKVISIAVLReegingdrEMSAMAQVCGFEVWDITVQDLLENKitldrfkglvfpggfsyADALGSAKGWAASLLLNEGIKTQLNKFIarsdtfsfgvcngcqlmNLLGWfsvstqarqpyiksrvrcpplkkeksgvnitrlsitlnfstsdTLSWLLDSNTNVTVSALSWAFMVNVSSFPAHFMILVILRKKREhdldtlqghlyf

MYLGIHPGAFSRVPYHGAHSSQHIRAPGPEQRHAPCISHIVTLTSYISIPQVFTLARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGPLHTPLADVAVVALVHNDLRgaatsigeqpikglvdpKRGARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSFSGRFAFKNHGIYDHLDRSQCLPIRYVDDNNkitedypmnpngspgkrerkkKTGRYLGkyghgavqkgmpFKDYHGKTGRVfnvtqhavgvivnkrvrtriipksaekisssvsrkTCLAQFYVADGKLSCQLYQRSADMGLGVPFNIASYSLLTYMIAHVtglqrtsnmtnskgyrrgtrdlfsrpfrrhgtiplsvymkvYKVGDIVDIKCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVAFNSNSLVFFQCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVALQEVNQKLGQIGLLFIYFIVQRTKLCIVQRHEVGLAFDEWDLEYYTDIFRNKLKRNPTSVECFDLAQSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMNARCADEEYNSLVTrigpkyqyqpvRDDIVGATLGKKvtrigpkyqyqpvrddivgatlgkKVISIAVLREEGINGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQLNKFIARSDTFSFGVCNGCQLMNLLGWFSVSTQARQPyiksrvrcpplkkeksgvnitrlsITLNFSTSDTLSWLLDSNTNVTVSALSWAFMVNVSSFPAHFMILVILRKKREHDLDTLQGHLYF

MYLGIHPGAFSRVPYHGAHSSQHIRAPGPEQRHAPCISHIVTLTSYISIPQVFTLARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGPLHTPLADVAVVALVHNDLRGAATSIGEQPIKGLVDPKRGARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSFSGRFAFKNHGIYDHLDRSQCLPIRYVDDNNKITEDYPMNPNGSPGKRERKKKTGRYLGKYGHGAVQKGMPFKDYHGKTGRVFNVTQHAVGVIVNKRVRTRIIPKSAEKISSSVSRKTCLAQFYVADGKLSCQLYQRSADMGLGVPFNIASYSLLTYMIAHVTGLQRTSNMTNSKGYRRGTRDLFSRPFRRHGTIPLSVYMKVYKVGDIVDIKCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVAFNSNSLVFFQCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVALQEVNQKLGQIGLLFIYFIVQRTKLCIVQRHEVGLAFDEWDLEYYTDIFRNKLKRNPTSVECFDLAQSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMNARCADEEYNSLVTRIGPKYQYQPVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVISIAVLREEGINGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQLNKFIARSDTFSFGVCNGCQLMNLLGWFSVSTQARQPYIKSRVRCPPLKKEKSGVNITRLSITLNFstsdtlswlldsNTNVTVSALSWAFMVNVSSFPAHFMILVILRKKREHDLDTLQGHLYF

*********************************APCISHIVTLTSYISIPQVFTLARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGPLHTPLADVAVVALVHNDLRGAATSIGEQPIKGLVDPKRGARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSFSGRFAFKNHGIYDHLDRSQCLPIRYVDDNN*************************YLGKYGHGAVQKGMPFKDYHGKTGRVFNVTQHAVGVIVNKRVRTRIIPKSAEKISSSVSRKTCLAQFYVADGKLSCQLYQRSADMGLGVPFNIASYSLLTYMIAHVTGLQRT********YRRGTRDLFSRPFRRHGTIPLSVYMKVYKVGDIVDIKCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVAFNSNSLVFFQCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVALQEVNQKLGQIGLLFIYFIVQRTKLCIVQRHEVGLAFDEWDLEYYTDIFRNKLKRNPTSVECFDLAQSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMNARCADEEYNSLVTRIGPKYQYQPVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVISIAVLREEGINGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQLNKFIARSDTFSFGVCNGCQLMNLLGWFSVSTQARQPYIKSRVRCPPLKKEKSGVNITRLSITLNFSTSDTLSWLLDSNTNVTVSALSWAFMVNVSSFPAHFMILVILRKKREH***********

MYLG*HPGAFSRVPYHGAHSSQHIRAPGPEQRHAPCISHIVTLTSYISIPQVFTLARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGPLHTPLADVAVVALVHNDLRGAATSIGEQPIKGLVDPKRGARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSFSGRFAFKNHGIYDHLDRSQCLPIRYVDDNNKITEDYPMNPNGSPGKRERKKKTGRYLGKYGHGAVQKGMPFKDYHGKTGRVFNVTQHAVGVIVNKRVRTRIIPKSAEKISSSVSRKTCLAQFYVADGKLSCQLYQRSADMGLGVPFNIASYSLLTYMIAHVTGLQRTSNMTNSKGYRRGTRDL********************KVGDIVDIKCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVAFNSNSLVFFQCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVALQEVNQKLGQIGLLFIYFIVQRTKLCIVQRHEVGLAFDEWDLEYYTDIFRNKLKRNPTSVECFDLAQSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMN**CADEEYNSLVTRIGPKYQYQPVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVISIAVLREEGINGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQLNKFIARSDTFSFGVCNGCQLMNLLGWFSVSTQARQPYIKSRVRCPPLKKEKSGVNITRLSITLNFSTSDTLSWLLDSNTNVTVSALSWAFMVNVSSFPAHFMILVILRKKREHDLDT*Q**LYF

MYLGIHPGAFSRVPYHGAHSSQHIRAPGPEQRHAPCISHIVTLTSYISIPQVFTLARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGPLHTPLADVAVVALVHNDLRGAATSIGEQPIKGLVDPKRGARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSFSGRFAFKNHGIYDHLDRSQCLPIRYVDDNNKITEDYPMNP************TGRYLGKYGHGAVQKGMPFKDYHGKTGRVFNVTQHAVGVIVNKRVRTRIIPKSAEKISSSVSRKTCLAQFYVADGKLSCQLYQRSADMGLGVPFNIASYSLLTYMIAHVTGLQRTSNMTNSKGYRRGTRDLFSRPFRRHGTIPLSVYMKVYKVGDIVDIKCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVAFNSNSLVFFQCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVALQEVNQKLGQIGLLFIYFIVQRTKLCIVQRHEVGLAFDEWDLEYYTDIFRNKLKRNPTSVECFDLAQSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMNARCADEEYNSLVTRIGPKYQYQPVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVISIAVLREEGINGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQLNKFIARSDTFSFGVCNGCQLMNLLGWFSVSTQARQPYIKSRVRCPPLKKEKSGVNITRLSITLNFSTSDTLSWLLDSNTNVTVSALSWAFMVNVSSFPAHFMILVILRKKREHDLDTLQGHLYF

MYLGIHPGAFSRVPYHGAHSSQHIRAPGPEQRHAPCISHIVTLTSYISIPQVFTLARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGPLHTPLADVAVVALVHNDLRGAATSIGEQPIKGLVDPKRGARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSFSGRFAFKNHGIYDHLDRSQCLPIRYVDDNNKITEDYPMNPNG*PGKRERKKKTGRYLGKYGHGAVQKGMPFKDYHGKTGRVFNVTQHAVGVIVNKRVRTRIIPKSAEKI*SSVSRKTCLAQFYVADGKLSCQLYQRSADMGLGVPFNIASYSLLTYMIAHVTGLQRTSN*T******RGTRDLFSRPFRRHGTIPLSVYMKVYKVGDIVDIKCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVAFNSNSLVFFQCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVALQEVNQKLGQIGLLFIYFIVQRTKLCIVQRHEVGLAFDEWDLEYYTDIFRNKLKRNPTSVECFDLAQSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMNARCADEEYNSLVTRIGPKYQYQPVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVISIAVLREEGINGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQLNKFIARSDTFSFGVCNGCQLMNLLGWFSVSTQARQPYIKSRVRCPPLKKEKSGVNITRLSITLNFSTSDTLSWLLDSNTNVTVSALSWAFMVNVSSFPAHFMILVILRKKREHDLDTLQ**LYF

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MYLGIHPGAFSRVPYHGAHSSQHIRAPGPEQRHAPCISHIVTLTSYISIPQVFTLARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGPLHTPLADVAVVALVHNDLRGAATSIGEQPIKGLVDPKRGARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSFSGRFAFKNHGIYDHLDRSQCLPIRYVDDNNKITEDYPMNPNGSPGKRERKKKTGRYLGKYGHGAVQKGMPFKDYHGKTGRVFNVTQHAVGVIVNKRVRTRIIPKSAEKISSSVSRKTCLAQFYVADGKLSCQLYQRSADMGLGVPFNIASYSLLTYMIAHVTGLQRTSNMTNSKGYRRGTRDLFSRPFRRHGTIPLSVYMKVYKVGDIVDIKCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVAFNSNSLVFFQCAESFYDRMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVALQEVNQKLGQIGLLFIYFIVQRTKLCIVQRHEVGLAFDEWDLEYYTDIFRNKLKRNPTSVECFDLAQSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLIWERTSYExxxxxxxxxxxxxxxxxxxxxIGPKYQYQPVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVISIAVLREEGINGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQLNKFIARSDTFSFGVCNGCQLMNLLGWFSVSTQARQPYIKSRVRCPPLKKEKSGVNITRLSITLNFSTSDTLSWLLDSNTNVTVSALSWAFMVNVSSFPAHFMILVILRKKREHDLDTLQGHLYF

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		875	2.2.26 [Sep-21-2011]
O15067		1338	Phosphoribosylformylglyci	yes	N/A	0.276	0.180	0.386	2e-44
Q5SUR0		1337	Phosphoribosylformylglyci	yes	N/A	0.251	0.164	0.400	3e-43
P35421		1354	Phosphoribosylformylglyci	yes	N/A	0.193	0.124	0.469	1e-40
Q9M8D3		1407	Probable phosphoribosylfo	yes	N/A	0.205	0.127	0.455	2e-40
Q54JC8		1355	Phosphoribosylformylglyci	yes	N/A	0.221	0.143	0.418	9e-38
Q19311		1324	Probable phosphoribosylfo	yes	N/A	0.109	0.072	0.606	1e-34
P38972		1358	Phosphoribosylformylglyci	yes	N/A	0.282	0.181	0.333	8e-34
Q9HXN2		1298	Phosphoribosylformylglyci	yes	N/A	0.227	0.153	0.351	3e-32
Q88P16		1299	Phosphoribosylformylglyci	yes	N/A	0.226	0.152	0.330	4e-31
Q4ZX02		1298	Phosphoribosylformylglyci	yes	N/A	0.206	0.139	0.352	2e-30

>sp\|O15067\|PUR4_HUMAN Phosphoribosylformylglycinamidine synthase OS=Homo sapiens GN=PFAS PE=1 SV=4	Back alignment and function desciption

