Psyllid ID: psy6094


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-----
MKSPHSPKGLTHSVTSWETRQKLLNDPVLDAAFKKEMIRKLQSRRYQEMLEARKKLPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLDFITLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAKIIKELRARLDMLLAHKLSHPGTTAWGDPNEGNILHCCSGFSRMVMVE
ccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEEEccccccEEEccccccccccccccccHHccccccccccccHHHHHHHHHHHHHccccccccEEEEEEEccccccEEEHHHHHHHHHHHccccccHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHcccccccccccEEEEEccccccccccccEEEEEcccccccccccccccccccccccccHHcccccccccccccccEEEEcccHHHHcccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccccHHHHcccccEEEEEc
cccccccccccHccHHHHHHHHHccccHHHHHHHHHcccccHHcccccHHHHHHcccHHHHHHHHHHHHHcccEEEEEEccccccccEEEHHHHcHHHHHHHccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEcccccEEccccccccccEEEEEEccHHHHHHccccccccccccEEEEEcHHHHccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccHHcHHHccccccHHHHHHHHHccccHHHHHHHHHccccEEEEEcccccEEEEcccccccEEEEc
mksphspkglthsVTSWETRQKLLNDPVLDAAFKKEMIRKLQSRRYQEMLEARKklpsyqmrDAVLDMVRNNQITvisgetgsgpplhlDFITLKrsetqqypndvlnmlkdpelegvnnDVIFSLLQHIcttqrpgaiLVYCTYTfmgvspmkvFFCKNVLQRLMkgvganspKRWVKLLRSMLVVPILVFLPGWDTINSLHRsmcqssffnssrfqiiplhsmlptvsqksifntppegvRKIVLATNiaetsitidDIVYVVdcgktkmsnfdvkdniatlkpEWISLANAKQRrgragrtlkrsetqqypndvlnmlkdpelegvnnDVIFSLLQHIcttqrpgailvflpgwdTINSLHRsmcqssffnSCLLYEFamvdnkpkeiitvrdclsfeckpSTAKIIKELRARLDMLLAHklshpgttawgdpnegnilhccsgfsrmvmve
mksphspkglthsvtswetrQKLLNDPVLDAAFKKEMIRKLQSRRYQEMLearkklpsyqmRDAVLDMVRNNQITvisgetgsgppLHLDFITLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLAtniaetsitiddiVYVVDCGKTKMSNFDVkdniatlkpewislanakqrrgragrtlkrsetqqypndVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAKIIKELRARLDMLLAHKLSHpgttawgdpneGNILHCCSGFSRMVMVE
MKSPHSPKGLTHSVTSWETRQKLLNDPVLDAAFKKEMIRKLQSRRYQEMLEARKKLPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLDFITLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAKIIKELRARLDMLLAHKLSHPGTTAWGDPNEGNILHCCSGFSRMVMVE
**********************LLNDPVLDAAFKKEMI********************YQMRDAVLDMVRNNQITVISGETGSGPPLHLDFITLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLA*************************LNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAKIIKELRARLDMLLAHKLSHPGTTAWGDPNEGNILHCCSGFSRM****
*******************************************************LPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLDFITLKRSETQQYPNDVLN***********NDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMC****FNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAKIIKELRARLDMLLAHKLSHPGTTAWGDPNEGNILHCCSGFSRMVMVE
***************SWETRQKLLNDPVLDAAFKKEMIRKLQSRRYQEMLEARKKLPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLDFITLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLAN*************RSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAKIIKELRARLDMLLAHKLSHPGTTAWGDPNEGNILHCCSGFSRMVMVE
***********************************************EMLEARKKLPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLDFITLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANA*********TLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAKIIKELRARLDMLLAHKLSHPGTTAWGDPNEGNILHCCSGFSRMVMVE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSPHSPKGLTHSVTSWETRQKLLNDPVLDAAFKKEMIRKLQSRRYQEMLEARKKLPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLDFITLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKRSETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAKIIKELRARLDMLLAHKLSHPGTTAWGDPNEGNILHCCSGFSRMVMVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query455
380029828 863 PREDICTED: probable ATP-dependent RNA he 0.338 0.178 0.431 3e-40
110755029 964 PREDICTED: probable ATP-dependent RNA he 0.338 0.159 0.431 4e-40
383865235 976 PREDICTED: probable ATP-dependent RNA he 0.345 0.160 0.434 9e-40
350402556 977 PREDICTED: probable ATP-dependent RNA he 0.340 0.158 0.429 3e-39
328711816 1055 PREDICTED: probable ATP-dependent RNA he 0.338 0.145 0.421 3e-39
340711835 977 PREDICTED: probable ATP-dependent RNA he 0.340 0.158 0.429 1e-38
488587119 856 PREDICTED: LOW QUALITY PROTEIN: probable 0.619 0.329 0.364 1e-38
432891825 1050 PREDICTED: probable ATP-dependent RNA he 0.272 0.118 0.620 3e-38
390349687 1040 PREDICTED: probable ATP-dependent RNA he 0.221 0.097 0.634 5e-38
47224961 706 unnamed protein product [Tetraodon nigro 0.254 0.164 0.655 6e-38
>gi|380029828|ref|XP_003698567.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like, partial [Apis florea] Back     alignment and taxonomy information
 Score =  172 bits (436), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 119/204 (58%), Gaps = 50/204 (24%)

Query: 100 QQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTTQRPGAILVYCTYTFMGVSPMKVFFCK 159
           ++YP +V++ L++P  E ++ D+I  L++HIC T+ PGA                     
Sbjct: 412 KKYPREVIDQLRNPYSEMMSLDLIEQLIRHICRTKAPGA--------------------- 450

Query: 160 NVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQI 219
                                        ILVFLPG   I  L+R M  +  ++ S + I
Sbjct: 451 -----------------------------ILVFLPGMMDITKLNRMMLDTGCYSQSHYVI 481

Query: 220 IPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKD 279
            PLHS +PT+ QK IF  PP+GVRKI++AT+IAETSITI+D+VYV+DCGK K   FD++ 
Sbjct: 482 YPLHSRMPTIDQKLIFKEPPKGVRKIIIATSIAETSITIEDVVYVIDCGKMKFGKFDIQK 541

