Psyllid ID: psy6094
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 455 | ||||||
| 380029828 | 863 | PREDICTED: probable ATP-dependent RNA he | 0.338 | 0.178 | 0.431 | 3e-40 | |
| 110755029 | 964 | PREDICTED: probable ATP-dependent RNA he | 0.338 | 0.159 | 0.431 | 4e-40 | |
| 383865235 | 976 | PREDICTED: probable ATP-dependent RNA he | 0.345 | 0.160 | 0.434 | 9e-40 | |
| 350402556 | 977 | PREDICTED: probable ATP-dependent RNA he | 0.340 | 0.158 | 0.429 | 3e-39 | |
| 328711816 | 1055 | PREDICTED: probable ATP-dependent RNA he | 0.338 | 0.145 | 0.421 | 3e-39 | |
| 340711835 | 977 | PREDICTED: probable ATP-dependent RNA he | 0.340 | 0.158 | 0.429 | 1e-38 | |
| 488587119 | 856 | PREDICTED: LOW QUALITY PROTEIN: probable | 0.619 | 0.329 | 0.364 | 1e-38 | |
| 432891825 | 1050 | PREDICTED: probable ATP-dependent RNA he | 0.272 | 0.118 | 0.620 | 3e-38 | |
| 390349687 | 1040 | PREDICTED: probable ATP-dependent RNA he | 0.221 | 0.097 | 0.634 | 5e-38 | |
| 47224961 | 706 | unnamed protein product [Tetraodon nigro | 0.254 | 0.164 | 0.655 | 6e-38 |
| >gi|380029828|ref|XP_003698567.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like, partial [Apis florea] | Back alignment and taxonomy information |
|---|
Score = 172 bits (436), Expect = 3e-40, Method: Compositional matrix adjust.
Identities = 88/204 (43%), Positives = 119/204 (58%), Gaps = 50/204 (24%)
Query: 100 QQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCK 159
++YP +V++ L++P E ++ D+I L++HIC T+ PGA
Sbjct: 412 KKYPREVIDQLRNPYSEMMSLDLIEQLIRHICRTKAPGA--------------------- 450
Query: 160 NVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQI 219
ILVFLPG I L+R M + ++ S + I
Sbjct: 451 -----------------------------ILVFLPGMMDITKLNRMMLDTGCYSQSHYVI 481
Query: 220 IPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKD 279
PLHS +PT+ QK IF PP+GVRKI++AT+IAETSITI+D+VYV+DCGK K FD++
Sbjct: 482 YPLHSRMPTIDQKLIFKEPPKGVRKIIIATSIAETSITIEDVVYVIDCGKMKFGKFDIQK 541
Query: 280 NIATLKPEWISLANAKQRRGRAGR 303
NI TL+PEW+SLANAKQRRGRAGR
Sbjct: 542 NIQTLEPEWVSLANAKQRRGRAGR 565
|
Source: Apis florea Species: Apis florea Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|110755029|ref|XP_394965.3| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383865235|ref|XP_003708080.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350402556|ref|XP_003486528.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328711816|ref|XP_001947767.2| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|340711835|ref|XP_003394474.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|488587119|ref|XP_004478889.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase DHX36 [Dasypus novemcinctus] | Back alignment and taxonomy information |
|---|
| >gi|432891825|ref|XP_004075666.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Oryzias latipes] | Back alignment and taxonomy information |
|---|
| >gi|390349687|ref|XP_784575.3| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|47224961|emb|CAF97376.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 455 | ||||||
| RGD|1308767 | 1000 | Dhx36 "DEAH (Asp-Glu-Ala-His) | 0.356 | 0.162 | 0.497 | 4.5e-58 | |
| MGI|MGI:1919412 | 1001 | Dhx36 "DEAH (Asp-Glu-Ala-His) | 0.356 | 0.161 | 0.491 | 5.9e-58 | |
| UNIPROTKB|F6V8H1 | 1122 | DHX36 "Uncharacterized protein | 0.356 | 0.144 | 0.497 | 7e-58 | |
| UNIPROTKB|Q9H2U1 | 1008 | DHX36 "Probable ATP-dependent | 0.356 | 0.160 | 0.491 | 1.3e-57 | |
| UNIPROTKB|Q05B79 | 1010 | DHX36 "Uncharacterized protein | 0.356 | 0.160 | 0.491 | 2.8e-57 | |
| UNIPROTKB|E1C550 | 985 | DHX36 "Uncharacterized protein | 0.329 | 0.152 | 0.506 | 3e-57 | |
| ZFIN|ZDB-GENE-050419-20 | 1037 | si:dkey-119o24.1 "si:dkey-119o | 0.252 | 0.110 | 0.588 | 4.5e-54 | |
| UNIPROTKB|E7EWK3 | 797 | DHX36 "Probable ATP-dependent | 0.356 | 0.203 | 0.491 | 8e-51 | |
| TAIR|locus:2039280 | 995 | AT2G35920 [Arabidopsis thalian | 0.362 | 0.165 | 0.473 | 6.9e-45 | |
| TAIR|locus:2052841 | 1299 | HVT1 "helicase in vascular tis | 0.252 | 0.088 | 0.577 | 9.5e-44 |
| RGD|1308767 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 397 (144.8 bits), Expect = 4.5e-58, Sum P(4) = 4.5e-58
Identities = 84/169 (49%), Positives = 111/169 (65%)
Query: 189 ILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLA 248
ILVFLPGWD I++LH + F S RF IIPLHS++PTV+Q +F P GVRKIV+A
Sbjct: 483 ILVFLPGWDNISTLHDLLMSQVMFKSDRFLIIPLHSLMPTVNQTQVFKKTPPGVRKIVIA 542
Query: 249 TNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKRS 308
TNIAETSITIDD+VYV+D GK K ++FD ++NI+T+ EW+S ANAKQR+GRAGR
Sbjct: 543 TNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQPGH 602
Query: 309 ETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTT---QRPGAILVFL 354
Y ++L D +L +++ + L+ +C R G I FL
Sbjct: 603 CYHLYNGLRASLLDDYQLP----EILRTPLEELCLQIKILRLGGIAYFL 647
|
|
| MGI|MGI:1919412 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6V8H1 DHX36 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H2U1 DHX36 "Probable ATP-dependent RNA helicase DHX36" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05B79 DHX36 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C550 DHX36 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050419-20 si:dkey-119o24.1 "si:dkey-119o24.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EWK3 DHX36 "Probable ATP-dependent RNA helicase DHX36" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039280 AT2G35920 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2052841 HVT1 "helicase in vascular tissue and tapetum" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 455 | |||
| COG1643 | 845 | COG1643, HrpA, HrpA-like helicases [DNA replicatio | 4e-37 | |
| TIGR01970 | 819 | TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H | 5e-25 | |
| PRK11664 | 812 | PRK11664, PRK11664, ATP-dependent RNA helicase Hrp | 1e-20 | |
| TIGR01967 | 1283 | TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H | 8e-18 | |
| PRK11131 | 1294 | PRK11131, PRK11131, ATP-dependent RNA helicase Hrp | 3e-16 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 3e-13 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 3e-12 | |
| COG1643 | 845 | COG1643, HrpA, HrpA-like helicases [DNA replicatio | 1e-07 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 6e-07 | |
| TIGR01967 | 1283 | TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H | 3e-05 | |
| PRK11131 | 1294 | PRK11131, PRK11131, ATP-dependent RNA helicase Hrp | 2e-04 |
| >gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 144 bits (365), Expect = 4e-37
Identities = 51/116 (43%), Positives = 64/116 (55%), Gaps = 2/116 (1%)
Query: 189 ILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLA 248
ILVFLPG I + +I+PL+ L Q +F P G RK+VLA
Sbjct: 262 ILVFLPGQREIERTAEWL--EKAELGDDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLA 319
Query: 249 TNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRT 304
TNIAETS+TI I YV+D G K +D + + L+ E IS A+A QR GRAGRT
Sbjct: 320 TNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRT 375
|
Length = 845 |
| >gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 455 | |||
| KOG0923|consensus | 902 | 100.0 | ||
| KOG0922|consensus | 674 | 100.0 | ||
| KOG0924|consensus | 1042 | 100.0 | ||
| KOG0925|consensus | 699 | 100.0 | ||
| KOG0920|consensus | 924 | 100.0 | ||
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 100.0 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 100.0 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 100.0 | |
| KOG0926|consensus | 1172 | 100.0 | ||
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 100.0 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 100.0 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 100.0 | |
| KOG0921|consensus | 1282 | 100.0 | ||
| KOG0330|consensus | 476 | 100.0 | ||
| KOG0331|consensus | 519 | 100.0 | ||
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.97 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.97 | |
| KOG0328|consensus | 400 | 99.97 | ||
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.97 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.97 | |
| PTZ00110 | 545 | helicase; Provisional | 99.97 | |
| KOG0340|consensus | 442 | 99.97 | ||
| KOG0345|consensus | 567 | 99.96 | ||
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.96 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.96 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.96 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.96 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.96 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.96 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.96 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.96 | |
| KOG0333|consensus | 673 | 99.96 | ||
| KOG0342|consensus | 543 | 99.96 | ||
| KOG0343|consensus | 758 | 99.95 | ||
| KOG0338|consensus | 691 | 99.95 | ||
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.94 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.94 | |
| KOG0332|consensus | 477 | 99.94 | ||
| KOG0347|consensus | 731 | 99.94 | ||
| KOG0326|consensus | 459 | 99.93 | ||
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.93 | |
| KOG0341|consensus | 610 | 99.93 | ||
| KOG0336|consensus | 629 | 99.93 | ||
| KOG0339|consensus | 731 | 99.93 | ||
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.93 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.92 | |
| KOG0335|consensus | 482 | 99.92 | ||
| KOG0348|consensus | 708 | 99.92 | ||
| KOG0334|consensus | 997 | 99.91 | ||
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.91 | |
| KOG0327|consensus | 397 | 99.9 | ||
| KOG0346|consensus | 569 | 99.9 | ||
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.9 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.89 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.87 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.87 | |
| KOG0344|consensus | 593 | 99.87 | ||
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.86 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.86 | |
| KOG0350|consensus | 620 | 99.86 | ||
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.84 | |
| KOG4284|consensus | 980 | 99.84 | ||
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.83 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.83 | |
| KOG0337|consensus | 529 | 99.82 | ||