 Score =  181 bits (459), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/277 (38%), Positives = 140/277 (50%), Gaps = 35/277 (12%)

Query: 503  GQIGLLFIYFIVQRTKLCIVQRHEVGLAFD--EWDLEYYTDIFRNKLKRNPTSVECFDLA 560
            G  GL     + +   L ++   E GL  +  E DL      +R+        + C +L 
Sbjct: 926  GNCGLQVDVPVPRVDVLSVLFAEEPGLVLEVQEPDLAQVLKRYRD------AGLHCLELG 979

Query: 561  QSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMNARCADEEYNSLV 620
             +  E   H   ++SV  N   VL E +G L  +WE TS++L++LQ   RC  EE   L 
Sbjct: 980  HTG-EAGPHAMVRVSV--NGAVVLEEPVGELRALWEETSFQLDRLQAEPRCVAEEERGLR 1036

Query: 621  TRIGPKYQYQPVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVISIAVLREEG 680
             R+GP Y   P        T  K      P                G     +A+LREEG
Sbjct: 1037 ERMGPSYCLPP--------TFPKASVPREP----------------GGPSPRVAILREEG 1072

Query: 681  INGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAAS 740
             NGDREM+    + GFEVWD+T+QDL    I LD F+G+ F GGFSYAD LGSAKGWAA+
Sbjct: 1073 SNGDREMADAFHLAGFEVWDVTMQDLCSGAIGLDTFRGVAFVGGFSYADVLGSAKGWAAA 1132

Query: 741  LLLNEGIKTQLNKFIARSDTFSFGVCNGCQLMNLLGW 777
            +  +     +L +F  R DTFS GVCNGCQL+ LLGW
Sbjct: 1133 VTFHPRAGAELRRFRKRPDTFSLGVCNGCQLLALLGW 1169

Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 5EC: .EC: 3

>sp\|Q5SUR0\|PUR4_MOUSE Phosphoribosylformylglycinamidine synthase OS=Mus musculus GN=Pfas PE=2 SV=1	Back alignment and function description

>sp\|P35421\|PUR4_DROME Phosphoribosylformylglycinamidine synthase OS=Drosophila melanogaster GN=ade2 PE=1 SV=2	Back alignment and function description

>sp\|Q9M8D3\|PUR4_ARATH Probable phosphoribosylformylglycinamidine synthase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=At1g74260 PE=1 SV=3	Back alignment and function description

>sp\|Q54JC8\|PUR4_DICDI Phosphoribosylformylglycinamidine synthase OS=Dictyostelium discoideum GN=purL PE=1 SV=1	Back alignment and function description

>sp\|Q19311\|PUR4_CAEEL Probable phosphoribosylformylglycinamidine synthase OS=Caenorhabditis elegans GN=F10F2.2 PE=3 SV=3	Back alignment and function description

>sp\|P38972\|PUR4_YEAST Phosphoribosylformylglycinamidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE6 PE=1 SV=2	Back alignment and function description

>sp\|Q9HXN2\|PUR4_PSEAE Phosphoribosylformylglycinamidine synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purL PE=3 SV=1	Back alignment and function description

>sp\|Q88P16\|PUR4_PSEPK Phosphoribosylformylglycinamidine synthase OS=Pseudomonas putida (strain KT2440) GN=purL PE=3 SV=1	Back alignment and function description

>sp\|Q4ZX02\|PUR4_PSEU2 Phosphoribosylformylglycinamidine synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=purL PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		875
380025190		1326	PREDICTED: phosphoribosylformylglycinami	0.212	0.140	0.492	3e-50
345490285		1324	PREDICTED: phosphoribosylformylglycinami	0.213	0.141	0.507	3e-50
328791126		1325	PREDICTED: phosphoribosylformylglycinami	0.208	0.137	0.507	6e-50
383857210		1325	PREDICTED: phosphoribosylformylglycinami	0.208	0.137	0.487	1e-49
189236168		1309	PREDICTED: similar to phosphoribosylform	0.270	0.181	0.404	3e-47
332028851		1326	Phosphoribosylformylglycinamidine syntha	0.208	0.137	0.485	4e-47
307202110		587	Phosphoribosylformylglycinamidine syntha	0.209	0.311	0.492	1e-46
242003452		1316	Phosphoribosylformylglycinamidine syntha	0.206	0.137	0.471	2e-46
241148658		1311	phosphoribosylformylglycinamidine syntha	0.203	0.135	0.478	6e-46
322798297		1269	hypothetical protein SINV_11838 [Solenop	0.204	0.141	0.492	6e-46

>gi\|380025190\|ref\|XP_003696360.1\| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Apis florea]	Back alignment and taxonomy information

 Score =  207 bits (526), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 131/211 (62%), Gaps = 25/211 (11%)

Query: 573  KISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMNARCADEEYNSLVTRIGPKYQYQPV 632
            KI + V  + V++  + +L  +WE TSY+LE+ Q N  CA EE+N +  R  P Y     
Sbjct: 987  KIKIQVQEKLVVDSTVLSLMTLWEETSYQLERRQTNIECAFEEFNGIKDRTAPTY----- 1041

Query: 633  RDDIVGATLGKKVTRIGPKYQYQP-VRDDIVGATLGKKVISIAVLREEGINGDREMSAMA 691
                              K  + P +R   +   L  K I++ VLREEGINGDREM+A  
Sbjct: 1042 ------------------KLSFNPDIRPIAIYKNLSSK-IAVVVLREEGINGDREMAASL 1082

Query: 692  QVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQL 751
               GFEVWD+T+QD L+NKIT DRF+G++FPGGFSYAD LGSAKGWAASLL N  ++ QL
Sbjct: 1083 MEAGFEVWDVTMQDFLQNKITFDRFRGVIFPGGFSYADVLGSAKGWAASLLFNPSLQKQL 1142

Query: 752  NKFIARSDTFSFGVCNGCQLMNLLGWFSVST 782
              FI+R D FS GVCNGCQLM+LLGW    T
Sbjct: 1143 KAFISRKDIFSLGVCNGCQLMSLLGWIGTKT 1173

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|345490285\|ref\|XP_001605732.2\| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|328791126\|ref\|XP_625036.3\| PREDICTED: phosphoribosylformylglycinamidine synthase [Apis mellifera]	Back alignment and taxonomy information

>gi\|383857210\|ref\|XP_003704098.1\| PREDICTED: phosphoribosylformylglycinamidine synthase-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|189236168\|ref\|XP_001809512.1\| PREDICTED: similar to phosphoribosylformylglycinamidine synthase, putative [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|332028851\|gb\|EGI68877.1\| Phosphoribosylformylglycinamidine synthase [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|307202110\|gb\|EFN81618.1\| Phosphoribosylformylglycinamidine synthase [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|242003452\|ref\|XP_002422737.1\| Phosphoribosylformylglycinamidine synthase, putative [Pediculus humanus corporis] gi\|212505570\|gb\|EEB09999.1\| Phosphoribosylformylglycinamidine synthase, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|241148658\|ref\|XP_002405859.1\| phosphoribosylformylglycinamidine synthase, putative [Ixodes scapularis] gi\|215493774\|gb\|EEC03415.1\| phosphoribosylformylglycinamidine synthase, putative [Ixodes scapularis]	Back alignment and taxonomy information

>gi\|322798297\|gb\|EFZ20043.1\| hypothetical protein SINV_11838 [Solenopsis invicta]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		875
UNIPROTKB\|F5GWT9		914	PFAS "Phosphoribosylformylglyc	0.137	0.131	0.658	3.7e-73
RGD\|1304926		1271	Pfas "phosphoribosylformylglyc	0.141	0.097	0.64	7.7e-73
UNIPROTKB\|O15067		1338	PFAS "Phosphoribosylformylglyc	0.137	0.089	0.658	3.3e-72
MGI\|MGI:2684864		1337	Pfas "phosphoribosylformylglyc	0.141	0.092	0.64	4e-72
UNIPROTKB\|E2QYQ9		1341	PFAS "Uncharacterized protein"	0.12	0.078	0.714	7.2e-72
ZFIN\|ZDB-GENE-030131-4420		1314	pfas "phosphoribosylformylglyc	0.12	0.079	0.742	3.6e-71
UNIPROTKB\|I3L712		1338	PFAS "Uncharacterized protein"	0.12	0.078	0.714	4.5e-70
UNIPROTKB\|F1N4K1		1338	PFAS "Uncharacterized protein"	0.141	0.092	0.64	1.1e-68
TAIR\|locus:2019637		1407	PUR4 "purine biosynthesis 4" [	0.12	0.074	0.657	3.5e-64
FB\|FBgn0000052		1354	ade2 "adenosine 2" [Drosophila	0.118	0.076	0.653	6.4e-63

UNIPROTKB\|F5GWT9 PFAS "Phosphoribosylformylglycinamidine synthase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

 Score = 385 (140.6 bits), Expect = 3.7e-73, Sum P(3) = 3.7e-73
 Identities = 79/120 (65%), Positives = 93/120 (77%)

Query:    53 FTLARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGP 112
             F L R P        PP +SV QAL  V+RL +V SKR+LTNKVDR V GL+AQQQCVGP
Sbjct:   217 FFLQRKPPMLQPLALPPGLSVHQALERVLRLPAVASKRYLTNKVDRSVGGLVAQQQCVGP 276

Query:   113 LHTPLADVAVVALVHNDLRGAATSIGEQPIKGLVDPKRGARMAVAEALTNLVFAKISDLK 172
             L TPLADVAVVAL H +L GAAT++GEQP+K L+DPK  AR+AVAEALTNLVFA ++DL+
Sbjct:   277 LQTPLADVAVVALSHEELIGAATALGEQPVKSLLDPKVAARLAVAEALTNLVFALVTDLR 336

GO:0004642 "phosphoribosylformylglycinamidine synthase activity" evidence=IEA

GO:0006189 "'de novo' IMP biosynthetic process" evidence=IEA

GO:0006541 "glutamine metabolic process" evidence=IEA

GO:0042493 "response to drug" evidence=IEA

RGD\|1304926 Pfas "phosphoribosylformylglycinamidine synthase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|O15067 PFAS "Phosphoribosylformylglycinamidine synthase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:2684864 Pfas "phosphoribosylformylglycinamidine synthase (FGAR amidotransferase)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QYQ9 PFAS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-4420 pfas "phosphoribosylformylglycinamidine synthase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|I3L712 PFAS "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N4K1 PFAS "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

TAIR\|locus:2019637 PUR4 "purine biosynthesis 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