Query: 280 NIATLKPEWISLANAKQRRGRAGR 303
           NI TL+PEW+SLANAKQRRGRAGR
Sbjct: 542 NIQTLEPEWVSLANAKQRRGRAGR 565




Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|110755029|ref|XP_394965.3| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383865235|ref|XP_003708080.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350402556|ref|XP_003486528.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328711816|ref|XP_001947767.2| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340711835|ref|XP_003394474.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|488587119|ref|XP_004478889.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase DHX36 [Dasypus novemcinctus] Back     alignment and taxonomy information
>gi|432891825|ref|XP_004075666.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|390349687|ref|XP_784575.3| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|47224961|emb|CAF97376.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query455
RGD|1308767 1000 Dhx36 "DEAH (Asp-Glu-Ala-His) 0.356 0.162 0.497 4.5e-58
MGI|MGI:1919412 1001 Dhx36 "DEAH (Asp-Glu-Ala-His) 0.356 0.161 0.491 5.9e-58
UNIPROTKB|F6V8H1 1122 DHX36 "Uncharacterized protein 0.356 0.144 0.497 7e-58
UNIPROTKB|Q9H2U1 1008 DHX36 "Probable ATP-dependent 0.356 0.160 0.491 1.3e-57
UNIPROTKB|Q05B79 1010 DHX36 "Uncharacterized protein 0.356 0.160 0.491 2.8e-57
UNIPROTKB|E1C550 985 DHX36 "Uncharacterized protein 0.329 0.152 0.506 3e-57
ZFIN|ZDB-GENE-050419-20 1037 si:dkey-119o24.1 "si:dkey-119o 0.252 0.110 0.588 4.5e-54
UNIPROTKB|E7EWK3 797 DHX36 "Probable ATP-dependent 0.356 0.203 0.491 8e-51
TAIR|locus:2039280 995 AT2G35920 [Arabidopsis thalian 0.362 0.165 0.473 6.9e-45
TAIR|locus:2052841 1299 HVT1 "helicase in vascular tis 0.252 0.088 0.577 9.5e-44
RGD|1308767 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 397 (144.8 bits), Expect = 4.5e-58, Sum P(4) = 4.5e-58
 Identities = 84/169 (49%), Positives = 111/169 (65%)

Query:   189 ILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLA 248
             ILVFLPGWD I++LH  +     F S RF IIPLHS++PTV+Q  +F   P GVRKIV+A
Sbjct:   483 ILVFLPGWDNISTLHDLLMSQVMFKSDRFLIIPLHSLMPTVNQTQVFKKTPPGVRKIVIA 542

Query:   249 TNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKRS 308
             TNIAETSITIDD+VYV+D GK K ++FD ++NI+T+  EW+S ANAKQR+GRAGR     
Sbjct:   543 TNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRKGRAGRVQPGH 602

Query:   309 ETQQYPNDVLNMLKDPELEGVNNDVIFSLLQHICTT---QRPGAILVFL 354
                 Y     ++L D +L     +++ + L+ +C      R G I  FL
Sbjct:   603 CYHLYNGLRASLLDDYQLP----EILRTPLEELCLQIKILRLGGIAYFL 647


GO:0003725 "double-stranded RNA binding" evidence=IEA;ISO
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA;ISO
GO:0005737 "cytoplasm" evidence=IEA;ISO
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0009615 "response to virus" evidence=IEA;ISO
GO:0043330 "response to exogenous dsRNA" evidence=IEA;ISO
MGI|MGI:1919412 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F6V8H1 DHX36 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2U1 DHX36 "Probable ATP-dependent RNA helicase DHX36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B79 DHX36 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C550 DHX36 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050419-20 si:dkey-119o24.1 "si:dkey-119o24.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E7EWK3 DHX36 "Probable ATP-dependent RNA helicase DHX36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2039280 AT2G35920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052841 HVT1 "helicase in vascular tissue and tapetum" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query455
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 4e-37
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 5e-25
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 1e-20
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 8e-18
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 3e-16
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-13
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 3e-12
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-07
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 6e-07
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 3e-05
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 2e-04
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
 Score =  144 bits (365), Expect = 4e-37
 Identities = 51/116 (43%), Positives = 64/116 (55%), Gaps = 2/116 (1%)

Query: 189 ILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLA 248
           ILVFLPG   I      +           +I+PL+  L    Q  +F   P G RK+VLA
Sbjct: 262 ILVFLPGQREIERTAEWL--EKAELGDDLEILPLYGALSAEEQVRVFEPAPGGKRKVVLA 319

Query: 249 TNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRT 304
           TNIAETS+TI  I YV+D G  K   +D +  +  L+ E IS A+A QR GRAGRT
Sbjct: 320 TNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRAGRT 375