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.82 | |
| KOG0349|consensus | 725 | 99.81 | ||
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.76 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.76 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.74 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.74 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.73 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.72 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.7 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.69 | |
| KOG0354|consensus | 746 | 99.68 | ||
| PRK13766 | 773 | Hef nuclease; Provisional | 99.65 | |
| KOG0352|consensus | 641 | 99.64 | ||
| PRK09694 | 878 | helicase Cas3; Provisional | 99.63 | |
| KOG0351|consensus | 941 | 99.62 | ||
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.62 | |
| KOG0952|consensus | 1230 | 99.62 | ||
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.6 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.56 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.53 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.53 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.52 | |
| KOG0921|consensus | 1282 | 99.48 | ||
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.47 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.46 | |
| KOG0950|consensus | 1008 | 99.46 | ||
| KOG0329|consensus | 387 | 99.45 | ||
| KOG0951|consensus | 1674 | 99.44 | ||
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 99.43 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.42 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 99.42 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 99.42 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.41 | |
| KOG0353|consensus | 695 | 99.4 | ||
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 99.37 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 99.32 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.3 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.29 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 99.25 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.23 | |
| PF04408 | 102 | HA2: Helicase associated domain (HA2); InterPro: I | 99.22 | |
| KOG0948|consensus | 1041 | 99.21 | ||
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.16 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 99.15 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.13 | |
| KOG0947|consensus | 1248 | 99.08 | ||
| KOG4150|consensus | 1034 | 99.02 | ||
| smart00847 | 92 | HA2 Helicase associated domain (HA2) Add an annota | 98.99 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 98.82 | |
| KOG0953|consensus | 700 | 98.82 | ||
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 98.76 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 98.73 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 98.73 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 98.49 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 98.39 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 98.37 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 98.32 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 98.21 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 98.17 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 97.75 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 97.65 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 97.61 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.6 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 97.55 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 97.01 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 96.83 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.77 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 96.75 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 96.66 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 96.58 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.42 | |
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 96.42 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 96.31 | |
| KOG0949|consensus | 1330 | 96.3 | ||
| KOG0391|consensus | 1958 | 96.14 | ||
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 96.09 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 95.91 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 95.89 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 95.81 | |
| KOG0392|consensus | 1549 | 95.81 | ||
| KOG0385|consensus | 971 | 95.79 | ||
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 95.61 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 95.57 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.39 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 95.33 | |
| KOG0951|consensus | 1674 | 95.3 | ||
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 95.27 | |
| KOG1123|consensus | 776 | 95.24 | ||
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 95.24 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 95.24 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 95.18 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 95.11 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 95.11 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.04 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 94.98 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 94.95 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 94.94 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 94.91 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 94.84 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 94.74 | |
| KOG0384|consensus | 1373 | 94.64 | ||
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 94.6 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 94.6 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 94.6 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 94.46 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 94.39 | |
| KOG1802|consensus | 935 | 94.16 | ||
| KOG0389|consensus | 941 | 94.0 | ||
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 93.92 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 93.91 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 93.81 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 93.78 | |
| KOG0387|consensus | 923 | 93.65 | ||
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 93.58 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 93.55 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 93.5 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 93.48 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 93.46 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 92.98 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 92.98 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 92.78 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.75 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 92.68 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 92.53 | |
| KOG0390|consensus | 776 | 92.51 | ||
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 92.5 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 92.43 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 92.41 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 92.37 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 92.35 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 92.3 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 92.2 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 92.16 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 92.14 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 92.05 | |
| KOG2373|consensus | 514 | 91.94 | ||
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 91.88 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 91.86 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 91.76 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 91.57 | |
| KOG1000|consensus | 689 | 91.48 | ||
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 91.44 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 91.38 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 91.31 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 91.29 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 91.28 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 91.23 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 91.2 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 91.17 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 91.13 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 91.12 | |
| PF05729 | 166 | NACHT: NACHT domain | 91.11 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 91.06 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 90.98 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 90.93 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 90.68 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 90.68 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 90.64 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 90.62 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 90.57 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 90.43 | |
| PF13173 | 128 | AAA_14: AAA domain | 90.18 | |
| PRK13764 | 602 | ATPase; Provisional | 90.16 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 90.16 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 90.12 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 90.09 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 90.01 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 89.93 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 89.91 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 89.9 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 89.83 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 89.81 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 89.73 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 89.68 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 89.63 | |
| KOG0388|consensus | 1185 | 89.57 | ||