FB\|FBgn0000052 ade2 "adenosine 2" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.1.1	LOW CONFIDENCE prediction!
4th Layer	2.1.1.45	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		875
PLN03206		1307	PLN03206, PLN03206, phosphoribosylformylglycinamid	5e-58
TIGR01735		1310	TIGR01735, FGAM_synt, phosphoribosylformylglycinam	2e-54
PRK05297		1290	PRK05297, PRK05297, phosphoribosylformylglycinamid	2e-50
PLN03206		1307	PLN03206, PLN03206, phosphoribosylformylglycinamid	3e-50
pfam13507		259	pfam13507, GATase_5, CobB/CobQ-like glutamine amid	8e-47
TIGR01735		1310	TIGR01735, FGAM_synt, phosphoribosylformylglycinam	5e-42
cd01740		238	cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotr	9e-40
PRK05297		1290	PRK05297, PRK05297, phosphoribosylformylglycinamid	3e-39
PLN03206		1307	PLN03206, PLN03206, phosphoribosylformylglycinamid	2e-37
TIGR01735		1310	TIGR01735, FGAM_synt, phosphoribosylformylglycinam	9e-28
PRK01827		264	PRK01827, thyA, thymidylate synthase; Reviewed	4e-27
pfam00303		262	pfam00303, Thymidylat_synt, Thymidylate synthase	2e-26
TIGR03284		295	TIGR03284, thym_sym, thymidylate synthase	2e-25
PTZ00164		514	PTZ00164, PTZ00164, bifunctional dihydrofolate red	2e-25
PRK05297		1290	PRK05297, PRK05297, phosphoribosylformylglycinamid	7e-23
COG0207		268	COG0207, ThyA, Thymidylate synthase [Nucleotide tr	1e-22
cd00351		215	cd00351, TS_Pyrimidine_HMase, Thymidylate synthase	1e-22
COG0047		231	COG0047, PurL, Phosphoribosylformylglycinamidine (	1e-21
PTZ00189		160	PTZ00189, PTZ00189, 60S ribosomal protein L21; Pro	2e-20
PHA03366		1304	PHA03366, PHA03366, FGAM-synthase; Provisional	2e-17
TIGR01739		1202	TIGR01739, tegu_FGAM_synt, herpesvirus tegument pr	6e-17
PTZ00189		160	PTZ00189, PTZ00189, 60S ribosomal protein L21; Pro	1e-16
pfam01157		99	pfam01157, Ribosomal_L21e, Ribosomal protein L21e	2e-16
pfam01157		99	pfam01157, Ribosomal_L21e, Ribosomal protein L21e	2e-16
PLN00190		158	PLN00190, PLN00190, 60S ribosomal protein L21; Pro	6e-16
PLN00190		158	PLN00190, PLN00190, 60S ribosomal protein L21; Pro	4e-14
cd02204		264	cd02204, PurL_repeat2, PurL subunit of the formylg	8e-14
COG2139		98	COG2139, RPL21A, Ribosomal protein L21E [Translati	4e-13
COG0046		743	COG0046, PurL, Phosphoribosylformylglycinamidine (	3e-12
PHA03366		1304	PHA03366, PHA03366, FGAM-synthase; Provisional	6e-11
TIGR01735		1310	TIGR01735, FGAM_synt, phosphoribosylformylglycinam	2e-10
PLN03206		1307	PLN03206, PLN03206, phosphoribosylformylglycinamid	2e-09
pfam13507		259	pfam13507, GATase_5, CobB/CobQ-like glutamine amid	3e-09
PRK04306		98	PRK04306, PRK04306, 50S ribosomal protein L21e; Re	3e-09
TIGR01739		1202	TIGR01739, tegu_FGAM_synt, herpesvirus tegument pr	4e-09
PLN03206		1307	PLN03206, PLN03206, phosphoribosylformylglycinamid	8e-08
COG2139		98	COG2139, RPL21A, Ribosomal protein L21E [Translati	1e-07
PRK01175		261	PRK01175, PRK01175, phosphoribosylformylglycinamid	2e-07
PRK05297		1290	PRK05297, PRK05297, phosphoribosylformylglycinamid	3e-07
TIGR01857		1239	TIGR01857, FGAM-synthase, phosphoribosylformylglyc	8e-07
TIGR01736		715	TIGR01736, FGAM_synth_II, phosphoribosylformylglyc	2e-06
cd01740		238	cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotr	6e-06
cd01653		115	cd01653, GATase1, Type 1 glutamine amidotransferas	6e-06
cd03128		92	cd03128, GAT_1, Type 1 glutamine amidotransferase	1e-05
TIGR01737		227	TIGR01737, FGAM_synth_I, phosphoribosylformylglyci	1e-05
cd02203		313	cd02203, PurL_repeat1, PurL subunit of the formylg	6e-04
PRK03619		219	PRK03619, PRK03619, phosphoribosylformylglycinamid	0.001

>gnl\|CDD\|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

 Score =  216 bits (551), Expect = 5e-58
 Identities = 92/207 (44%), Positives = 116/207 (56%), Gaps = 28/207 (13%)

Query: 573  KISVAVNNEPVLNEDLGTLFLIWERTSYELEKLQMNARCADEEYNSLVTRIGPKYQ--YQ 630
             I V V+    L+E   +L  +WE TS++LEKLQ    C  +E   L +R  P ++  + 
Sbjct: 964  LIEVKVDGATCLSEKTASLRDMWEETSFQLEKLQRLESCVAQEKEGLKSRKAPTWKLSFT 1023

Query: 631  PVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVISIAVLREEGINGDREMSAM 690
            P   D                         I+ AT   KV   A++REEG NGDREM+A 
Sbjct: 1024 PAFTD-----------------------KKIMNATSKPKV---AIIREEGSNGDREMAAA 1057

Query: 691  AQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQ 750
                GFE WD+T+ DLL  +I+LD F+G+VF GGFSYAD L SAKGWA S+  NE +  Q
Sbjct: 1058 FYAAGFEPWDVTMSDLLNGRISLDDFRGIVFVGGFSYADVLDSAKGWAGSIRFNEPLLQQ 1117

Query: 751  LNKFIARSDTFSFGVCNGCQLMNLLGW 777
              +F  R DTFS GVCNGCQLM LLGW
Sbjct: 1118 FQEFYNRPDTFSLGVCNGCQLMALLGW 1144

Length = 1307

>gnl\|CDD\|188163 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine synthase, single chain form	Back alignment and domain information

>gnl\|CDD\|235394 PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|222184 pfam13507, GATase_5, CobB/CobQ-like glutamine amidotransferase domain	Back alignment and domain information

>gnl\|CDD\|188163 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine synthase, single chain form	Back alignment and domain information

>gnl\|CDD\|153211 cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase	Back alignment and domain information

>gnl\|CDD\|235394 PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|188163 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine synthase, single chain form	Back alignment and domain information

>gnl\|CDD\|234984 PRK01827, thyA, thymidylate synthase; Reviewed	Back alignment and domain information

>gnl\|CDD\|215846 pfam00303, Thymidylat_synt, Thymidylate synthase	Back alignment and domain information

>gnl\|CDD\|213790 TIGR03284, thym_sym, thymidylate synthase	Back alignment and domain information

>gnl\|CDD\|240299 PTZ00164, PTZ00164, bifunctional dihydrofolate reductase-thymidylate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|235394 PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|223285 COG0207, ThyA, Thymidylate synthase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238211 cd00351, TS_Pyrimidine_HMase, Thymidylate synthase and pyrimidine hydroxymethylase: Thymidylate synthase (TS) and deoxycytidylate hydroxymethylase (dCMP-HMase) are homologs that catalyze analogous alkylation of C5 of pyrimidine nucleotides	Back alignment and domain information

>gnl\|CDD\|223125 COG0047, PurL, Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|240309 PTZ00189, PTZ00189, 60S ribosomal protein L21; Provisional	Back alignment and domain information

>gnl\|CDD\|223058 PHA03366, PHA03366, FGAM-synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|233554 TIGR01739, tegu_FGAM_synt, herpesvirus tegument protein/v-FGAM-synthase	Back alignment and domain information

>gnl\|CDD\|240309 PTZ00189, PTZ00189, 60S ribosomal protein L21; Provisional	Back alignment and domain information

>gnl\|CDD\|110179 pfam01157, Ribosomal_L21e, Ribosomal protein L21e	Back alignment and domain information

>gnl\|CDD\|110179 pfam01157, Ribosomal_L21e, Ribosomal protein L21e	Back alignment and domain information

>gnl\|CDD\|177784 PLN00190, PLN00190, 60S ribosomal protein L21; Provisional	Back alignment and domain information

>gnl\|CDD\|177784 PLN00190, PLN00190, 60S ribosomal protein L21; Provisional	Back alignment and domain information

>gnl\|CDD\|100035 cd02204, PurL_repeat2, PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), second repeat	Back alignment and domain information

>gnl\|CDD\|225050 COG2139, RPL21A, Ribosomal protein L21E [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|223124 COG0046, PurL, Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223058 PHA03366, PHA03366, FGAM-synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|188163 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine synthase, single chain form	Back alignment and domain information

>gnl\|CDD\|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|222184 pfam13507, GATase_5, CobB/CobQ-like glutamine amidotransferase domain	Back alignment and domain information

>gnl\|CDD\|235275 PRK04306, PRK04306, 50S ribosomal protein L21e; Reviewed	Back alignment and domain information

>gnl\|CDD\|233554 TIGR01739, tegu_FGAM_synt, herpesvirus tegument protein/v-FGAM-synthase	Back alignment and domain information

>gnl\|CDD\|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|225050 COG2139, RPL21A, Ribosomal protein L21E [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|234913 PRK01175, PRK01175, phosphoribosylformylglycinamidine synthase I; Provisional	Back alignment and domain information

>gnl\|CDD\|235394 PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|130916 TIGR01857, FGAM-synthase, phosphoribosylformylglycinamidine synthase, clade II	Back alignment and domain information

>gnl\|CDD\|233552 TIGR01736, FGAM_synth_II, phosphoribosylformylglycinamidine synthase II	Back alignment and domain information

>gnl\|CDD\|153211 cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase	Back alignment and domain information

>gnl\|CDD\|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>gnl\|CDD\|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>gnl\|CDD\|233553 TIGR01737, FGAM_synth_I, phosphoribosylformylglycinamidine synthase I	Back alignment and domain information

>gnl\|CDD\|100034 cd02203, PurL_repeat1, PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat	Back alignment and domain information