Length = 845

>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 455
KOG0923|consensus 902 100.0
KOG0922|consensus 674 100.0
KOG0924|consensus 1042 100.0
KOG0925|consensus 699 100.0
KOG0920|consensus 924 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
KOG0926|consensus 1172 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0921|consensus 1282 100.0
KOG0330|consensus476 100.0
KOG0331|consensus519 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.97
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.97
KOG0328|consensus400 99.97
PRK01172 674 ski2-like helicase; Provisional 99.97
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.97
PTZ00110545 helicase; Provisional 99.97
KOG0340|consensus442 99.97
KOG0345|consensus567 99.96
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.96
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.96
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.96
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.96
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.96
PTZ00424401 helicase 45; Provisional 99.96
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.96
PRK02362 737 ski2-like helicase; Provisional 99.96
KOG0333|consensus673 99.96
KOG0342|consensus543 99.96
KOG0343|consensus 758 99.95
KOG0338|consensus691 99.95
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.94
PRK00254 720 ski2-like helicase; Provisional 99.94
KOG0332|consensus477 99.94
KOG0347|consensus731 99.94
KOG0326|consensus459 99.93
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.93
KOG0341|consensus610 99.93
KOG0336|consensus629 99.93
KOG0339|consensus731 99.93
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.93
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.92
KOG0335|consensus482 99.92
KOG0348|consensus708 99.92
KOG0334|consensus 997 99.91
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.91
KOG0327|consensus397 99.9
KOG0346|consensus569 99.9
PRK13767 876 ATP-dependent helicase; Provisional 99.9
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.89
PRK106891147 transcription-repair coupling factor; Provisional 99.87
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.87
KOG0344|consensus593 99.87
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.86
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.86
KOG0350|consensus620 99.86
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.84
KOG4284|consensus 980 99.84
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.83
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.83
KOG0337|consensus529 99.82
COG1202 830 Superfamily II helicase, archaea-specific [General 99.82
KOG0349|consensus725 99.81
PRK09401 1176 reverse gyrase; Reviewed 99.76
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.76
COG1204 766 Superfamily II helicase [General function predicti 99.74
COG1205 851 Distinct helicase family with a unique C-terminal 99.74
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.73
PHA02558501 uvsW UvsW helicase; Provisional 99.72
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.7
PRK14701 1638 reverse gyrase; Provisional 99.69
KOG0354|consensus746 99.68
PRK13766 773 Hef nuclease; Provisional 99.65
KOG0352|consensus 641 99.64
PRK09694878 helicase Cas3; Provisional 99.63
KOG0351|consensus 941 99.62
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.62
KOG0952|consensus 1230 99.62
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.6
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.56
PRK05580679 primosome assembly protein PriA; Validated 99.53
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.53
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.52
KOG0921|consensus 1282 99.48
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.47
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.46
KOG0950|consensus 1008 99.46
KOG0329|consensus387 99.45
KOG0951|consensus 1674 99.44
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.43
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.42
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.42
PRK05298652 excinuclease ABC subunit B; Provisional 99.42
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.41
KOG0353|consensus 695 99.4
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.37
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.32
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.3
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.29
smart0049082 HELICc helicase superfamily c-terminal domain. 99.25
PRK04914 956 ATP-dependent helicase HepA; Validated 99.23
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.22
KOG0948|consensus 1041 99.21
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.16
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.15
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.13
KOG0947|consensus 1248 99.08
KOG4150|consensus 1034 99.02
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 98.99
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.82
KOG0953|consensus700 98.82
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.76
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.73
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.73
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.49
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.39
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.37
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.32
COG1198730 PriA Primosomal protein N' (replication factor Y) 98.21
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.17
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.75
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 97.65
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 97.61
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 97.6
PRK12326764 preprotein translocase subunit SecA; Reviewed 97.55
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.01
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 96.83
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.77
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 96.75
CHL00122 870 secA preprotein translocase subunit SecA; Validate 96.66
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 96.58
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 96.42
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.42
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 96.31
KOG0949|consensus 1330 96.3
KOG0391|consensus 1958 96.14
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 96.09
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 95.91
smart00487201 DEXDc DEAD-like helicases superfamily. 95.89
COG4096 875 HsdR Type I site-specific restriction-modification 95.81
KOG0392|consensus1549 95.81
KOG0385|consensus 971 95.79
PF04851184 ResIII: Type III restriction enzyme, res subunit; 95.61
PF1324576 AAA_19: Part of AAA domain 95.57
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.39
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 95.33
KOG0951|consensus1674 95.3
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.27
KOG1123|consensus776 95.24
smart00488289 DEXDc2 DEAD-like helicases superfamily. 95.24
smart00489289 DEXDc3 DEAD-like helicases superfamily. 95.24
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.18
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 95.11
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 95.11
PRK13833323 conjugal transfer protein TrbB; Provisional 95.04
PF1355562 AAA_29: P-loop containing region of AAA domain 94.98
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.95
PRK10536262 hypothetical protein; Provisional 94.94
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 94.91
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 94.84
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.74
KOG0384|consensus 1373 94.64
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 94.6
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.6
PRK13851344 type IV secretion system protein VirB11; Provision 94.6
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.46
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 94.39
KOG1802|consensus 935 94.16
KOG0389|consensus941 94.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 93.92
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.91
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 93.81
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 93.78
KOG0387|consensus 923 93.65
COG1136226 SalX ABC-type antimicrobial peptide transport syst 93.58
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 93.55
smart00382148 AAA ATPases associated with a variety of cellular 93.5
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 93.48
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 93.46
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 92.98
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 92.98
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 92.78
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 92.75
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 92.68
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 92.53
KOG0390|consensus776 92.51
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 92.5
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 92.43
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 92.41
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.37
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 92.35
PRK05580 679 primosome assembly protein PriA; Validated 92.3
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 92.2
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 92.16
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 92.14
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 92.05
KOG2373|consensus514 91.94
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 91.88
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 91.86
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 91.76
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 91.57
KOG1000|consensus689 91.48
COG4525259 TauB ABC-type taurine transport system, ATPase com 91.44
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 91.38
PRK10436462 hypothetical protein; Provisional 91.31
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 91.29
PF00005137 ABC_tran: ABC transporter This structure is on hol 91.28
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 91.23
TIGR02533486 type_II_gspE general secretory pathway protein E. 91.2
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 91.17
TIGR00595 505 priA primosomal protein N'. All proteins in this f 91.13
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.12
PF05729166 NACHT: NACHT domain 91.11
COG1117253 PstB ABC-type phosphate transport system, ATPase c 91.06
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 90.98
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 90.93
PRK14974336 cell division protein FtsY; Provisional 90.68
PRK14873 665 primosome assembly protein PriA; Provisional 90.68
PRK00300205 gmk guanylate kinase; Provisional 90.64
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 90.62
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 90.57
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 90.43
PF13173128 AAA_14: AAA domain 90.18
PRK13764602 ATPase; Provisional 90.16
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 90.16
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 90.12
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 90.09
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 90.01
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 89.93
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 89.91
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 89.9
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 89.83
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 89.81
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 89.73
PRK08233182 hypothetical protein; Provisional 89.68
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 89.63
KOG0388|consensus1185 89.57
TIGR00235207 udk uridine kinase. Model contains a number of lon 89.54
PF12846304 AAA_10: AAA-like domain 89.44
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 89.41
PF00004132 AAA: ATPase family associated with various cellula 89.4
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 89.35
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 89.35
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 89.3
PRK10875615 recD exonuclease V subunit alpha; Provisional 89.26
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 89.22
PRK09200 790 preprotein translocase subunit SecA; Reviewed 89.04
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 88.99
COG3910233 Predicted ATPase [General function prediction only 88.94
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 88.91
KOG1970|consensus 634 88.89
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 88.88
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 88.87
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 88.84
cd03269210 ABC_putative_ATPase This subfamily is involved in 88.77
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 88.74
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 88.74
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 88.72
PRK14530215 adenylate kinase; Provisional 88.7
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 88.69
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 88.63
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 88.61
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 88.6
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 88.59
PHA02244383 ATPase-like protein 88.58
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 88.58