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 89.54 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 89.44 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 89.41 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 89.4 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 89.35 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 89.35 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 89.3 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 89.26 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 89.22 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 89.04 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 88.99 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 88.94 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 88.91 | |
| KOG1970|consensus | 634 | 88.89 | ||
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 88.88 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 88.87 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 88.84 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 88.77 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 88.74 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 88.74 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 88.72 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 88.7 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 88.69 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 88.63 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 88.61 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 88.6 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 88.59 | |
| PHA02244 | 383 | ATPase-like protein | 88.58 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 88.58 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 88.53 | |
| PRK06526 | 254 | transposase; Provisional | 88.52 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 88.42 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 88.36 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 88.36 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 88.36 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 88.32 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 88.29 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 88.27 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 88.27 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 88.23 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 88.21 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 88.21 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 88.12 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 88.08 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 87.99 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 87.98 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 87.94 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 87.93 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 87.9 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 87.9 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 87.87 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 87.82 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 87.8 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 87.8 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 87.8 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 87.79 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 87.76 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 87.76 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 87.71 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 87.69 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 87.68 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 87.68 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 87.66 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 87.61 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 87.61 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 87.6 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 87.58 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 87.58 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 87.57 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 87.56 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 87.55 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 87.54 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 87.52 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 87.48 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 87.48 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 87.47 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 87.43 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 87.39 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 87.36 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 87.31 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 87.28 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 87.27 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 87.23 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 87.2 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 87.16 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 87.16 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 87.15 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 87.14 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 87.13 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 87.12 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 87.12 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 87.08 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 87.07 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 87.06 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 87.03 | |
| KOG1803|consensus | 649 | 87.01 | ||
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 86.95 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 86.88 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 86.88 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 86.86 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 86.79 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 86.78 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 86.73 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 86.71 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 86.69 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 86.69 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 86.69 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 86.66 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 86.65 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 86.65 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 86.64 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 86.63 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 86.56 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 86.55 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 86.54 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 86.51 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 86.47 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 86.46 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 86.45 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 86.45 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 86.4 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 86.33 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 86.32 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 86.29 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 86.26 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 86.23 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 86.22 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 86.2 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 86.19 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 86.16 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 86.12 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 86.12 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 86.11 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 86.1 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 86.02 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 86.01 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 86.0 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 85.99 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 85.98 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 85.97 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 85.8 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 85.78 | |
| KOG0060|consensus | 659 | 85.72 | ||
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 85.69 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 85.68 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 85.65 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 85.65 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 85.61 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 85.56 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 85.52 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 85.5 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 85.48 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 85.46 | |
| KOG0347|consensus | 731 | 85.43 | ||
| PRK06762 | 166 | hypothetical protein; Provisional | 85.42 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 85.41 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 85.37 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 85.31 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 85.3 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 85.28 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 85.24 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 85.24 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 85.22 | |
| KOG1533|consensus | 290 | 85.21 | ||