>gnl\|CDD\|235140 PRK03619, PRK03619, phosphoribosylformylglycinamidine synthase I; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		875
PLN03206		1307	phosphoribosylformylglycinamidine synthase; Provis	100.0
TIGR01735		1310	FGAM_synt phosphoribosylformylglycinamidine syntha	100.0
PRK05297		1290	phosphoribosylformylglycinamidine synthase; Provis	100.0
KOG1907\|consensus		1320		100.0
TIGR01857		1239	FGAM-synthase phosphoribosylformylglycinamidine sy	100.0
PHA03366		1304	FGAM-synthase; Provisional	100.0
TIGR01739		1202	tegu_FGAM_synt herpesvirus tegument protein/v-FGAM	100.0
COG0046		743	PurL Phosphoribosylformylglycinamidine (FGAM) synt	100.0
PRK01213		724	phosphoribosylformylglycinamidine synthase II; Pro	100.0
COG0047		231	PurL Phosphoribosylformylglycinamidine (FGAM) synt	100.0
TIGR01736		715	FGAM_synth_II phosphoribosylformylglycinamidine sy	100.0
PF13507		259	GATase_5: CobB/CobQ-like glutamine amidotransferas	100.0
PRK14090		601	phosphoribosylformylglycinamidine synthase II; Pro	99.97
PRK01175		261	phosphoribosylformylglycinamidine synthase I; Prov	99.97
cd01740		238	GATase1_FGAR_AT Type 1 glutamine amidotransferase	99.92
PRK03619		219	phosphoribosylformylglycinamidine synthase I; Prov	99.92
TIGR01737		227	FGAM_synth_I phosphoribosylformylglycinamidine syn	99.9
cd02193		272	PurL Formylglycinamide ribonucleotide amidotransfe	99.82
cd02204		264	PurL_repeat2 PurL subunit of the formylglycinamide	99.8
KOG1907\|consensus		1320		99.79
PLN03206		1307	phosphoribosylformylglycinamidine synthase; Provis	99.76
PRK04306		98	50S ribosomal protein L21e; Reviewed	99.73
TIGR01735		1310	FGAM_synt phosphoribosylformylglycinamidine syntha	99.72
PTZ00189		160	60S ribosomal protein L21; Provisional	99.7
PLN00190		158	60S ribosomal protein L21; Provisional	99.7
PRK14090		601	phosphoribosylformylglycinamidine synthase II; Pro	99.69
COG0118		204	HisH Glutamine amidotransferase [Amino acid transp	99.66
PF01157		99	Ribosomal_L21e: Ribosomal protein L21e; InterPro:	99.66
TIGR03267		323	methan_mark_2 putative methanogenesis marker prote	99.66
COG2139		98	RPL21A Ribosomal protein L21E [Translation, riboso	99.59
cd02203		313	PurL_repeat1 PurL subunit of the formylglycinamide	99.58
PRK05297		1290	phosphoribosylformylglycinamidine synthase; Provis	99.57
PRK13526		179	glutamine amidotransferase subunit PdxT; Provision	99.5
TIGR01857		1239	FGAM-synthase phosphoribosylformylglycinamidine sy	99.4
PRK13142		192	hisH imidazole glycerol phosphate synthase subunit	99.36
PRK11780		217	isoprenoid biosynthesis protein with amidotransfer	99.35
CHL00188		210	hisH imidazole glycerol phosphate synthase subunit	99.34
PRK14004		210	hisH imidazole glycerol phosphate synthase subunit	99.32
PRK13146		209	hisH imidazole glycerol phosphate synthase subunit	99.31
TIGR01736		715	FGAM_synth_II phosphoribosylformylglycinamidine sy	99.28
COG0693		188	ThiJ Putative intracellular protease/amidase [Gene	99.27
PTZ00189		160	60S ribosomal protein L21; Provisional	99.26
PLN02832		248	glutamine amidotransferase subunit of pyridoxal 5'	99.26
PLN00190		158	60S ribosomal protein L21; Provisional	99.26
cd00396		222	PurM-like AIR (aminoimidazole ribonucleotide) synt	99.25
cd02192		283	PurM-like3 AIR synthase (PurM) related protein, su	99.25
PRK13152		201	hisH imidazole glycerol phosphate synthase subunit	99.24
PRK13143		200	hisH imidazole glycerol phosphate synthase subunit	99.22
PRK05731		318	thiamine monophosphate kinase; Provisional	99.2
PRK13170		196	hisH imidazole glycerol phosphate synthase subunit	99.19
PLN02617		538	imidazole glycerol phosphate synthase hisHF	99.18
KOG1732\|consensus		160		99.17
PRK01213		724	phosphoribosylformylglycinamidine synthase II; Pro	99.17
PRK13181		199	hisH imidazole glycerol phosphate synthase subunit	99.16
TIGR01379		317	thiL thiamine-monophosphate kinase. Proteins scori	99.15
TIGR03800		184	PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl	99.14
cd03133		213	GATase1_ES1 Type 1 glutamine amidotransferase (GAT	99.14
TIGR01382		166	PfpI intracellular protease, PfpI family. The memb	99.12
PRK13527		200	glutamine amidotransferase subunit PdxT; Provision	99.12
cd01750		194	GATase1_CobQ Type 1 glutamine amidotransferase (GA	99.1
cd03134		165	GATase1_PfpI_like A type 1 glutamine amidotransfer	99.06
cd01748		198	GATase1_IGP_Synthase Type 1 glutamine amidotransfe	99.04
cd02194		291	ThiL ThiL (Thiamine-monophosphate kinase) plays a	99.04
cd03169		180	GATase1_PfpI_1 Type 1 glutamine amidotransferase (	99.04
COG0207		268	ThyA Thymidylate synthase [Nucleotide transport an	99.03
PF01157		99	Ribosomal_L21e: Ribosomal protein L21e; InterPro:	99.03
PRK13525		189	glutamine amidotransferase subunit PdxT; Provision	99.01
cd02196		297	PurM PurM (Aminoimidazole Ribonucleotide [AIR] syn	99.01
cd03147		231	GATase1_Ydr533c_like Type 1 glutamine amidotransfe	98.99
KOG0623\|consensus		541		98.99
cd02195		287	SelD Selenophosphate synthetase (SelD) catalyzes t	98.96
cd03130		198	GATase1_CobB Type 1 glutamine amidotransferase (GA	98.96
PRK04155		287	chaperone protein HchA; Provisional	98.96
TIGR02124		320	hypE hydrogenase expression/formation protein HypE	98.96
KOG0673\|consensus		293		98.96
PRK13141		205	hisH imidazole glycerol phosphate synthase subunit	98.93
TIGR01855		196	IMP_synth_hisH imidazole glycerol phosphate syntha	98.89
cd03135		163	GATase1_DJ-1 Type 1 glutamine amidotransferase (GA	98.89
PRK11574		196	oxidative-stress-resistance chaperone; Provisional	98.83
PRK13821		323	thyA thymidylate synthase; Provisional	98.8
cd03148		232	GATase1_EcHsp31_like Type 1 glutamine amidotransfe	98.8
COG0046		743	PurL Phosphoribosylformylglycinamidine (FGAM) synt	98.79
TIGR01383		179	not_thiJ DJ-1 family protein. This model represent	98.78
cd02197		293	HypE HypE (Hydrogenase expression/formation protei	98.78
KOG2764\|consensus		247		98.78
cd03141		221	GATase1_Hsp31_like Type 1 glutamine amidotransfera	98.76
TIGR03284		296	thym_sym thymidylate synthase. Members of this pro	98.76
PF01965		147	DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T	98.74
cd03140		170	GATase1_PfpI_3 Type 1 glutamine amidotransferase (	98.72
cd03137		187	GATase1_AraC_1 AraC transcriptional regulators hav	98.72
PRK04306		98	50S ribosomal protein L21e; Reviewed	98.71
cd03132		142	GATase1_catalase Type 1 glutamine amidotransferase	98.71
cd01749		183	GATase1_PB Glutamine Amidotransferase (GATase_I) i	98.71
cd01742		181	GATase1_GMP_Synthase Type 1 glutamine amidotransfe	98.7
TIGR00888		188	guaA_Nterm GMP synthase (glutamine-hydrolyzing), N	98.67
KOG1732\|consensus		160		98.65
cd03139		183	GATase1_PfpI_2 Type 1 glutamine amidotransferase (	98.63
TIGR00878		332	purM phosphoribosylaminoimidazole synthetase. This	98.62
cd06061		298	PurM-like1 AIR synthase (PurM) related protein, su	98.6
PRK01827		264	thyA thymidylate synthase; Reviewed	98.59
cd01745		189	GATase1_2 Subgroup of proteins having the Type 1 g	98.58
PF00117		192	GATase: Glutamine amidotransferase class-I; InterP	98.57
COG2144		324	Selenophosphate synthetase-related proteins [Gener	98.54
PTZ00164		514	bifunctional dihydrofolate reductase-thymidylate s	98.54
PRK00784		488	cobyric acid synthase; Provisional	98.53
PRK00758		184	GMP synthase subunit A; Validated	98.52
PRK06490		239	glutamine amidotransferase; Provisional	98.52
PRK06895		190	putative anthranilate synthase component II; Provi	98.51
PRK06278		476	cobyrinic acid a,c-diamide synthase; Validated	98.5
cd03136		185	GATase1_AraC_ArgR_like AraC transcriptional regula	98.5
PRK01077		451	cobyrinic acid a,c-diamide synthase; Validated	98.49
TIGR00379		449	cobB cobyrinic acid a,c-diamide synthase. This mod	98.48
PF00586		96	AIRS: AIR synthase related protein, N-terminal dom	98.46
cd01744		178	GATase1_CPSase Small chain of the glutamine-depend	98.41
cd03138		195	GATase1_AraC_2 AraC transcriptional regulators hav	98.4
PRK06186		229	hypothetical protein; Validated	98.38
PRK05385		327	phosphoribosylaminoimidazole synthetase; Provision	98.36
cd00351		215	TS_Pyrimidine_HMase Thymidylate synthase and pyrim	98.36
cd03144		114	GATase1_ScBLP_like Type 1 glutamine amidotransfera	98.35
PRK08250		235	glutamine amidotransferase; Provisional	98.35
cd01741		188	GATase1_1 Subgroup of proteins having the Type 1 g	98.31
PRK07053		234	glutamine amidotransferase; Provisional	98.29
cd01653		115	GATase1 Type 1 glutamine amidotransferase (GATase1	98.28
TIGR00313		475	cobQ cobyric acid synthase CobQ.	98.26
cd01746		235	GATase1_CTP_Synthase Type 1 glutamine amidotransfe	98.22
TIGR03283		199	thy_syn_methano thymidylate synthase, methanogen t	98.22
PLN02347		536	GMP synthetase	98.21
PRK00074		511	guaA GMP synthase; Reviewed	98.2
TIGR01815		717	TrpE-clade3 anthranilate synthase, alpha proteobac	98.2
PRK13896		433	cobyrinic acid a,c-diamide synthase; Provisional	98.2
PRK05380		533	pyrG CTP synthetase; Validated	98.2
PRK00956		208	thyA thymidylate synthase; Provisional	98.19
PLN02327		557	CTP synthase	98.17
PF07685		158	GATase_3: CobB/CobQ-like glutamine amidotransferas	98.16
PRK00943		347	selenophosphate synthetase; Provisional	98.16
cd01743		184	GATase1_Anthranilate_Synthase Type 1 glutamine ami	98.15
PF00303		269	Thymidylat_synt: Thymidylate synthase; InterPro: I	98.15
PRK11249		752	katE hydroperoxidase II; Provisional	98.11
cd03146		212	GAT1_Peptidase_E Type 1 glutamine amidotransferase	98.09
PRK07765		214	para-aminobenzoate synthase component II; Provisio	98.08
COG0518		198	GuaA GMP synthase - Glutamine amidotransferase dom	98.06
PF07722		217	Peptidase_C26: Peptidase C26; InterPro: IPR011697	98.06
TIGR00337		525	PyrG CTP synthase. CTP synthase is involved in pyr	98.04
cd02691		346	PurM-like2 AIR synthase (PurM) related protein, ar	98.04
PRK12564		360	carbamoyl phosphate synthase small subunit; Review	98.04
PRK09393		322	ftrA transcriptional activator FtrA; Provisional	98.03
PRK13566		720	anthranilate synthase; Provisional	98.02
PF01174		188	SNO: SNO glutamine amidotransferase family; InterP	98.02
PLN02335		222	anthranilate synthase	98.01
cd03128		92	GAT_1 Type 1 glutamine amidotransferase (GATase1)-	98.0
PF13278		166	DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M	98.0
COG0311		194	PDX2 Predicted glutamine amidotransferase involved	98.0
CHL00101		190	trpG anthranilate synthase component 2	97.93
COG2139		98	RPL21A Ribosomal protein L21E [Translation, riboso	97.92
PRK05665		240	amidotransferase; Provisional	97.91
PRK05637		208	anthranilate synthase component II; Provisional	97.88
PRK12838		354	carbamoyl phosphate synthase small subunit; Review	97.88
CHL00197		382	carA carbamoyl-phosphate synthase arginine-specifi	97.88
PRK05670		189	anthranilate synthase component II; Provisional	97.88
TIGR01368		358	CPSaseIIsmall carbamoyl-phosphate synthase, small	97.84
PRK11366		254	puuD gamma-glutamyl-gamma-aminobutyrate hydrolase;	97.82
cd01747		273	GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot	97.81
PRK07649		195	para-aminobenzoate/anthranilate synthase glutamine	97.79
COG0504		533	PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide	97.78
PF02769		153	AIRS_C: AIR synthase related protein, C-terminal d	97.76
TIGR00566		188	trpG_papA glutamine amidotransferase of anthranila	97.72
PRK07567		242	glutamine amidotransferase; Provisional	97.68
PRK06774		191	para-aminobenzoate synthase component II; Provisio	97.68
PRK08007		187	para-aminobenzoate synthase component II; Provisio	97.64
PRK09065		237	glutamine amidotransferase; Provisional	97.57
COG0611		317	ThiL Thiamine monophosphate kinase [Coenzyme metab	97.55
PLN02771		415	carbamoyl-phosphate synthase (glutamine-hydrolyzin	97.53
PRK14105		345	selenophosphate synthetase; Provisional	97.47
TIGR01823		742	PabB-fungal aminodeoxychorismate synthase, fungal	97.32
TIGR00476		347	selD selenium donor protein. In prokaryotes, the i	97.25
PRK08857		193	para-aminobenzoate synthase component II; Provisio	97.23
KOG2387\|consensus		585		97.21
COG2071		243	Predicted glutamine amidotransferases [General fun	97.2
COG1492		486	CobQ Cobyric acid synthase [Coenzyme metabolism]	97.09
COG0512		191	PabA Anthranilate/para-aminobenzoate synthases com	97.09
COG1797		451	CobB Cobyrinic acid a,c-diamide synthase [Coenzyme	96.78
COG0505		368	CarA Carbamoylphosphate synthase small subunit [Am	96.76
PRK09522		531	bifunctional glutamine amidotransferase/anthranila	96.6
PLN02889		918	oxo-acid-lyase/anthranilate synthase	96.51
PRK14607		534	bifunctional glutamine amidotransferase/anthranila	96.47
PRK05282		233	(alpha)-aspartyl dipeptidase; Validated	96.34
PF09825		367	BPL_N: Biotin-protein ligase, N terminal; InterPro	96.24
COG3442		250	Predicted glutamine amidotransferase [General func	95.93
KOG0370\|consensus		1435		95.19
cd03129		210	GAT1_Peptidase_E_like Type 1 glutamine amidotransf	94.87
PLN02557		379	phosphoribosylformylglycinamidine cyclo-ligase	94.49
KOG1224\|consensus		767		94.24
KOG3210\|consensus		226		94.2
KOG1559\|consensus		340		94.16
KOG1622\|consensus		552		93.5
COG3155		217	ElbB Uncharacterized protein involved in an early	93.46
KOG3179\|consensus		245		93.4
COG4977		328	Transcriptional regulator containing an amidase do	93.26
COG4285		253	Uncharacterized conserved protein [Function unknow	88.71
PRK05368		302	homoserine O-succinyltransferase; Provisional	88.04
TIGR02069		250	cyanophycinase cyanophycinase. This model describe	87.45
cd03145		217	GAT1_cyanophycinase Type 1 glutamine amidotransfer	87.1
PF03575		154	Peptidase_S51: Peptidase family S51; InterPro: IPR	86.48
cd02203		313	PurL_repeat1 PurL subunit of the formylglycinamide	81.07