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 88.53
PRK06526254 transposase; Provisional 88.52
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 88.42
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 88.36
PRK09183259 transposase/IS protein; Provisional 88.36
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 88.36
PRK05541176 adenylylsulfate kinase; Provisional 88.32
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 88.29
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 88.27
PRK07261171 topology modulation protein; Provisional 88.27
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 88.23
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 88.21
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 88.21
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 88.12
PLN02165334 adenylate isopentenyltransferase 88.08
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 87.99
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 87.98
TIGR00376637 DNA helicase, putative. The gene product may repre 87.94
COG4136213 ABC-type uncharacterized transport system, ATPase 87.93
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 87.9
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 87.9
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 87.87
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 87.82
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 87.8
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 87.8
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 87.8
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 87.79
PRK14527191 adenylate kinase; Provisional 87.76
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 87.76
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 87.71
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 87.69
cd03246173 ABCC_Protease_Secretion This family represents the 87.68
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 87.68
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 87.66
PRK11331459 5-methylcytosine-specific restriction enzyme subun 87.61
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 87.61
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 87.6
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 87.58
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 87.58
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 87.57
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 87.56
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 87.55
PRK14242253 phosphate transporter ATP-binding protein; Provisi 87.54
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 87.52
PRK12402337 replication factor C small subunit 2; Reviewed 87.48
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 87.48
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 87.47
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 87.43
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 87.39
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 87.36
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 87.31
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 87.28
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 87.27
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 87.23
PRK14531183 adenylate kinase; Provisional 87.2
PRK00698205 tmk thymidylate kinase; Validated 87.16
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 87.16
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 87.15
COG3842352 PotA ABC-type spermidine/putrescine transport syst 87.14
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 87.13
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 87.12
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 87.12
PRK10908222 cell division protein FtsE; Provisional 87.08
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 87.07
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 87.06
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 87.03
KOG1803|consensus649 87.01
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 86.95
COG1127263 Ttg2A ABC-type transport system involved in resist 86.88
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 86.88
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 86.86
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 86.79
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 86.78
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 86.73
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 86.71
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 86.69
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 86.69
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 86.69
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 86.66
PRK08118167 topology modulation protein; Reviewed 86.65
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 86.65
PRK09825176 idnK D-gluconate kinase; Provisional 86.64
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 86.63
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 86.56
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 86.55
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 86.54
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 86.51
cd03216163 ABC_Carb_Monos_I This family represents the domain 86.47
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 86.46
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 86.45
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 86.45
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 86.4
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 86.33
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 86.32
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 86.29
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 86.26
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 86.23
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 86.22
PRK05480209 uridine/cytidine kinase; Provisional 86.2
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 86.19
cd03215182 ABC_Carb_Monos_II This family represents domain II 86.16
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 86.12
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 86.12
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 86.11
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 86.1
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 86.02
PRK14738206 gmk guanylate kinase; Provisional 86.01
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 86.0
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 85.99
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 85.98
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 85.97
PRK14239252 phosphate transporter ATP-binding protein; Provisi 85.8
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 85.78
KOG0060|consensus659 85.72
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 85.69
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 85.68
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 85.65
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 85.65
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 85.61
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 85.56
COG4133209 CcmA ABC-type transport system involved in cytochr 85.52
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 85.5
PRK14237267 phosphate transporter ATP-binding protein; Provisi 85.48
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 85.46
KOG0347|consensus 731 85.43
PRK06762166 hypothetical protein; Provisional 85.42
PRK00131175 aroK shikimate kinase; Reviewed 85.41
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 85.37
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 85.31
COG4152300 ABC-type uncharacterized transport system, ATPase 85.3
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 85.28
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 85.24
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 85.24
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 85.22
KOG1533|consensus290 85.21
PRK14240250 phosphate transporter ATP-binding protein; Provisi 85.2
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 85.19
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 85.17
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 85.17
PRK14737186 gmk guanylate kinase; Provisional 85.15
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 85.12
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 85.11
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 85.09
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 85.06
PRK03695248 vitamin B12-transporter ATPase; Provisional 85.05
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 85.04
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 85.03
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 84.95
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 84.94
PRK14532188 adenylate kinase; Provisional 84.93
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 84.91
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 84.91
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 84.91
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 84.88
COG4619223 ABC-type uncharacterized transport system, ATPase 84.84
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 84.84
cd03234226 ABCG_White The White subfamily represents ABC tran 84.82
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 84.82
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 84.81
PRK14241258 phosphate transporter ATP-binding protein; Provisi 84.8
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 84.78
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 84.77
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 84.75
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 84.75
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 84.74
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 84.73
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 84.73
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 84.71
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 84.71
PRK08356195 hypothetical protein; Provisional 84.69
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 84.67
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 84.67
PRK08181269 transposase; Validated 84.66
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 84.66
PRK04296190 thymidine kinase; Provisional 84.59
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 84.59
PRK06217183 hypothetical protein; Validated 84.58
PRK14235267 phosphate transporter ATP-binding protein; Provisi 84.58
PRK14528186 adenylate kinase; Provisional 84.56
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 84.53
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 84.52
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 84.51
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 84.48
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 84.42
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 84.42
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 84.39
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 84.37
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 84.36
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 84.35
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 84.35
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 84.34
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 84.32
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 84.3
COG3973 747 Superfamily I DNA and RNA helicases [General funct 84.29
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 84.29
PRK14238271 phosphate transporter ATP-binding protein; Provisi 84.29
PRK09984262 phosphonate/organophosphate ester transporter subu 84.28
PRK10253265 iron-enterobactin transporter ATP-binding protein; 84.25
PRK13975196 thymidylate kinase; Provisional 84.23
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 84.16
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 84.15
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 84.13
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 84.13
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 84.12
PRK07667193 uridine kinase; Provisional 84.09
PRK09087226 hypothetical protein; Validated 84.02
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 84.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 84.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 83.98
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 83.98
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 83.97
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 83.96
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 83.91
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 83.88
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 83.87
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 83.85
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 83.85
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 83.84
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 83.83
PRK10619257 histidine/lysine/arginine/ornithine transporter su 83.83
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 83.82
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 83.79
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 83.79
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 83.73
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 83.69
PRK03839180 putative kinase; Provisional 83.69
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 83.68
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 83.65
PRK01184184 hypothetical protein; Provisional 83.65
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 83.64
>KOG0923|consensus Back     alignment and domain information
Probab=100.00  E-value=2.9e-93  Score=721.73  Aligned_cols=392  Identities=28%  Similarity=0.402  Sum_probs=354.9