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 85.2 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 85.19 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 85.17 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 85.17 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 85.15 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 85.12 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 85.11 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 85.09 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 85.06 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 85.05 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 85.04 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 85.03 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 84.95 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 84.94 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 84.93 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 84.91 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 84.91 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 84.91 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 84.88 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 84.84 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 84.84 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 84.82 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 84.82 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 84.81 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 84.8 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 84.78 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 84.77 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 84.75 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 84.75 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 84.74 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 84.73 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 84.73 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 84.71 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 84.71 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 84.69 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 84.67 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 84.67 | |
| PRK08181 | 269 | transposase; Validated | 84.66 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 84.66 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 84.59 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 84.59 | |
| PRK06217 | 183 | hypothetical protein; Validated | 84.58 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 84.58 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 84.56 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 84.53 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 84.52 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 84.51 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 84.48 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 84.42 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 84.42 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 84.39 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 84.37 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 84.36 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 84.35 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 84.35 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 84.34 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 84.32 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 84.3 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 84.29 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 84.29 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 84.29 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 84.28 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 84.25 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 84.23 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 84.16 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 84.15 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 84.13 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 84.13 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 84.12 | |
| PRK07667 | 193 | uridine kinase; Provisional | 84.09 | |
| PRK09087 | 226 | hypothetical protein; Validated | 84.02 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 84.0 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 84.0 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 83.98 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 83.98 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 83.97 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 83.96 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 83.91 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 83.88 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 83.87 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 83.85 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 83.85 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 83.84 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 83.83 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 83.83 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 83.82 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 83.79 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 83.79 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 83.73 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 83.69 | |
| PRK03839 | 180 | putative kinase; Provisional | 83.69 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 83.68 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 83.65 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 83.65 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 83.64 |
| >KOG0923|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.9e-93 Score=721.73 Aligned_cols=392 Identities=28% Similarity=0.402 Sum_probs=354.9
Q ss_pred HHHHHHHHHccCCCHHHHHHHHHHHHcCCeEEEEcCCCCCcccchh-hhhh-----------------------------
Q psy6094 45 RYQEMLEARKKLPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLD-FITL----------------------------- 94 (455)
Q Consensus 45 ~~~~~l~~R~~lP~~~~q~~il~~i~~~~~vii~~~TGSGKTtqlp-~ll~----------------------------- 94 (455)
+-.++.+.|+.||+|.++++++.+|.++||+||.|+||||||||+| ||.+
T Consensus 253 ~~~~iee~RksLPVy~ykdell~av~e~QVLiI~GeTGSGKTTQiPQyL~EaGytk~gk~IgcTQPRRVAAmSVAaRVA~ 332 (902)
T KOG0923|consen 253 RRESIEEVRKSLPVYPYKDELLKAVKEHQVLIIVGETGSGKTTQIPQYLYEAGYTKGGKKIGCTQPRRVAAMSVAARVAE 332 (902)
T ss_pred HHHHHHHHHhcCCchhhHHHHHHHHHhCcEEEEEcCCCCCccccccHHHHhcccccCCceEeecCcchHHHHHHHHHHHH
Confidence 4556778899999999999999999999999999999999999999 9987
Q ss_pred hh----cCCCCC-hH-----------------HHHHhc-cCCCCcCcc-------------hHHHHHHHHHHHHhcCCCC
Q psy6094 95 KR----SETQQY-PN-----------------DVLNML-KDPELEGVN-------------NDVIFSLLQHICTTQRPGA 138 (455)
Q Consensus 95 e~----~~~vg~-p~-----------------~ll~~l-~d~~L~~~~-------------~D~ll~~lk~il~~~~~~~ 138 (455)
|+ |..||| +| -|||++ .+|+|..|+ +|+|++++|++. +.||++
T Consensus 333 EMgvkLG~eVGYsIRFEdcTSekTvlKYMTDGmLlREfL~epdLasYSViiiDEAHERTL~TDILfgLvKDIa-r~RpdL 411 (902)
T KOG0923|consen 333 EMGVKLGHEVGYSIRFEDCTSEKTVLKYMTDGMLLREFLSEPDLASYSVIIVDEAHERTLHTDILFGLVKDIA-RFRPDL 411 (902)
T ss_pred HhCcccccccceEEEeccccCcceeeeeecchhHHHHHhccccccceeEEEeehhhhhhhhhhHHHHHHHHHH-hhCCcc
Confidence 22 223332 11 189998 999999999 999999999999 999999
Q ss_pred eEEEEccCC-----------------CCC-ccceEEeehhhhhhhhccCCCCChHHHHHHHHccCCCCEEEEcCCHHHHH
Q psy6094 139 ILVYCTYTF-----------------MGV-SPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTIN 200 (455)
Q Consensus 139 k~ilmSAT~-----------------~g~-~pv~~~~l~~~~~~~~~~~~~~~~~~l~~~i~~~~~g~iLVFlp~~~ei~ 200 (455)
|++++|||+ ||+ |||+++|.+.+.-+|+.....+ .+..|+. .+.|+||||++|+++|+
T Consensus 412 KllIsSAT~DAekFS~fFDdapIF~iPGRRyPVdi~Yt~~PEAdYldAai~t---VlqIH~t-qp~GDILVFltGQeEIE 487 (902)
T KOG0923|consen 412 KLLISSATMDAEKFSAFFDDAPIFRIPGRRYPVDIFYTKAPEADYLDAAIVT---VLQIHLT-QPLGDILVFLTGQEEIE 487 (902)
T ss_pred eEEeeccccCHHHHHHhccCCcEEeccCcccceeeecccCCchhHHHHHHhh---heeeEec-cCCccEEEEeccHHHHH
Confidence 999999999 999 9999999988877776544321 2333333 77899999999999999
Q ss_pred HHHHHHHhcCCC---CCCCeEEEeecCCCChhhHhhhhcCCCCCceEEEEeCCCCccCCCCCCeeEEEeCCCCccccccc
Q psy6094 201 SLHRSMCQSSFF---NSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDV 277 (455)
Q Consensus 201 ~l~~~L~~~~~~---~~~~~~v~~lhs~l~~~~r~~v~~~~~~g~~kVivaTniae~gitI~~V~~VID~g~~k~~~yd~ 277 (455)
.+.+.|.+.... ....+.++|+|+.||.+.|.+||++.|+|.||||+|||||||||||+||.||||+|++|++.|||
T Consensus 488 t~~e~l~~~~~~LGski~eliv~PiYaNLPselQakIFePtP~gaRKVVLATNIAETSlTIdgI~yViDpGf~K~nsynp 567 (902)
T KOG0923|consen 488 TVKENLKERCRRLGSKIRELIVLPIYANLPSELQAKIFEPTPPGARKVVLATNIAETSLTIDGIKYVIDPGFVKQNSYNP 567 (902)
T ss_pred HHHHHHHHHHHHhccccceEEEeeccccCChHHHHhhcCCCCCCceeEEEeecchhhceeecCeEEEecCccccccCcCC
Confidence 999888865322 34578999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCcccccccccchhhHHhhhcccCCCCCCeEEecCC----hhhhccCCCCcccccC-hHHHHHHHh---------hhcC
Q psy6094 278 KDNIATLKPEWISLANAKQRRGRAGRTLKRSETQQYP----NDVLNMLKDPELEGVN-NDVIFSLLQ---------HICT 343 (455)
Q Consensus 278 ~~~~~~l~~~~iSka~~~QR~GRaGR~~~G~c~~L~t----~~~~~~~~~PEi~r~~-~~~~L~~l~---------~~~~ 343 (455)
++||+.|..+|||||+|.||+|||||+|||+|||||| ..+++..+.|||+|.| ..++|.+++ +|++
T Consensus 568 rtGmesL~v~piSKAsA~QRaGRAGRtgPGKCfRLYt~~aY~~eLE~~t~PEIqRtnL~nvVL~LkSLGI~Dl~~FdFmD 647 (902)
T KOG0923|consen 568 RTGMESLLVTPISKASANQRAGRAGRTGPGKCFRLYTAWAYEHELEEMTVPEIQRTNLGNVVLLLKSLGIHDLIHFDFLD 647 (902)
T ss_pred CcCceeEEEeeechhhhhhhccccCCCCCCceEEeechhhhhhhhccCCCcceeeccchhHHHHHHhcCcchhcccccCC
Confidence 9999999999999999999999999999999999999 5678899999999999 999997765 8999
Q ss_pred CCChhhHHhHHhhhhhcccccCCCCCCcccCChHHHHHhhCCCCh---------------hHHHHHHHhhc-----CcCC
Q psy6094 344 TQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKP---------------KEIITVRDCLS-----FECK 403 (455)
Q Consensus 344 ~P~~~~i~~al~~L~~lgald~~~~l~~~~~T~lG~~l~~lp~~p---------------~~~l~iaa~ls-----f~~p 403 (455)
||+.+++..||+.|+.||||+..|+| |.+|+.|++||+|| ++|++|||||| |+.|
T Consensus 648 pPp~etL~~aLE~LyaLGALn~~GeL-----Tk~GrrMaEfP~dPmlsKmi~as~ky~cs~EiitiaamlS~~~svfyrp 722 (902)
T KOG0923|consen 648 PPPTETLLKALEQLYALGALNHLGEL-----TKLGRRMAEFPVDPMLSKMIVASEKYKCSEEIITIAAMLSVGASVFYRP 722 (902)
T ss_pred CCChHHHHHHHHHHHHhhccccccch-----hhhhhhhhhcCCCHHHHhHHhhhccccchHHHHHHHHHHhcCchheecc
Confidence 99999999999999999999999999 99999999999999 79999999999 8899
Q ss_pred cChHHHHHHHHhhhC-CCCcHHHHHHHHHHHhcCCCCchHhHHHhh
Q psy6094 404 PSTAKIIKELRARLD-MLLAHKLSHPGTTAWGDPNEGNILHCCSGF 448 (455)
Q Consensus 404 ~~~~~~~~~~~~~~~-~~sD~~~~~~~~~~~~~~~~~~~~~~c~~~ 448 (455)
.++.-.++.+++.|. +.|||++++++|++|...+.+ .+||.++
T Consensus 723 k~~~v~ad~a~~~f~~~~gDhi~~L~vyn~w~es~~s--~~wC~e~ 766 (902)
T KOG0923|consen 723 KDKQVHADNARKNFEEPVGDHIVLLNVYNQWKESKYS--TQWCYEN 766 (902)
T ss_pred hhhhhhhhhhhhccCCCCcchhhhhHHHHHHhhcchh--hHHHHHh
Confidence 999999999999999 999999999999999999886 8999873
|