>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

Probab=100.00  E-value=1.9e-101  Score=952.07  Aligned_cols=607  Identities=35%  Similarity=0.517  Sum_probs=500.7

Q ss_pred             CeeeeCCCCcCccccccccccccccCCCC------CCCcc-------------------cEEEecccccccCCCCc-ccc
Q psy5570           1 MYLGIHPGAFSRVPYHGAHSSQHIRAPGP------EQRHA-------------------PCISHIVTLTSYISIPQ-VFT   54 (875)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~-------------------~~~~~~~~~~l~~~~P~-~~~   54 (875)
                      |.|+|.|++++++..    +|+++++|+.      +++++                   ..++|||...|++++|+ .|+
T Consensus       546 m~l~V~p~~~~~f~~----i~~re~~~~~vVG~vT~~~rl~v~~~~~~~~~~~~g~~~~~~~~dlp~~~l~~~~P~~~~~  621 (1307)
T PLN03206        546 DALLIKPESRDLLQS----ICDRERCSMAVIGTIDGSGRVVLVDSAAPEKCEANGLPPPPPAVDLDLEKVLGDMPQKTFE  621 (1307)
T ss_pred             heeeECcccHHHHHH----HHHHcCCCeEEEEEEecCCeEEEEECCccccccccccccCceeEEEEhHHhcCCCCccccc
Confidence            899999999999999    9999999996      33232                   34578988889999999 998


Q ss_pred             cccCCCCCCCCCCCCCcCHHHHHHHHhcCcccccccceeecccccccceeEeccccCCCCCCcCceEEEEEecCCcEEEE
Q psy5570          55 LARAPGFPTTAHTPPNISVLQALNNVMRLVSVGSKRFLTNKVDRCVTGLIAQQQCVGPLHTPLADVAVVALVHNDLRGAA  134 (875)
Q Consensus        55 ~~~~~~~~~~~~~p~~~dl~~~l~~vL~~pnVaSK~~l~~qyD~~Vgg~tv~~P~vGp~~~p~sDaaV~~~~~~~~~g~a  134 (875)
                      .++.++...+.++|...+++++|+++|++||||||+||++||||+|||+||+||+|||||.|++|++|+++...+.+|+|
T Consensus       622 ~~~~~~~~~~~~~~~~~~~~~~l~~vL~~pnVaSK~~l~~~~D~~V~g~vv~~~~vGp~q~p~aD~aV~~~~~~~~~g~a  701 (1307)
T PLN03206        622 FKRVANKLEPLDIPPGITVMDALKRVLRLPSVCSKRFLTTKVDRCVTGLVAQQQTVGPLQIPLADVAVIAQTHTGLTGGA  701 (1307)
T ss_pred             cccccccccccccCCCcCHHHHHHHHhcCCccccccchhhhcccccCceEcccCccCCccCCCcceeEEEEeCCCCeEEE
Confidence            88865444444444456899999999999999999999999999999999999999999999999999998765679999


Q ss_pred             EEecCCCcccccCHHHHHHHHHHHHHhhccccCCcccccceeccccccccccCCcccccccCcc----hhcccccccccc
Q psy5570         135 TSIGEQPIKGLVDPKRGARMAVAEALTNLVFAKISDLKFLFASSRSIHIFHYSFSGRFAFKNHG----IYDHLDRSQCLP  210 (875)
Q Consensus       135 ms~G~~p~~~~~dPy~GA~~AV~EAl~Nlva~g~~~l~~i~ls~n~~~~~~~~~~~~w~~g~P~----l~~a~~a~~~~~  210 (875)
                      ||+|+||+++.+|||+||++||+||+|||+|++..+++++.+++|||          |++++|+    ||++     |+|
T Consensus       702 ~s~G~~p~~~~~dp~~ga~~AV~Ea~~Nlvaa~~~~l~di~~s~nw~----------~~~~~p~~~~~l~~a-----v~g  766 (1307)
T PLN03206        702 CAIGEQPIKGLVDPKAMARLAVGEALTNLVWAKVTALSDVKASGNWM----------YAAKLDGEGADMYDA-----AVA  766 (1307)
T ss_pred             EEecCCCceeeeCHHHHHHHHHHHHHhHhhccCCCcHHHeEEEcChh----------HhhcCCCCHHHHHHH-----HHH
Confidence            99999999999999999999999999999999877899999999999          8888886    6666     999


Q ss_pred             hHHhhhhcCCcccCCCCCCCCCCc--cccccccccc-cccccccccccCCCccccCCCcceecceeeecccEEEEccccc
Q psy5570         211 IRYVDDNNKITEDYPMNPNGSPGK--RERKKKTGRY-LGKYGHGAVQKGMPFKDYHGKTGRVFNVTQHAVGVIVNKRVRT  287 (875)
Q Consensus       211 l~d~~~~lgiP~i~gkdsm~~~~~--~~~~~~~~~~-~~~~~~~si~~g~p~kd~~g~Tg~v~~~~~~a~g~~v~k~v~~  287 (875)
                      ++|+|++||||+|+|||||||++.  ++.+..|+|| |++++.                  +             .+++.
T Consensus       767 ~~~~~~~Lgipii~GKdSls~~~~~~~~~~~~P~TLvIs~~~~------------------v-------------~Dv~~  815 (1307)
T PLN03206        767 LRDAMIELGVAIDGGKDSLSMAAQAGGEVVKAPGNLVISAYVT------------------C-------------PDITK  815 (1307)
T ss_pred             HHHHHHHcCCCcccCeecCCCCCCCCCCCcCCCCCEEEEEEEE------------------c-------------CCccc
Confidence            999999999999999999999875  3567777777 555542                  1             12222


Q ss_pred             ccccccccccCCCCCcceEEEEEEeeCCcccccccccccccccchhHHHHHHHHHHHHHHhhccccccccccCCCCccCC
Q psy5570         288 RIIPKSAEKISSSVSRKTCLAQFYVADGKLSCQLYQRSADMGLGVPFNIASYSLLTYMIAHVTGLQRTSNMTNSKGYRRG  367 (875)
Q Consensus       288 ritp~l~~~~~~sk~~~s~laq~~v~~g~l~~~l~qrS~D~~Lg~~fn~~qya~l~~~~a~~~~l~~~~~m~~skG~r~~  367 (875)
                      .+                                                                              
T Consensus       816 ~v------------------------------------------------------------------------------  817 (1307)
T PLN03206        816 TV------------------------------------------------------------------------------  817 (1307)
T ss_pred             Cc------------------------------------------------------------------------------
Confidence            33                                                                              