Q ss_pred             HHHHHHHHHccCCCHHHHHHHHHHHHcCCeEEEEcCCCCCcccchh-hhhh-----------------------------
Q psy6094          45 RYQEMLEARKKLPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLD-FITL-----------------------------   94 (455)
Q Consensus        45 ~~~~~l~~R~~lP~~~~q~~il~~i~~~~~vii~~~TGSGKTtqlp-~ll~-----------------------------   94 (455)
                      +-.++.+.|+.||+|.++++++.+|.++||+||.|+||||||||+| ||.+                             
T Consensus       253 ~~~~iee~RksLPVy~ykdell~av~e~QVLiI~GeTGSGKTTQiPQyL~EaGytk~gk~IgcTQPRRVAAmSVAaRVA~  332 (902)
T KOG0923|consen  253 RRESIEEVRKSLPVYPYKDELLKAVKEHQVLIIVGETGSGKTTQIPQYLYEAGYTKGGKKIGCTQPRRVAAMSVAARVAE  332 (902)
T ss_pred             HHHHHHHHHhcCCchhhHHHHHHHHHhCcEEEEEcCCCCCccccccHHHHhcccccCCceEeecCcchHHHHHHHHHHHH
Confidence            4556778899999999999999999999999999999999999999 9987                             


Q ss_pred             hh----cCCCCC-hH-----------------HHHHhc-cCCCCcCcc-------------hHHHHHHHHHHHHhcCCCC
Q psy6094          95 KR----SETQQY-PN-----------------DVLNML-KDPELEGVN-------------NDVIFSLLQHICTTQRPGA  138 (455)
Q Consensus        95 e~----~~~vg~-p~-----------------~ll~~l-~d~~L~~~~-------------~D~ll~~lk~il~~~~~~~  138 (455)
                      |+    |..||| +|                 -|||++ .+|+|..|+             +|+|++++|++. +.||++
T Consensus       333 EMgvkLG~eVGYsIRFEdcTSekTvlKYMTDGmLlREfL~epdLasYSViiiDEAHERTL~TDILfgLvKDIa-r~RpdL  411 (902)
T KOG0923|consen  333 EMGVKLGHEVGYSIRFEDCTSEKTVLKYMTDGMLLREFLSEPDLASYSVIIVDEAHERTLHTDILFGLVKDIA-RFRPDL  411 (902)
T ss_pred             HhCcccccccceEEEeccccCcceeeeeecchhHHHHHhccccccceeEEEeehhhhhhhhhhHHHHHHHHHH-hhCCcc
Confidence            22    223332 11                 189998 999999999             999999999999 999999


Q ss_pred             eEEEEccCC-----------------CCC-ccceEEeehhhhhhhhccCCCCChHHHHHHHHccCCCCEEEEcCCHHHHH
Q psy6094         139 ILVYCTYTF-----------------MGV-SPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPILVFLPGWDTIN  200 (455)
Q Consensus       139 k~ilmSAT~-----------------~g~-~pv~~~~l~~~~~~~~~~~~~~~~~~l~~~i~~~~~g~iLVFlp~~~ei~  200 (455)
                      |++++|||+                 ||+ |||+++|.+.+.-+|+.....+   .+..|+. .+.|+||||++|+++|+
T Consensus       412 KllIsSAT~DAekFS~fFDdapIF~iPGRRyPVdi~Yt~~PEAdYldAai~t---VlqIH~t-qp~GDILVFltGQeEIE  487 (902)
T KOG0923|consen  412 KLLISSATMDAEKFSAFFDDAPIFRIPGRRYPVDIFYTKAPEADYLDAAIVT---VLQIHLT-QPLGDILVFLTGQEEIE  487 (902)
T ss_pred             eEEeeccccCHHHHHHhccCCcEEeccCcccceeeecccCCchhHHHHHHhh---heeeEec-cCCccEEEEeccHHHHH
Confidence            999999999                 999 9999999988877776544321   2333333 77899999999999999


Q ss_pred             HHHHHHHhcCCC---CCCCeEEEeecCCCChhhHhhhhcCCCCCceEEEEeCCCCccCCCCCCeeEEEeCCCCccccccc
Q psy6094         201 SLHRSMCQSSFF---NSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDV  277 (455)
Q Consensus       201 ~l~~~L~~~~~~---~~~~~~v~~lhs~l~~~~r~~v~~~~~~g~~kVivaTniae~gitI~~V~~VID~g~~k~~~yd~  277 (455)
                      .+.+.|.+....   ....+.++|+|+.||.+.|.+||++.|+|.||||+|||||||||||+||.||||+|++|++.|||
T Consensus       488 t~~e~l~~~~~~LGski~eliv~PiYaNLPselQakIFePtP~gaRKVVLATNIAETSlTIdgI~yViDpGf~K~nsynp  567 (902)
T KOG0923|consen  488 TVKENLKERCRRLGSKIRELIVLPIYANLPSELQAKIFEPTPPGARKVVLATNIAETSLTIDGIKYVIDPGFVKQNSYNP  567 (902)
T ss_pred             HHHHHHHHHHHHhccccceEEEeeccccCChHHHHhhcCCCCCCceeEEEeecchhhceeecCeEEEecCccccccCcCC
Confidence            999888865322   34578999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccccccchhhHHhhhcccCCCCCCeEEecCC----hhhhccCCCCcccccC-hHHHHHHHh---------hhcC
Q psy6094         278 KDNIATLKPEWISLANAKQRRGRAGRTLKRSETQQYP----NDVLNMLKDPELEGVN-NDVIFSLLQ---------HICT  343 (455)
Q Consensus       278 ~~~~~~l~~~~iSka~~~QR~GRaGR~~~G~c~~L~t----~~~~~~~~~PEi~r~~-~~~~L~~l~---------~~~~  343 (455)
                      ++||+.|..+|||||+|.||+|||||+|||+||||||    ..+++..+.|||+|.| ..++|.+++         +|++
T Consensus       568 rtGmesL~v~piSKAsA~QRaGRAGRtgPGKCfRLYt~~aY~~eLE~~t~PEIqRtnL~nvVL~LkSLGI~Dl~~FdFmD  647 (902)
T KOG0923|consen  568 RTGMESLLVTPISKASANQRAGRAGRTGPGKCFRLYTAWAYEHELEEMTVPEIQRTNLGNVVLLLKSLGIHDLIHFDFLD  647 (902)
T ss_pred             CcCceeEEEeeechhhhhhhccccCCCCCCceEEeechhhhhhhhccCCCcceeeccchhHHHHHHhcCcchhcccccCC
Confidence            9999999999999999999999999999999999999    5678899999999999 999997765         8999