|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >KOG0921|consensus | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0921|consensus | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >KOG4150|consensus | Back alignment and domain information |
|---|
| >smart00847 HA2 Helicase associated domain (HA2) Add an annotation | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0392|consensus | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >KOG0384|consensus | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG1802|consensus | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >KOG2373|consensus | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >KOG1000|consensus | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >KOG0388|consensus | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >KOG1970|consensus | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >KOG0060|consensus | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 455 | ||||
| 3kx2_B | 767 | Crystal Structure Of Prp43p In Complex With Adp Len | 2e-15 | ||
| 2xau_A | 773 | Crystal Structure Of The Prp43p Deah-Box Rna Helica | 2e-15 |
| >pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 | Back alignment and structure |
|
| >pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 455 | |||
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 1e-34 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 6e-08 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 1e-28 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 2e-28 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 6e-28 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 7e-28 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 1e-27 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 2e-27 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 2e-25 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 1e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-11 |
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 | Back alignment and structure |
|---|
Score = 136 bits (344), Expect = 1e-34
Identities = 51/126 (40%), Positives = 68/126 (53%), Gaps = 10/126 (7%)
Query: 189 ILVFLPGWDTINSLHRSMCQ-----SSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGV- 242
IL+FL G D I R + + PL+ LP Q+ IF PE
Sbjct: 306 ILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHN 365
Query: 243 ----RKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRR 298
RK+V++TNIAETS+TID IVYVVD G +K ++ + + +L IS A+A+QR
Sbjct: 366 GRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRA 425
Query: 299 GRAGRT 304
GRAGRT
Sbjct: 426 GRAGRT 431
|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 455 | |||
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 100.0 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 100.0 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 100.0 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 100.0 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.97 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.97 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.96 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.96 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.96 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.96 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.96 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.96 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.95 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.95 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.95 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.95 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.95 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.95 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.94 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.94 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.94 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.94 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.94 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.94 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.94 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.93 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.93 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.93 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.93 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.92 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.92 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 99.91 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.91 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.91 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.91 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.91 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.91 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.9 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.89 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.88 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.88 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.87 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.86 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.86 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.86 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.85 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.84 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.84 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.83 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 99.81 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 99.81 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 99.8 | |
| 3i4u_A | 270 | ATP-dependent RNA helicase DHX8; splicing, ATP-bin | 99.79 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 99.79 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.79 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 99.78 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 99.77 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.76 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.76 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.76 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 99.61 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.67 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 99.67 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 99.66 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.6 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.47 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.41 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.24 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 99.23 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.0 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 98.93 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 98.91 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 98.8 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 98.78 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 98.78 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 98.78 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 98.77 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 98.76 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 98.75 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 98.74 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 98.74 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 98.71 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 98.7 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 98.68 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 98.68 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 98.62 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 98.36 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 97.92 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 97.78 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 96.31 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 95.34 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 95.27 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 94.5 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 94.08 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 93.82 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 93.54 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 93.38 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 93.3 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 93.3 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 92.95 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 92.89 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 92.87 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 92.76 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 92.71 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 92.71 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 92.67 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 92.39 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 92.27 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 92.2 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 92.13 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 92.07 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 91.92 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 91.81 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 91.78 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 91.67 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 91.64 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 91.5 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 91.39 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 91.2 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 91.0 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 90.98 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 90.96 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 90.83 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 90.79 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 90.76 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 90.76 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 90.69 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 90.65 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 90.63 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 90.62 