Q ss_pred             ccccccccccccCCCCcceeeEEeecCCEEEE---ecccccccCccccccC-CcccccCC--CCCCCCCcccCchHHHHH
Q psy5570         368 TRDLFSRPFRRHGTIPLSVYMKVYKVGDIVDI---KCAESFYDRMTECVYS-SPLTSFNH--GIKPDPWFYVDVMGKGKV  441 (875)
Q Consensus       368 Tr~~~Sk~fr~~G~~pls~~l~~yk~GD~V~I---~~~~sv~kg~p~~~~g-~~~~v~~~--G~~p~~~~~~~~~~~~~~  441 (875)
                           +++||+.              ||.+++   .|...      .++-| .+.+++++  +..|+    +++++.+|.
T Consensus       818 -----tp~lK~~--------------G~~vlL~idlG~~~------~~LGGS~~~q~~~~~g~~~Pd----v~d~~~lK~  868 (1307)
T PLN03206        818 -----TPDLKLG--------------DDGVLLHVDLGKGK------RRLGGSALAQAYDQIGDDCPD----LDDVAYLKK  868 (1307)
T ss_pred             -----ChhhcCC--------------CCEEEEEEecCCCC------cCccccHHHHHhCccCCCCCC----CCCHHHHHH
Confidence                 3334321              333222   11110      11111 12334555  44899    888999999


Q ss_pred             HHHHHH-hH---HhhhhcccCC-ChHHHHhcCCcccccCCCCCCCceEEEeCCcchhHHHHhhhhccccchhhhhhhhcc
Q psy5570         442 AFNSNS-LV---FFQCAESFYD-RMTECVYSSPLTSFNHGIKPDPWFYVDVMGKGKVALQEVNQKLGQIGLLFIYFIVQR  516 (875)
Q Consensus       442 ~f~~~~-li---~i~s~hdvsD-GL~~al~eMa~~~~~~G~~~~~~~~Idl~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  516 (875)
                      +|+.++ +|   +|.|+||+|| ||++||+||| |++++|++      ||+....                        .
T Consensus       869 ~f~av~~Li~~glV~A~HDvSdGGL~~ALaEMA-fag~~G~~------Idl~~~~------------------------~  917 (1307)
T PLN03206        869 AFEATQDLIAKRLISAGHDISDGGLVVTLLEMA-FAGNCGIN------VDLPSSG------------------------H  917 (1307)
T ss_pred             HHHHHHHHHHCCCeeEEEeCCcCHHHHHHHHHH-hhcCCcEE------EEeCCcc------------------------c
Confidence            999999 88   8999999999 8999999999 99999999      8875311                        0


Q ss_pred             hhhhhhccccceee--EecCCHHHHHHHHHhhcCCCCCCCceeecccccCcccccceeeEEEEECCEeeccccHHHHHHH
Q psy5570         517 TKLCIVQRHEVGLA--FDEWDLEYYTDIFRNKLKRNPTSVECFDLAQSNSEHSRHWFFKISVAVNNEPVLNEDLGTLFLI  594 (875)
Q Consensus       517 ~~~~~LFsE~~G~v--v~~~d~~~v~~~f~~~l~r~p~~ve~~~IGqvnseh~~h~~~~~~i~~~g~~i~~~~l~~L~~~  594 (875)
                      +.++.||+|++|++  |.+++.+.+.++++.      .++.+..||+++++      ..+.|..+|+.+.+.++++|+++
T Consensus       918 ~~~~~LFsEs~G~VieV~~e~~~~v~~~l~~------~gi~~~vIG~vt~~------~~i~I~~~g~~~l~~~l~eL~~~  985 (1307)
T PLN03206        918 SAFETLFAEELGLVLEVSRKNLDAVMEKLAA------AGVTAEVIGQVTAS------PLIEVKVDGATCLSEKTASLRDM  985 (1307)
T ss_pred             hHHHHHhCCCccEEEEEehhHHHHHHHHHHH------CCCCeEEEEEECCC------CeEEEEECCEEEEecCHHHHHHH
Confidence            13478999999977  556677888898987      68889999999875      35777778888888999999999


Q ss_pred             HHHHHHHHHhhhcCccchhhhhhhccccCCCcee--cCCCCcccccccccccccccCCcccCCCCccccccccccccceE
Q psy5570         595 WERTSYELEKLQMNARCADEEYNSLVTRIGPKYQ--YQPVRDDIVGATLGKKVTRIGPKYQYQPVRDDIVGATLGKKVIS  672 (875)
Q Consensus       595 w~~ts~~i~~~~~np~~a~~e~~~~~~~~~p~~~--f~p~~~~~~~~~~~~~~~~~~~thn~p~~~~p~~ga~~~~~~~k  672 (875)
                      |++|||+++++|+||.|+++|+..+.++.++.++  |+|...                       ..++   ..+.++||
T Consensus       986 W~~tS~~le~l~~~~~~~~~e~~~~~~~~~~~~~l~f~~~~~-----------------------~~~~---~~~~~~pk 1039 (1307)
T PLN03206        986 WEETSFQLEKLQRLESCVAQEKEGLKSRKAPTWKLSFTPAFT-----------------------DKKI---MNATSKPK 1039 (1307)
T ss_pred             HhccChhhhhccCCchhhhHHHhhhhccCCceeecccCcccc-----------------------cccc---ccCCCCCe
Confidence            9999999999999999999998766665555332  444310                       0011   12457899


Q ss_pred             EEEEecCCCCCHHHHHHHHHHcCCeeEEEEeecccccccCccCccEEEEcCCcCccccccchhHHHHHHhhchhHHHHHH
Q psy5570         673 IAVLREEGINGDREMSAMAQVCGFEVWDITVQDLLENKITLDRFKGLVFPGGFSYADALGSAKGWAASLLLNEGIKTQLN  752 (875)
Q Consensus       673 VaIlv~pG~n~~~e~~~A~~~aG~~v~~V~~~dl~~~~~~l~~~d~lvlPGGfS~gD~l~~s~~~a~ail~~~~i~~~v~  752 (875)
                      |+|++|||+||++||++||+++||++++||++||.++...|++|++|+|||||||||+++++++||+++++|++++++|+
T Consensus      1040 VaVl~~pGtN~~~e~~~Af~~aGf~~~~V~~~dl~~~~~~L~~~~glv~pGGFSyGD~l~sg~~wa~~i~~n~~~~~~~~ 1119 (1307)
T PLN03206       1040 VAIIREEGSNGDREMAAAFYAAGFEPWDVTMSDLLNGRISLDDFRGIVFVGGFSYADVLDSAKGWAGSIRFNEPLLQQFQ 1119 (1307)
T ss_pred             EEEEECCCCCCHHHHHHHHHHcCCceEEEEeeecccccccccceeEEEEcCcCCCccccchHHHHHHHHHhChHHHHHHH
Confidence            99999999999999999999999999999999999998889999999999999999999999999999999999999999


Q ss_pred             HHHHCCCceEEEEehhHHHHHhcCCCCCCc-------------cccccCCCCeEEeccEEec--cC------Cc--eEEE
Q psy5570         753 KFIARSDTFSFGVCNGCQLMNLLGWFSVST-------------QARQPYIKSRVRCPPLKKE--KS------GV--NITR  809 (875)
Q Consensus       753 ~f~~r~g~~vLGICnGfQiL~elGlLpg~~-------------~t~~~n~~~~f~~~~v~v~--~~------~~--~~~r  809 (875)
                      +|++++|+|+||||||||||+++|||||..             +++.+|.++||+||||.+.  ++      ++  ..+.
T Consensus      1120 ~f~~~~d~~~LGICNGfQiL~~lgllPg~~~~~~~~~~~~e~~p~l~~N~s~rfesr~v~v~V~~s~si~l~~~~G~~l~ 1199 (1307)
T PLN03206       1120 EFYNRPDTFSLGVCNGCQLMALLGWVPGPQVGGGLGAGGDPSQPRFVHNESGRFECRFTSVTIEDSPAIMLKGMEGSTLG 1199 (1307)
T ss_pred             HHHhCCCceEEEEcHHHHHHHHcCCCCCCccccccccccccCCceeeecCCCCeEEeceEEEECCCCChhhcccCCCEEE
Confidence            999878999999999999999999999862             4568899999999999984  21      23  4688


Q ss_pred             eecce-----eecCHHHHHHHHhCCCcee
Q psy5570         810 LSITL-----NFSTSDTLSWLLDSNTNVT  833 (875)
Q Consensus       810 ~pi~~-----~f~~~~~l~~l~~~~~~~~  833 (875)
                      +||+|     ||.+++++++|++|||-++
T Consensus      1200 i~vaHgEGr~~~~~~~~l~~l~~~gqva~ 1228 (1307)
T PLN03206       1200 VWAAHGEGRAYFPDESVLDEVLKSNLAPV 1228 (1307)
T ss_pred             EEEEcCCCCeecCCHHHHHHHHhcCeEEE
Confidence            88999     5567778999999998653

>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form	Back alignment and domain information

>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>KOG1907\|consensus	Back alignment and domain information

>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II	Back alignment and domain information

>PHA03366 FGAM-synthase; Provisional	Back alignment and domain information

>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase	Back alignment and domain information

>COG0046 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK01213 phosphoribosylformylglycinamidine synthase II; Provisional	Back alignment and domain information

>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01736 FGAM_synth_II phosphoribosylformylglycinamidine synthase II	Back alignment and domain information

>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A	Back alignment and domain information

>PRK14090 phosphoribosylformylglycinamidine synthase II; Provisional	Back alignment and domain information

>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional	Back alignment and domain information

>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase	Back alignment and domain information

>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional	Back alignment and domain information

>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I	Back alignment and domain information

>cd02193 PurL Formylglycinamide ribonucleotide amidotransferase (FGAR-AT) catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, phosphate, and glutamate in the fourth step of the purine biosynthetic pathway	Back alignment and domain information

>cd02204 PurL_repeat2 PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), second repeat	Back alignment and domain information

>KOG1907\|consensus	Back alignment and domain information

>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>PRK04306 50S ribosomal protein L21e; Reviewed	Back alignment and domain information

>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form	Back alignment and domain information

>PTZ00189 60S ribosomal protein L21; Provisional	Back alignment and domain information

>PLN00190 60S ribosomal protein L21; Provisional	Back alignment and domain information

>PRK14090 phosphoribosylformylglycinamidine synthase II; Provisional	Back alignment and domain information

>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PF01157 Ribosomal_L21e: Ribosomal protein L21e; InterPro: IPR001147 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>TIGR03267 methan_mark_2 putative methanogenesis marker protein 2	Back alignment and domain information