Q ss_pred             CCChhhHHhHHhhhhhcccccCCCCCCcccCChHHHHHhhCCCCh---------------hHHHHHHHhhc-----CcCC
Q psy6094         344 TQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKP---------------KEIITVRDCLS-----FECK  403 (455)
Q Consensus       344 ~P~~~~i~~al~~L~~lgald~~~~l~~~~~T~lG~~l~~lp~~p---------------~~~l~iaa~ls-----f~~p  403 (455)
                      ||+.+++..||+.|+.||||+..|+|     |.+|+.|++||+||               ++|++||||||     |+.|
T Consensus       648 pPp~etL~~aLE~LyaLGALn~~GeL-----Tk~GrrMaEfP~dPmlsKmi~as~ky~cs~EiitiaamlS~~~svfyrp  722 (902)
T KOG0923|consen  648 PPPTETLLKALEQLYALGALNHLGEL-----TKLGRRMAEFPVDPMLSKMIVASEKYKCSEEIITIAAMLSVGASVFYRP  722 (902)
T ss_pred             CCChHHHHHHHHHHHHhhccccccch-----hhhhhhhhhcCCCHHHHhHHhhhccccchHHHHHHHHHHhcCchheecc
Confidence            99999999999999999999999999     99999999999999               79999999999     8899


Q ss_pred             cChHHHHHHHHhhhC-CCCcHHHHHHHHHHHhcCCCCchHhHHHhh
Q psy6094         404 PSTAKIIKELRARLD-MLLAHKLSHPGTTAWGDPNEGNILHCCSGF  448 (455)
Q Consensus       404 ~~~~~~~~~~~~~~~-~~sD~~~~~~~~~~~~~~~~~~~~~~c~~~  448 (455)
                      .++.-.++.+++.|. +.|||++++++|++|...+.+  .+||.++
T Consensus       723 k~~~v~ad~a~~~f~~~~gDhi~~L~vyn~w~es~~s--~~wC~e~  766 (902)
T KOG0923|consen  723 KDKQVHADNARKNFEEPVGDHIVLLNVYNQWKESKYS--TQWCYEN  766 (902)
T ss_pred             hhhhhhhhhhhhccCCCCcchhhhhHHHHHHhhcchh--hHHHHHh
Confidence            999999999999999 999999999999999999886  8999873



>KOG0922|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG2373|consensus Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query455
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 2e-15
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 2e-15
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure

Iteration: 1

Score = 80.5 bits (197), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 51/126 (40%), Positives = 68/126 (53%), Gaps = 10/126 (7%) Query: 189 ILVFLPGWDTINSLHRSMCQSS-----FFNSSRFQIIPLHSMLPTVSQKSIFNTPPEG-- 241 IL+FL G D I R + + PL+ LP Q+ IF PE Sbjct: 306 ILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHN 365 Query: 242 ---VRKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRR 298 RK+V++TNIAETS+TID IVYVVD G +K ++ + + +L IS A+A+QR Sbjct: 366 GRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRA 425 Query: 299 GRAGRT 304 GRAGRT Sbjct: 426 GRAGRT 431
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query455
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 1e-34
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 6e-08
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 1e-28
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 2e-28
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 6e-28
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 7e-28
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 1e-27
1yks_A440 Genome polyprotein [contains: flavivirin protease 2e-27
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-25
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  136 bits (344), Expect = 1e-34
 Identities = 51/126 (40%), Positives = 68/126 (53%), Gaps = 10/126 (7%)

Query: 189 ILVFLPGWDTINSLHRSMCQ-----SSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGV- 242
           IL+FL G D I    R +                 + PL+  LP   Q+ IF   PE   
Sbjct: 306 ILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHN 365

Query: 243 ----RKIVLATNIAETSITIDDIVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRR 298
               RK+V++TNIAETS+TID IVYVVD G +K   ++ +  + +L    IS A+A+QR 
Sbjct: 366 GRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRA 425