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 90.56 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 90.2 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 90.17 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 90.15 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 90.03 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 89.98 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 89.97 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 89.86 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 89.85 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 89.8 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 89.67 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 89.48 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 89.42 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 89.19 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 89.18 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 88.99 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 88.98 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 88.9 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 88.89 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 88.88 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 88.87 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 88.86 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 88.86 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 88.81 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 88.81 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 88.69 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 88.67 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 88.62 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 88.59 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 88.56 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 88.53 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 88.47 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 88.47 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 88.43 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 88.43 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 88.42 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 88.38 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 88.34 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 88.32 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 88.29 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 88.27 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 88.2 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 88.12 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 88.1 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 88.05 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 88.0 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 88.0 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 87.95 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 87.87 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 87.71 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 87.69 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 87.69 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 87.68 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 87.58 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 87.57 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 87.52 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 87.48 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 87.46 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 87.46 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 87.35 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 87.22 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 87.1 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 87.05 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 86.95 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 86.92 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 86.89 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 86.89 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 86.89 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 86.84 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 86.82 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 86.78 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 86.73 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 86.64 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 86.59 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 86.5 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 86.5 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 86.48 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 86.45 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 86.39 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 86.35 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 86.34 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 86.32 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 86.28 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 86.28 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 86.25 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 86.09 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 85.97 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 85.97 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 85.88 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 85.87 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 85.83 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 85.81 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 85.73 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 85.73 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 85.72 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 85.69 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 85.69 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 85.68 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 85.66 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 85.59 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 85.46 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 85.35 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 85.3 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 85.14 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 85.14 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 85.11 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 85.09 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 85.07 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 85.06 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 85.05 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 85.03 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 85.03 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 84.96 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 84.94 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 84.92 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 84.88 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 84.79 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 84.61 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 84.59 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 84.55 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 84.55 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 84.5 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 84.5 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 84.49 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 84.48 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 84.46 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 84.43 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 84.42 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 84.35 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 84.32 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 84.22 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 84.2 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 84.16 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 84.09 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 83.97 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 83.88 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 83.86 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 83.84 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 83.81 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 83.75 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 83.68 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 83.65 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 83.6 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 83.39 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 83.26 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 83.22 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 83.19 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 83.15 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 83.12 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 83.12 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 83.1 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 83.0 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 82.98 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 82.97 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 82.92 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 82.87 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 82.86 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 82.83 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 82.71 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 82.68 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 82.48 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 82.45 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 82.44 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 82.42 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 82.42 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 82.35 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 82.33 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 82.32 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 82.29 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 82.2 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 82.14 