>COG2139 RPL21A Ribosomal protein L21E [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd02203 PurL_repeat1 PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat	Back alignment and domain information

>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional	Back alignment and domain information

>PRK13526 glutamine amidotransferase subunit PdxT; Provisional	Back alignment and domain information

>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II	Back alignment and domain information

>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional	Back alignment and domain information

>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional	Back alignment and domain information

>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>TIGR01736 FGAM_synth_II phosphoribosylformylglycinamidine synthase II	Back alignment and domain information

>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only]	Back alignment and domain information

>PTZ00189 60S ribosomal protein L21; Provisional	Back alignment and domain information

>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex	Back alignment and domain information

>PLN00190 60S ribosomal protein L21; Provisional	Back alignment and domain information

>cd00396 PurM-like AIR (aminoimidazole ribonucleotide) synthase related protein	Back alignment and domain information

>cd02192 PurM-like3 AIR synthase (PurM) related protein, subgroup 3 of unknown function	Back alignment and domain information

>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PRK05731 thiamine monophosphate kinase; Provisional	Back alignment and domain information

>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>KOG1732\|consensus	Back alignment and domain information

>PRK01213 phosphoribosylformylglycinamidine synthase II; Provisional	Back alignment and domain information

>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>TIGR01379 thiL thiamine-monophosphate kinase	Back alignment and domain information

>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2	Back alignment and domain information

>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1	Back alignment and domain information

>TIGR01382 PfpI intracellular protease, PfpI family	Back alignment and domain information

>PRK13527 glutamine amidotransferase subunit PdxT; Provisional	Back alignment and domain information

>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ)	Back alignment and domain information

>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus	Back alignment and domain information

>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS)	Back alignment and domain information

>cd02194 ThiL ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine	Back alignment and domain information

>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus	Back alignment and domain information

>COG0207 ThyA Thymidylate synthase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF01157 Ribosomal_L21e: Ribosomal protein L21e; InterPro: IPR001147 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>PRK13525 glutamine amidotransferase subunit PdxT; Provisional	Back alignment and domain information

>cd02196 PurM PurM (Aminoimidazole Ribonucleotide [AIR] synthetase), one of eleven enzymes required for purine biosynthesis, catalyzes the conversion of formylglycinamide ribonucleotide (FGAM) and ATP to AIR, ADP, and Pi, the fifth step in de novo purine biosynthesis	Back alignment and domain information

>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein	Back alignment and domain information

>KOG0623\|consensus	Back alignment and domain information

>cd02195 SelD Selenophosphate synthetase (SelD) catalyzes the conversion of selenium to selenophosphate which is required by a number of bacterial, archaeal and eukaryotic organisms for synthesis of Secys-tRNA, the precursor of selenocysteine in selenoenzymes	Back alignment and domain information

>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase	Back alignment and domain information

>PRK04155 chaperone protein HchA; Provisional	Back alignment and domain information

>TIGR02124 hypE hydrogenase expression/formation protein HypE	Back alignment and domain information

>KOG0673\|consensus	Back alignment and domain information

>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional	Back alignment and domain information

>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit	Back alignment and domain information

>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1	Back alignment and domain information

>PRK11574 oxidative-stress-resistance chaperone; Provisional	Back alignment and domain information

>PRK13821 thyA thymidylate synthase; Provisional	Back alignment and domain information

>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31)	Back alignment and domain information

>COG0046 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01383 not_thiJ DJ-1 family protein	Back alignment and domain information

>cd02197 HypE HypE (Hydrogenase expression/formation protein)	Back alignment and domain information

>KOG2764\|consensus	Back alignment and domain information

>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein	Back alignment and domain information

>TIGR03284 thym_sym thymidylate synthase	Back alignment and domain information

>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity	Back alignment and domain information

>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus	Back alignment and domain information

>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PRK04306 50S ribosomal protein L21e; Reviewed	Back alignment and domain information

>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases	Back alignment and domain information

>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis	Back alignment and domain information

>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase	Back alignment and domain information

>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit	Back alignment and domain information

>KOG1732\|consensus	Back alignment and domain information

>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus	Back alignment and domain information

>TIGR00878 purM phosphoribosylaminoimidazole synthetase	Back alignment and domain information

>cd06061 PurM-like1 AIR synthase (PurM) related protein, subgroup 1 of unknown function	Back alignment and domain information

>PRK01827 thyA thymidylate synthase; Reviewed	Back alignment and domain information

>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain	Back alignment and domain information

>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group []	Back alignment and domain information

>COG2144 Selenophosphate synthetase-related proteins [General function prediction only]	Back alignment and domain information

>PTZ00164 bifunctional dihydrofolate reductase-thymidylate synthase; Provisional	Back alignment and domain information

>PRK00784 cobyric acid synthase; Provisional	Back alignment and domain information

>PRK00758 GMP synthase subunit A; Validated	Back alignment and domain information

>PRK06490 glutamine amidotransferase; Provisional	Back alignment and domain information

>PRK06895 putative anthranilate synthase component II; Provisional	Back alignment and domain information

>PRK06278 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PRK01077 cobyrinic acid a,c-diamide synthase; Validated	Back alignment and domain information

>TIGR00379 cobB cobyrinic acid a,c-diamide synthase	Back alignment and domain information

>PF00586 AIRS: AIR synthase related protein, N-terminal domain; InterPro: IPR000728 This family includes Hydrogen expression/formation protein, HypE, which may be involved in the maturation of NifE hydrogenase; AIR synthase and FGAM synthase, which are involved in de novo purine biosynthesis; and selenide, water dikinase, an enzyme which synthesizes selenophosphate from selenide and ATP	Back alignment and domain information

>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II	Back alignment and domain information

>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PRK06186 hypothetical protein; Validated	Back alignment and domain information

>PRK05385 phosphoribosylaminoimidazole synthetase; Provisional	Back alignment and domain information

>cd00351 TS_Pyrimidine_HMase Thymidylate synthase and pyrimidine hydroxymethylase: Thymidylate synthase (TS) and deoxycytidylate hydroxymethylase (dCMP-HMase) are homologs that catalyze analogous alkylation of C5 of pyrimidine nucleotides	Back alignment and domain information

>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP)	Back alignment and domain information

>PRK08250 glutamine amidotransferase; Provisional	Back alignment and domain information

>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain	Back alignment and domain information

>PRK07053 glutamine amidotransferase; Provisional	Back alignment and domain information

>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>TIGR00313 cobQ cobyric acid synthase CobQ	Back alignment and domain information

>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase	Back alignment and domain information

>TIGR03283 thy_syn_methano thymidylate synthase, methanogen type	Back alignment and domain information

>PLN02347 GMP synthetase	Back alignment and domain information

>PRK00074 guaA GMP synthase; Reviewed	Back alignment and domain information

>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade	Back alignment and domain information

>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional	Back alignment and domain information

>PRK05380 pyrG CTP synthetase; Validated	Back alignment and domain information

>PRK00956 thyA thymidylate synthase; Provisional	Back alignment and domain information

>PLN02327 CTP synthase	Back alignment and domain information

>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea []	Back alignment and domain information

>PRK00943 selenophosphate synthetase; Provisional	Back alignment and domain information

>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase	Back alignment and domain information

>PF00303 Thymidylat_synt: Thymidylate synthase; InterPro: IPR000398 Thymidylate synthase (2	Back alignment and domain information

>PRK11249 katE hydroperoxidase II; Provisional	Back alignment and domain information

>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E	Back alignment and domain information

>PRK07765 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism]	Back alignment and domain information

>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>TIGR00337 PyrG CTP synthase	Back alignment and domain information

>cd02691 PurM-like2 AIR synthase (PurM) related protein, archaeal subgroup 2 of unknown function	Back alignment and domain information

>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed	Back alignment and domain information

>PRK09393 ftrA transcriptional activator FtrA; Provisional	Back alignment and domain information

>PRK13566 anthranilate synthase; Provisional	Back alignment and domain information

>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ]	Back alignment and domain information

>PLN02335 anthranilate synthase	Back alignment and domain information

>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain	Back alignment and domain information

>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C	Back alignment and domain information

>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>CHL00101 trpG anthranilate synthase component 2	Back alignment and domain information

>COG2139 RPL21A Ribosomal protein L21E [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05665 amidotransferase; Provisional	Back alignment and domain information

>PRK05637 anthranilate synthase component II; Provisional	Back alignment and domain information

>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed	Back alignment and domain information

>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional	Back alignment and domain information

>PRK05670 anthranilate synthase component II; Provisional	Back alignment and domain information

>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit	Back alignment and domain information

>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional	Back alignment and domain information

>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase	Back alignment and domain information

>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated	Back alignment and domain information

>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]	Back alignment and domain information

>PF02769 AIRS_C: AIR synthase related protein, C-terminal domain; InterPro: IPR010918 This entry includes Hydrogen expression/formation protein, HypE, which may be involved in the maturation of NifE hydrogenase; AIR synthase and FGAM synthase, which are involved in de novo purine biosynthesis; and selenide, water dikinase, an enzyme which synthesizes selenophosphate from selenide and ATP	Back alignment and domain information

>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase	Back alignment and domain information

>PRK07567 glutamine amidotransferase; Provisional	Back alignment and domain information

>PRK06774 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>PRK08007 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>PRK09065 glutamine amidotransferase; Provisional	Back alignment and domain information

>COG0611 ThiL Thiamine monophosphate kinase [Coenzyme metabolism]	Back alignment and domain information

>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing)	Back alignment and domain information

>PRK14105 selenophosphate synthetase; Provisional	Back alignment and domain information

>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade	Back alignment and domain information

>TIGR00476 selD selenium donor protein	Back alignment and domain information

>PRK08857 para-aminobenzoate synthase component II; Provisional	Back alignment and domain information

>KOG2387\|consensus	Back alignment and domain information

>COG2071 Predicted glutamine amidotransferases [General function prediction only]	Back alignment and domain information

>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism]	Back alignment and domain information

>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]	Back alignment and domain information

>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism]	Back alignment and domain information

>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional	Back alignment and domain information

>PLN02889 oxo-acid-lyase/anthranilate synthase	Back alignment and domain information

>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional	Back alignment and domain information

>PRK05282 (alpha)-aspartyl dipeptidase; Validated	Back alignment and domain information

>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown	Back alignment and domain information

>COG3442 Predicted glutamine amidotransferase [General function prediction only]	Back alignment and domain information

>KOG0370\|consensus	Back alignment and domain information

>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins	Back alignment and domain information

>PLN02557 phosphoribosylformylglycinamidine cyclo-ligase	Back alignment and domain information

>KOG1224\|consensus	Back alignment and domain information

>KOG3210\|consensus	Back alignment and domain information

>KOG1559\|consensus	Back alignment and domain information

>KOG1622\|consensus	Back alignment and domain information

>COG3155 ElbB Uncharacterized protein involved in an early stage of isoprenoid biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG3179\|consensus	Back alignment and domain information

>COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription]	Back alignment and domain information

>COG4285 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK05368 homoserine O-succinyltransferase; Provisional	Back alignment and domain information

>TIGR02069 cyanophycinase cyanophycinase	Back alignment and domain information

>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase	Back alignment and domain information

>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>cd02203 PurL_repeat1 PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		875
3ugj_A		1303	Formyl Glycinamide Ribonucletide Amidotransferase F		1e-27
1t3t_A		1303	Structure Of Formylglycinamide Synthetase Length =		2e-26
3ihi_A		307	Crystal Structure Of Mouse Thymidylate Synthase Len		4e-18
1rts_A		307	Thymidylate Synthase From Rat In Ternary Complex Wi		4e-18
3egy_X		313	Crystal Structure Of Human Thymidyalte Synthase A19		5e-17
1hw3_A		313	Structure Of Human Thymidylate Synthase Suggests Ad		6e-17
3n5g_A		325	Crystal Structure Of Histidine-Tagged Human Thymidy		6e-17
3ebu_A		313	Replacement Of Val3 In Human Thymidylate Synthase A		7e-17
3n5e_A		325	Crystal Structure Of Human Thymidylate Synthase Bou		7e-17
4e28_A		325	Structure Of Human Thymidylate Synthase In Inactive		8e-17
3n5e_B		325	Crystal Structure Of Human Thymidylate Synthase Bou		8e-17
3ehi_X		313	Crystal Structure Of Human Thymidyalte Synthase M19		8e-17
3eaw_X		313	Replacement Of Val3 In Human Thymidylate Synthase A		8e-17
1hw4_A		355	Structure Of Thymidylate Synthase Suggests Advantag		9e-17
3gh2_X		313	Replacement Of Val3 In Human Thymidylate Synthase A		9e-17
2rd8_B		313	Human Thymidylate Synthase Stabilized In Active Con		9e-17
1ju6_A		313	Human Thymidylate Synthase Complex With Dump And Ly		9e-17
2rd8_A		313	Human Thymidylate Synthase Stabilized In Active Con		9e-17
3ef9_A		313	Replacement Of Val3 In Human Thymidylate Synthase A		1e-16
4gyh_A		318	Structure Of Human Thymidylate Synthase At High Sal		1e-16
3edw_X		313	Replacement Of Val3 In Human Thymidylate Synthase A		1e-16
3gg5_A		313	Replacement Of Val3 In Human Thymidylate Synthase A		1e-16
1hvy_A		288	Human Thymidylate Synthase Complexed With Dump And		1e-16
1hzw_A		290	Crystal Structure Of Human Thymidylate Synthase Len		1e-16
3ed7_A		295	Replacement Of Val3 In Human Thymidylate Synthase A		1e-16
3uwl_A		315	Crystal Structure Of Enteroccocus Faecalis Thymidyl		2e-16
3ix6_A		360	Crystal Structure Of Thymidylate Synthase Thya From		2e-16
3uwl_B		315	Crystal Structure Of Enteroccocus Faecalis Thymidyl		5e-16
3kgb_A		294	Crystal Structure Of Thymidylate Synthase 12 FROM E		2e-15
1bo8_A		316	Thymidylate Synthase R178t Mutant Length = 316		3e-15
1bp6_A		316	Thymidylate Synthase R23i, R179t Double Mutant Leng		3e-15
1bo7_A		316	Thymidylate Synthase R179t Mutant Length = 316		3e-15
4dq1_A		321	Thymidylate Synthase From Staphylococcus Aureus. Le		4e-15
3inv_A		521	Trypanosoma Cruzi Dihydrofolate Reductase-Thymidyla		7e-15
2h2q_A		521	Crystal Structure Of Trypanosoma Cruzi Dihydrofolat		7e-15
1tsv_A		316	Thymidylate Synthase R179a Mutant Length = 316		1e-14
1tsx_A		316	Thymidylate Synthase R179e Mutant Length = 316		1e-14
2g8d_A		316	Lactobacillus Casei Thymidylate Synthase Y261w-dump		1e-14
2g86_A		316	L. Casei Thymidylate Synthase Y261f In Complex With		1e-14
1tsy_A		316	Thymidylate Synthase R179k Mutant Length = 316		1e-14
2g8a_A		316	Lactobacillus Casei Y261m In Complex With Substrate		1e-14
2g89_A		316	L. Casei Thymidylate Synthase Y261a In Complex With		1e-14
1lca_A		316	Lactobacillus Casei Thymidylate Synthase Ternary Co		1e-14
1vza_A		316	Thymidylate Synthase E60d Mutant Binary Complex Wit		1e-14
1bp0_A		316	Thymidylate Synthase R23i Mutant Length = 316		1e-14
1vzb_A		316	L. Casei Thymidylate Synthase Mutant E60q Binary Co		1e-14
1tda_A		315	Structures Of Thymidylate Synthase With A C-Termina		1e-14
3um5_A		608	Double Mutant (A16v+s108t) Plasmodium Falciparum Di		2e-14
3qgt_A		608	Crystal Structure Of Wild-Type Pfdhfr-Ts Complexed		2e-14
3jsu_A		608	Quadruple Mutant(N51i+c59r+s108n+i164l) Plasmodium		2e-14
1bpj_A		316	Thymidylate Synthase R178t, R179t Double Mutant Len		2e-14
1njc_A		316	Thymidylate Synthase, Mutation, N229d With 2'-Deoxy		4e-14
1j3i_C		328	Wild-Type Plasmodium Falciparum Dihydrofolate Reduc		5e-14
1jmi_A		316	Contributions Of Orientation And Hydrogen Bonding T		6e-14
3qj7_A		264	Crystal Structure Of The Mycobacterium Tuberculosis		7e-14
3i3r_A		511	X-Ray Structure Dihydrofolate ReductaseTHYMIDYLATE		8e-14
1jmg_A		316	Contributions Of Orientation And Hydrogen Bonding T		8e-14
3nrr_A		515	Co-Crystal Structure Of Dihydrofolate Reductase-Thy		8e-14
1jmf_A		316	Contributions Of Orientation And Hydrogen Bonding T		1e-13
2zkr_q		160	Structure Of A Mammalian Ribosomal 60s Subunit With		1e-13
1nja_A		316	Thymidylate Synthase, Mutation, N229c With 2'-deoxy		2e-13
1jmh_A		316	Contributions Of Orientation And Hydrogen Bonding T		2e-13
3bgx_A		264	E. Coli Thymidylate Synthase C146s Mutant Complexed		2e-12
1qqq_A		264	Crystal Structure Analysis Of Ser254 Mutant Of Esch		3e-12
2g8m_B		264	Escherichia Coli Thymidylate Synthase Y209w In Comp		3e-12
3bfi_A		264	E. Coli Thymidylate Synthase Y209m Mutant Complexed		3e-12
2ftn_A		264	E. Coli Thymidylate Synthase Y94f Mutant Length = 2		3e-12
1f4d_A		264	Crystal Structure Of E. Coli Thymidylate Synthase C		3e-12
1aiq_A		264	Crystal Structure Of Thymidylate Synthase R126e Mut		3e-12
1kce_A		264	E. Coli Thymidylate Synthase Mutant E58q In Complex		3e-12
2tsc_A		264	Structure, Multiple Site Binding, And Segmental Acc		4e-12
1tlc_A		265	Thymidylate Synthase Complexed With Dgmp And Folate		4e-12
2bbq_A		264	Structural Basis For Recognition Of Polyglutamyl Fo		4e-12
2vf0_A		264	Crystal Structure Of The Thymidylate Synthase K48q		4e-12
1zpr_A		264	E. Coli Thymidylate Synthase Mutant E58q In Complex		4e-12
2vet_A		264	Crystal Structure Of The Thymidylate Synthase K48q		4e-12
1jg0_A		264	Crystal Structure Of Escherichia Coli Thymidylate S		4e-12
1kzj_A		264	Crystal Structure Of Ects W80g/dump/cb3717 Complex		4e-12
1evf_A		264	Crystal Structure Analysis Of Cys167 Mutant Of Esch		5e-12
1evg_A		264	Crystal Structure Analysis Of Cys167 Mutant Of Esch		6e-12
1ev5_A		264	Crystal Structure Analysis Of Ala167 Mutant Of Esch		6e-12
1f4g_A		264	Crystal Structure Of E. Coli Thymidylate Synthase C		6e-12
1ci7_A		297	Ternary Complex Of Thymidylate Synthase From Pneumo		9e-12
1ev8_A		264	Crystal Structure Analysis Of Cys167 Mutant Of Esch		1e-11
1ffl_A		264	Crystal Structure Of The Apo-Thymidylate Synthase R		1e-11
1dna_A		264	D221(169)n Mutant Does Not Promote Opening Of The C		1e-11
1bq1_A		264	E. Coli Thymidylate Synthase Mutant N177a In Comple		3e-11
1nce_A		264	Crystal Structure Of A Ternary Complex Of E. Coli T		4e-11
2aaz_B		317	Cryptococcus Neoformans Thymidylate Synthase Comple		8e-11
2oip_A		519	Crystal Structure Of The S290g Active Site Mutant O		2e-10
3hj3_A		521	Crystal Structure Of The Chts-Dhfr F207a Non-Active		2e-10
1qzf_A		521	Crystal Structure Of Dhfr-Ts From Cryptosporidium H		2e-10
3dl6_A		521	Crystal Structure Of The A287fS290G ACTIVE SITE MUT		2e-10
3dl5_A		521	Crystal Structure Of The A287f Active Site Mutant O		2e-10
1s1i_Q		100	Structure Of The Ribosomal 80s-Eef2-Sordarin Comple		3e-10
3izs_U		160	Localization Of The Large Subunit Ribosomal Protein		5e-10
3jyw_Q		116	Structure Of The 60s Proteins For Eukaryotic Riboso		9e-10
3izr_U		164	Localization Of The Large Subunit Ribosomal Protein		2e-09
3izr_U		164	Localization Of The Large Subunit Ribosomal Protein		4e-08
4f2v_A		272	Crystal Structure Of De Novo Designed Serine Hydrol		5e-08
3zf7_U		159	High-resolution Cryo-electron Microscopy Structure		2e-07
3zf7_U		159	High-resolution Cryo-electron Microscopy Structure		1e-04
4a17_P		157	T.Thermophila 60s Ribosomal Subunit In Complex With		6e-07
4a17_P		157	T.Thermophila 60s Ribosomal Subunit In Complex With		1e-04
1tis_A		286	Crystal Structure Of Thymidylate Synthase From T4 P		2e-06
1b02_A		279	Crystal Structure Of Thymidylate Synthase A From Ba		3e-06
1bko_A		278	Thermostable Thymidylate Synthase A From Bacillus S		3e-06

>pdb|3UGJ|A Chain A, Formyl Glycinamide Ribonucletide Amidotransferase From Salmonella Typhimurum: Role Of The Atp Complexation And Glutaminase Domain In Catalytic Coupling Length = 1303