Query: 299 GRAGRT 304
           GRAGRT
Sbjct: 426 GRAGRT 431


>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query455
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.97
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.97
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.96
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.96
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.96
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.96
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.96
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.96
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.95
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.95
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.95
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.95
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.95
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.95
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.94
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.94
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.94
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.94
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.94
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.94
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.94
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.93
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.93
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.93
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.93
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.92
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.92
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.91
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.91
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.91
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.91
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.91
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.91
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.9
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.89
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.88
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.88
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.87
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.86
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.86
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.86
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.85
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.84
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.84
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.83
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.81
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.81
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.8
3i4u_A 270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 99.79
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.79
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.79
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.78
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.77
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.76
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.76
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.76
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.61
3h1t_A590 Type I site-specific restriction-modification syst 99.67
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.67
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.66
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.6
3jux_A822 Protein translocase subunit SECA; protein transloc 99.47
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.41
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.24
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.23
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.93
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 98.91
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.8
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.78
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.78
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.78
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.77
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.76
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.75
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.74
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.74
3bor_A237 Human initiation factor 4A-II; translation initiat 98.71
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.7
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.68
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.68
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.62
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.36
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.92
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.78
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 96.31
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 95.34
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 95.27
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 94.5
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 94.08
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 93.82
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 93.54
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.38
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.3
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 93.3
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 92.95
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 92.89
2eyu_A261 Twitching motility protein PILT; pilus retraction 92.87
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.76
2oap_1511 GSPE-2, type II secretion system protein; hexameri 92.71
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 92.71
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.67
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.39
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 92.27
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.2
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.13
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 92.07
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 91.92
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 91.81
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.78
3co5_A143 Putative two-component system transcriptional RES 91.67
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.64
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 91.5
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 91.39
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.2
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.0
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 90.98
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 90.96
3vaa_A199 Shikimate kinase, SK; structural genomics, center 90.83
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 90.79
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 90.76
2kjq_A149 DNAA-related protein; solution structure, NESG, st 90.76
2ewv_A372 Twitching motility protein PILT; pilus retraction 90.69
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 90.65
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 90.63
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 90.62
1p9r_A418 General secretion pathway protein E; bacterial typ 90.56
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 90.2
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 90.17
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 90.15
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 90.03
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 89.98
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 89.97
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 89.86
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 89.85
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 89.8
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 89.67
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 89.48
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.42
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 89.19
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 89.18
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 88.99
1sgw_A214 Putative ABC transporter; structural genomics, P p 88.98
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 88.9
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 88.89
2chg_A226 Replication factor C small subunit; DNA-binding pr 88.88
1g6h_A257 High-affinity branched-chain amino acid transport 88.87
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 88.86
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 88.86
1b0u_A262 Histidine permease; ABC transporter, transport pro 88.81
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 88.81
2ghi_A260 Transport protein; multidrug resistance protein, M 88.69
1ji0_A240 ABC transporter; ATP binding protein, structural g 88.67
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 88.62
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 88.59
3bos_A242 Putative DNA replication factor; P-loop containing 88.56
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 88.53
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 88.47
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 88.47
4a74_A231 DNA repair and recombination protein RADA; hydrola 88.43
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 88.43
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 88.42
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 88.38
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 88.34
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 88.32
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 88.29
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 88.27
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 88.2
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 88.12
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 88.1
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 88.05
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 88.0
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 88.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 87.95
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 87.87
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 87.71
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 87.69
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 87.69
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 87.68
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 87.58
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 87.57
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 87.52
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 87.48
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 87.46
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 87.46
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 87.35
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 87.22
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 87.1
2vli_A183 Antibiotic resistance protein; transferase, tunica 87.05
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 86.95
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 86.92
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 86.89
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 86.89
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 86.89
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 86.84
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 86.82
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 86.78
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 86.73
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 86.64
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 86.59
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 86.5
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 86.5
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 86.48
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 86.45
3kta_A182 Chromosome segregation protein SMC; structural mai 86.39
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 86.35
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 86.34
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 86.32
2qgz_A308 Helicase loader, putative primosome component; str 86.28
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 86.28
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 86.25
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 86.09
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 85.97
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 85.97
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 85.88
2cvh_A220 DNA repair and recombination protein RADB; filamen 85.87
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 85.83
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 85.81
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 85.73
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 85.73
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 85.72
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 85.69
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 85.69
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 85.68
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 85.66
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 85.59
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 85.46
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 85.35
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 85.3
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 85.14
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 85.14
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 85.11
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 85.09
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 85.07
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 85.06
2r44_A331 Uncharacterized protein; putative ATPase, structur 85.05
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 85.03
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 85.03
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 84.96
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 84.94
1xjc_A169 MOBB protein homolog; structural genomics, midwest 84.92
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 84.88
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 84.79
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 84.61
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 84.59
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 84.55
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 84.55
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 84.5
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 84.5
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 84.49
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 84.48
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 84.46
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 84.43
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 84.42
3tlx_A243 Adenylate kinase 2; structural genomics, structura 84.35
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 84.32
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 84.22
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 84.2
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 84.16
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 84.09
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 83.97
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 83.88
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 83.86
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 83.84
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 83.81
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 83.75
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 83.68
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 83.65
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 83.6
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 83.39
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 83.26
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 83.22
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 83.19
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 83.15
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 83.12
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 83.12
2og2_A359 Putative signal recognition particle receptor; nuc 83.1
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 83.0
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 82.98
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 82.97
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 82.92
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 82.87
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 82.86
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 82.83
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 82.71
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 82.68
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 82.48
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 82.45
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 82.44
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 82.42
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 82.42
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 82.35
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 82.33
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 82.32
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 82.29
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 82.2
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 82.14
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 82.07
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 82.06
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 81.95
1via_A175 Shikimate kinase; structural genomics, transferase 81.91
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 81.66
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 81.65
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 81.62
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 81.57
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 81.44
3pvs_A447 Replication-associated recombination protein A; ma 81.4
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 81.39
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 81.36
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 81.26
2v1u_A387 Cell division control protein 6 homolog; DNA repli 81.19
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 81.11
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 80.94
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 80.86
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 80.85
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 80.84
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 80.84
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 80.8
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 80.55
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 80.5
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 80.48
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 80.42
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 80.32
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 80.32
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 80.31
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 80.25
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 80.04
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 80.04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=1e-65  Score=565.73  Aligned_cols=402  Identities=26%  Similarity=0.353  Sum_probs=338.2

Q ss_pred             HHHHHhcCHHHHHHHHHHccCCCHHHHHHHHHHHHcCCeEEEEcCCCCCcccchh-hhhh--------------------
Q psy6094          36 EMIRKLQSRRYQEMLEARKKLPSYQMRDAVLDMVRNNQITVISGETGSGPPLHLD-FITL--------------------   94 (455)
Q Consensus        36 ~~~~~~~~~~~~~~l~~R~~lP~~~~q~~il~~i~~~~~vii~~~TGSGKTtqlp-~ll~--------------------   94 (455)
                      .|.+...++++.++++.|+.+|++.+|++++.++.++++++|+|+|||||||++| +++.                    
T Consensus        73 ~f~~~~l~~~~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~L  152 (773)
T 2xau_A           73 PFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRVA  152 (773)
T ss_dssp             TTTCSBCCHHHHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHHH
T ss_pred             CccccCCCHHHHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHHH
Confidence            4777888999999999999999999999999999999999999999999999999 5433                    