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 82.07 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 82.06 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 81.95 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 81.91 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 81.66 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 81.65 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 81.62 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 81.57 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 81.44 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 81.4 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 81.39 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 81.36 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 81.26 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 81.19 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 81.11 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 80.94 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 80.86 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 80.85 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 80.84 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 80.84 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 80.8 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 80.55 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 80.5 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 80.48 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 80.42 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 80.32 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 80.32 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 80.31 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 80.25 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 80.04 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 80.04 |
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-65 Score=565.73 Aligned_cols=402 Identities=26% Similarity=0.353 Sum_probs=338.2
Q ss_pred HHHHHhcCHHHHHHHHHHccCCCHHHHHHHHHHHHcCCeEEEEcCCCCCcccchh-hhhh--------------------
Q psy6094 36 EMIRKLQSRRYQEMLEARKKLPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLD-FITL-------------------- 94 (455)
Q Consensus 36 ~~~~~~~~~~~~~~l~~R~~lP~~~~q~~il~~i~~~~~vii~~~TGSGKTtqlp-~ll~-------------------- 94 (455)
.|.+...++++.++++.|+.+|++.+|++++.++.++++++|+|+|||||||++| +++.
T Consensus 73 ~f~~~~l~~~~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~L 152 (773)
T 2xau_A 73 PFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVA 152 (773)
T ss_dssp TTTCSBCCHHHHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHH
T ss_pred CccccCCCHHHHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHH
Confidence 4777888999999999999999999999999999999999999999999999999 5433
Q ss_pred ----------hhcCCCC----------------------ChHHHHHhc-cCCCCcCcc-------------hHHHHHHHH
Q psy6094 95 ----------KRSETQQ----------------------YPNDVLNML-KDPELEGVN-------------NDVIFSLLQ 128 (455)
Q Consensus 95 ----------e~~~~vg----------------------~p~~ll~~l-~d~~L~~~~-------------~D~ll~~lk 128 (455)
+.+..+| +|+.+++.+ .++.+.+++ +|.++.+++
T Consensus 153 a~q~~~~l~~~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~ 232 (773)
T 2xau_A 153 AMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLK 232 (773)
T ss_dssp HHHHHHHHHHHTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHH
T ss_pred HHHHHHHHHHHhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHH
Confidence 1111111 244466666 566666655 677788899
Q ss_pred HHHHhcCCCCeEEEEccCC-----------------CCC-ccceEEeehhhhhhhhccCCCCChHHHHHHHHccCCCCEE
Q psy6094 129 HICTTQRPGAILVYCTYTF-----------------MGV-SPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPIL 190 (455)
Q Consensus 129 ~il~~~~~~~k~ilmSAT~-----------------~g~-~pv~~~~l~~~~~~~~~~~~~~~~~~l~~~i~~~~~g~iL 190 (455)
.+. ..+++.|+|+||||+ +|+ +|++.+|.+.....+... ....+........+|++|
T Consensus 233 ~l~-~~~~~~~iIl~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~----~l~~l~~~~~~~~~g~iL 307 (773)
T 2xau_A 233 QVV-KRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDS----AIRTVLQIHATEEAGDIL 307 (773)
T ss_dssp HHH-HHCTTCEEEEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHH----HHHHHHHHHHHSCSCEEE
T ss_pred HHH-HhCCCceEEEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHH----HHHHHHHHHHhcCCCCEE
Confidence 988 677899999999999 677 888888876432111100 000122222225789999
Q ss_pred EEcCCHHHHHHHHHHHHhcCC-----CCCCCeEEEeecCCCChhhHhhhhcCCC-----CCceEEEEeCCCCccCCCCCC
Q psy6094 191 VFLPGWDTINSLHRSMCQSSF-----FNSSRFQIIPLHSMLPTVSQKSIFNTPP-----EGVRKIVLATNIAETSITIDD 260 (455)
Q Consensus 191 VFlp~~~ei~~l~~~L~~~~~-----~~~~~~~v~~lhs~l~~~~r~~v~~~~~-----~g~~kVivaTniae~gitI~~ 260 (455)
|||+|+++|+.+++.|..... ....++.+.++||+|++++|.++++.|+ +|.++||||||+||+|||||+
T Consensus 308 VF~~~~~~i~~l~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~ 387 (773)
T 2xau_A 308 LFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDG 387 (773)
T ss_dssp EECSCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTT
T ss_pred EECCCHHHHHHHHHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCC
Confidence 999999999999999985100 0123589999999999999999999999 999999999999999999999
Q ss_pred eeEEEeCCCCcccccccCCCcccccccccchhhHHhhhcccCCCCCCeEEecCChh----hhccCCCCcccccC-hHHHH
Q psy6094 261 IVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKRSETQQYPND----VLNMLKDPELEGVN-NDVIF 335 (455)
Q Consensus 261 V~~VID~g~~k~~~yd~~~~~~~l~~~~iSka~~~QR~GRaGR~~~G~c~~L~t~~----~~~~~~~PEi~r~~-~~~~L 335 (455)
|++|||+|++|.+.||+..|++.|.+.|+|+++|.||+|||||.++|.||+||+++ .+.++..|||++.+ .+++|
T Consensus 388 v~~VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~~L~~~~L 467 (773)
T 2xau_A 388 IVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVL 467 (773)
T ss_dssp EEEEEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCSSCCCGGGGSCCHHHHH
T ss_pred eEEEEeCCCccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccccCCCccccCcHHHHHH
Confidence 99999999999999999999999999999999999999999999899999999954 36678999999999 99999
Q ss_pred HHHh---------hhcCCCChhhHHhHHhhhhhcccccCCCCCCcccCChHHHHHhhCCCCh---------------hHH
Q psy6094 336 SLLQ---------HICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKP---------------KEI 391 (455)
Q Consensus 336 ~~l~---------~~~~~P~~~~i~~al~~L~~lgald~~~~l~~~~~T~lG~~l~~lp~~p---------------~~~ 391 (455)
.+.. .|++||+++++..|++.|..+||||.++++ |++|+.|+.||++| +++
T Consensus 468 ~l~~~gi~~~~~f~~~~~p~~~~i~~a~~~L~~lgald~~~~l-----T~lG~~~a~~pl~p~~~~~l~~~~~~~c~~~~ 542 (773)
T 2xau_A 468 ELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNL-----TPLGRLASQFPLDPMLAVMLIGSFEFQCSQEI 542 (773)
T ss_dssp HHHHTTCCCGGGCCCSSCCCHHHHHHHHHHHHHTTSBCTTSCB-----CHHHHHHTTSSSCHHHHHHHHHGGGGTCHHHH
T ss_pred HHHHcCCCChhhccccCCCcHHHHHHHHHHHHHcCCcccCCCc-----ChhhhhhccccCCHHHHHHHHhhcccCchhHH
Confidence 7654 688999999999999999999999999999 99999999999999 899
Q ss_pred HHHHHhhc----CcCCcChHHHHHHHHhhhC-CCCcHHHHHHHHHHHhcCCCC-c-hHhHHHh
Q psy6094 392 ITVRDCLS----FECKPSTAKIIKELRARLD-MLLAHKLSHPGTTAWGDPNEG-N-ILHCCSG 447 (455)
Q Consensus 392 l~iaa~ls----f~~p~~~~~~~~~~~~~~~-~~sD~~~~~~~~~~~~~~~~~-~-~~~~c~~ 447 (455)
++|||+|+ |..|.+.+++++.+|++|. ..|||++++|+|++|.+.... . ..+||++
T Consensus 543 l~i~a~ls~~~~f~~~~~~~~~~~~~~~~f~~~~~D~~~~l~~~~~~~~~~~~~~~~~~~c~~ 605 (773)
T 2xau_A 543 LTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRD 605 (773)
T ss_dssp HHHHHHHTSCCCBCCCTTCHHHHHHHHHTTCCTTBHHHHHHHHHHHHTSHHHHHHCHHHHHHH
T ss_pred HHHHHhcccCCcccCChHHHHHHHHHHHhccCCCCcHHHHHHHHHHHHHhccccchHHHHHHH
Confidence 99999999 8888899999999999999 899999999999999775421 1 2589997
|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 455 | ||||
| d1yksa2 | 299 | c.37.1.14 (A:325-623) YFV helicase domain {Yellow | 9e-22 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 8e-14 |
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: YFV helicase domain species: Yellow fever virus [TaxId: 11089]
Score = 93.1 bits (231), Expect = 9e-22
Identities = 32/121 (26%), Positives = 48/121 (39%), Gaps = 12/121 (9%)
Query: 189 ILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLA 248
FLP N + S+ ++ ++ L+ +I P +LA
Sbjct: 39 TAWFLPSIRAANVMAASLRKAGK------SVVVLNRKTFEREYPTIKQKKP----DFILA 88
Query: 249 TNIAETSITIDDIVYVVDCGKT-KMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKR 307
T+IAE + + V+DC K D +A P IS ++A QRRGR GR R
Sbjct: 89 TDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPNR 147
Query: 308 S 308
Sbjct: 148 D 148
|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 455 | |||
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.95 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.93 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.83 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 99.83 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 99.83 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 99.82 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.82 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.82 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.81 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.81 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.79 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.76 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.63 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.62 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.61 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.58 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 99.54 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.44 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.3 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.26 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.25 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.22 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.2 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.2 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.18 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.09 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.01 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 98.81 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 98.62 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 98.31 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 98.29 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 98.22 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.2 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 98.16 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 98.15 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 98.09 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 97.62 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 97.56 | |
| d1nkta4 | 219 | Translocation ATPase SecA, nucleotide-binding doma | 97.36 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 97.3 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 95.66 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 95.32 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.06 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 94.96 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 94.73 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.64 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 94.14 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 94.13 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.76 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 93.49 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 93.44 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 93.36 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 93.36 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.3 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 93.07 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 93.04 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 92.92 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 92.77 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 92.37 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 92.31 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 92.24 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 92.15 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 92.14 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 91.88 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 91.77 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 91.49 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 91.45 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 91.42 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 91.25 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.18 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 91.12 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 91.08 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 91.06 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 91.06 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 90.9 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 90.78 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 90.75 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 90.73 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 90.73 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 90.64 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 90.63 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 90.51 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 90.51 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 90.28 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 90.25 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 90.24 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 89.92 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 89.76 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 89.71 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 89.69 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 89.58 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 89.55 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 89.48 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 89.43 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 89.39 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 89.25 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 88.95 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 88.88 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 88.83 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 88.59 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 88.4 | |
| d2p6ra1 | 85 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 88.38 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 88.37 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 88.33 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 88.31 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 88.22 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 88.16 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 88.12 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 87.6 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 87.54 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 87.38 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 87.11 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 86.79 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 86.78 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 86.73 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 86.59 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 86.59 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 86.43 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 86.35 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 85.94 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 85.87 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 85.8 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 85.71 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 85.62 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 85.55 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 85.48 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 85.47 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 85.42 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 85.18 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 85.18 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 85.15 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 84.94 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 84.81 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 84.77 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 84.7 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 84.64 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 83.58 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 83.51 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 83.42 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 83.32 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 82.98 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 82.81 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 82.61 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 82.5 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 80.98 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 80.69 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 80.08 |
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: YFV helicase domain species: Yellow fever virus [TaxId: 11089]
Probab=99.95 E-value=1.2e-30 Score=252.58 Aligned_cols=226 Identities=19% Similarity=0.115 Sum_probs=165.6
Q ss_pred cCCCCEEEEcCCHHHHHHHHHHHHhcCCCCCCCeEEEeecCCCChhhHhhhhcCCCCCceEEEEeCCCCccCCCCCCeeE
Q psy6094 184 MLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVY 263 (455)
Q Consensus 184 ~~~g~iLVFlp~~~ei~~l~~~L~~~~~~~~~~~~v~~lhs~l~~~~r~~v~~~~~~g~~kVivaTniae~gitI~~V~~ 263 (455)
..+|++||||||..+++.+++.|+..+ +.|++|||.++.+++.+ +++|.++|||||||||+|+|| ||++
T Consensus 34 ~~~g~~~~F~~s~~~~~~~a~~L~~~g------~~V~~l~~~~~~~e~~~----~~~~~~~~~~~t~~~~~~~~~-~~~~ 102 (299)
T d1yksa2 34 ADKRPTAWFLPSIRAANVMAASLRKAG------KSVVVLNRKTFEREYPT----IKQKKPDFILATDIAEMGANL-CVER 102 (299)
T ss_dssp HCCSCEEEECSCHHHHHHHHHHHHHTT------CCEEECCSSSCC------------CCCSEEEESSSTTCCTTC-CCSE
T ss_pred hcCCCEEEEeCCHHHHHHHHHHHHhcC------CeEEEEcCcCcHhHHhh----hhcCCcCEEEEechhhhceec-CceE
Confidence 458999999999999999999999875 67999999999988765 457889999999999999999 6999
Q ss_pred EEeCCCC-cccccccCCCcccccccccchhhHHhhhcccCCCCCC-eEEecCChhhhccC------CCCcccccChHHHH
Q psy6094 264 VVDCGKT-KMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKR-SETQQYPNDVLNML------KDPELEGVNNDVIF 335 (455)
Q Consensus 264 VID~g~~-k~~~yd~~~~~~~l~~~~iSka~~~QR~GRaGR~~~G-~c~~L~t~~~~~~~------~~PEi~r~~~~~~L 335 (455)
|||+|+. |...||+.+++..+...|+|++++.||+||+||.+.+ .||.+|+....++. +.++|...+-.+.+
T Consensus 103 vid~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~qr~gr~gr~~~~~~~~~~y~~~~~~d~~~~~~~te~~i~l~~i~l~~ 182 (299)
T d1yksa2 103 VLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPNRDGDSYYYSEPTSENNAHHVCWLEASMLLDNMEVRG 182 (299)
T ss_dssp EEECCEEEEEEEETTTTEEEEEEEEECCHHHHHHHHTTSSCCTTCCCEEEEECSCCCCCCTTBHHHHHHHHHHTTSCCGG
T ss_pred EEecCceeceeeecCCCCeeEEeeeecCHHHHHHhcccccccCCCceEEEEeCCCCCCcccchhhhhhHHHHhhCccccc
Confidence 9999995 8889999999999999999999999999999998653 56777774322111 11233332200011
Q ss_pred -------HHHhhhcCCCChhhHHhHHhhhhhcccccCCCCCCcccCChHHHHHhhCCCChhHHHHHHHhhcCcCCcChHH
Q psy6094 336 -------SLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAK 408 (455)
Q Consensus 336 -------~~l~~~~~~P~~~~i~~al~~L~~lgald~~~~l~~~~~T~lG~~l~~lp~~p~~~l~iaa~lsf~~p~~~~~ 408 (455)
....+++++|+.+....+++.+..+|||+..+.. +.+|+.++.+++.+... -..|+.|....-
T Consensus 183 ~~~g~~~~~e~~~~~~p~g~~~L~~~~~l~~l~aL~~~d~p-----~~La~~va~~~~~~~~~-----~~~f~~P~e~~i 252 (299)
T d1yksa2 183 GMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELVRNCDLP-----VWLSWQVAKAGLKTNDR-----KWCFEGPEEHEI 252 (299)
T ss_dssp GCCCCCSTTHHHHSSSCTTTTCCCHHHHHHHHHHHHTTCCC-----HHHHHHHHHTTCCTTCC-----GGGSCSCGGGCC
T ss_pred ccccccchhhhccccCCCchhhhhHhHHHHHHHHHhhcCCC-----cchHHHHHhcccccccc-----cceeECchhchh
Confidence 0112577888888777889999999999887766 89999999998876111 122666655432
Q ss_pred HHHHHH-hhhC-CCCcHHHHHHHH
Q psy6094 409 IIKELR-ARLD-MLLAHKLSHPGT 430 (455)
Q Consensus 409 ~~~~~~-~~~~-~~sD~~~~~~~~ 430 (455)
..+..+ .+|. +.|||+++++.|
T Consensus 253 ~~~~~~~~~f~~~~Gd~~~L~~r~ 276 (299)
T d1yksa2 253 LNDSGETVKCRAPGGAKKPLRPRW 276 (299)
T ss_dssp BCTTSCBCEEECTTSCEEECCCSS
T ss_pred hhhhccccceeCCCcceeeeeeeE
Confidence 222222 3466 899999988765
|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|