Q ss_pred             ----------hhcCCCC----------------------ChHHHHHhc-cCCCCcCcc-------------hHHHHHHHH
Q psy6094          95 ----------KRSETQQ----------------------YPNDVLNML-KDPELEGVN-------------NDVIFSLLQ  128 (455)
Q Consensus        95 ----------e~~~~vg----------------------~p~~ll~~l-~d~~L~~~~-------------~D~ll~~lk  128 (455)
                                +.+..+|                      +|+.+++.+ .++.+.+++             +|.++.+++
T Consensus       153 a~q~~~~l~~~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~  232 (773)
T 2xau_A          153 AMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLK  232 (773)
T ss_dssp             HHHHHHHHHHHTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHH
Confidence                      1111111                      244466666 566666655             677788899


Q ss_pred             HHHHhcCCCCeEEEEccCC-----------------CCC-ccceEEeehhhhhhhhccCCCCChHHHHHHHHccCCCCEE
Q psy6094         129 HICTTQRPGAILVYCTYTF-----------------MGV-SPMKVFFCKNVLQRLMKGVGANSPKRWVKLLRSMLVVPIL  190 (455)
Q Consensus       129 ~il~~~~~~~k~ilmSAT~-----------------~g~-~pv~~~~l~~~~~~~~~~~~~~~~~~l~~~i~~~~~g~iL  190 (455)
                      .+. ..+++.|+|+||||+                 +|+ +|++.+|.+.....+...    ....+........+|++|
T Consensus       233 ~l~-~~~~~~~iIl~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~~~~~~~~----~l~~l~~~~~~~~~g~iL  307 (773)
T 2xau_A          233 QVV-KRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDS----AIRTVLQIHATEEAGDIL  307 (773)
T ss_dssp             HHH-HHCTTCEEEEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSCCSCHHHH----HHHHHHHHHHHSCSCEEE
T ss_pred             HHH-HhCCCceEEEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCCchhHHHH----HHHHHHHHHHhcCCCCEE
Confidence            988 677899999999999                 677 888888876432111100    000122222225789999


Q ss_pred             EEcCCHHHHHHHHHHHHhcCC-----CCCCCeEEEeecCCCChhhHhhhhcCCC-----CCceEEEEeCCCCccCCCCCC
Q psy6094         191 VFLPGWDTINSLHRSMCQSSF-----FNSSRFQIIPLHSMLPTVSQKSIFNTPP-----EGVRKIVLATNIAETSITIDD  260 (455)
Q Consensus       191 VFlp~~~ei~~l~~~L~~~~~-----~~~~~~~v~~lhs~l~~~~r~~v~~~~~-----~g~~kVivaTniae~gitI~~  260 (455)
                      |||+|+++|+.+++.|.....     ....++.+.++||+|++++|.++++.|+     +|.++||||||+||+|||||+
T Consensus       308 VF~~~~~~i~~l~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~  387 (773)
T 2xau_A          308 LFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDG  387 (773)
T ss_dssp             EECSCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTT
T ss_pred             EECCCHHHHHHHHHHHHHHHHhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCC
Confidence            999999999999999985100     0123589999999999999999999999     999999999999999999999


Q ss_pred             eeEEEeCCCCcccccccCCCcccccccccchhhHHhhhcccCCCCCCeEEecCChh----hhccCCCCcccccC-hHHHH
Q psy6094         261 IVYVVDCGKTKMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKRSETQQYPND----VLNMLKDPELEGVN-NDVIF  335 (455)
Q Consensus       261 V~~VID~g~~k~~~yd~~~~~~~l~~~~iSka~~~QR~GRaGR~~~G~c~~L~t~~----~~~~~~~PEi~r~~-~~~~L  335 (455)
                      |++|||+|++|.+.||+..|++.|.+.|+|+++|.||+|||||.++|.||+||+++    .+.++..|||++.+ .+++|
T Consensus       388 v~~VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~~L~~~~L  467 (773)
T 2xau_A          388 IVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVL  467 (773)
T ss_dssp             EEEEEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCSSCCCGGGGSCCHHHHH
T ss_pred             eEEEEeCCCccceeeccccCccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccccCCCccccCcHHHHHH
Confidence            99999999999999999999999999999999999999999999899999999954    36678999999999 99999


Q ss_pred             HHHh---------hhcCCCChhhHHhHHhhhhhcccccCCCCCCcccCChHHHHHhhCCCCh---------------hHH
Q psy6094         336 SLLQ---------HICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKP---------------KEI  391 (455)
Q Consensus       336 ~~l~---------~~~~~P~~~~i~~al~~L~~lgald~~~~l~~~~~T~lG~~l~~lp~~p---------------~~~  391 (455)
                      .+..         .|++||+++++..|++.|..+||||.++++     |++|+.|+.||++|               +++
T Consensus       468 ~l~~~gi~~~~~f~~~~~p~~~~i~~a~~~L~~lgald~~~~l-----T~lG~~~a~~pl~p~~~~~l~~~~~~~c~~~~  542 (773)
T 2xau_A          468 ELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNL-----TPLGRLASQFPLDPMLAVMLIGSFEFQCSQEI  542 (773)
T ss_dssp             HHHHTTCCCGGGCCCSSCCCHHHHHHHHHHHHHTTSBCTTSCB-----CHHHHHHTTSSSCHHHHHHHHHGGGGTCHHHH
T ss_pred             HHHHcCCCChhhccccCCCcHHHHHHHHHHHHHcCCcccCCCc-----ChhhhhhccccCCHHHHHHHHhhcccCchhHH
Confidence            7654         688999999999999999999999999999     99999999999999               899


Q ss_pred             HHHHHhhc----CcCCcChHHHHHHHHhhhC-CCCcHHHHHHHHHHHhcCCCC-c-hHhHHHh
Q psy6094         392 ITVRDCLS----FECKPSTAKIIKELRARLD-MLLAHKLSHPGTTAWGDPNEG-N-ILHCCSG  447 (455)
Q Consensus       392 l~iaa~ls----f~~p~~~~~~~~~~~~~~~-~~sD~~~~~~~~~~~~~~~~~-~-~~~~c~~  447 (455)
                      ++|||+|+    |..|.+.+++++.+|++|. ..|||++++|+|++|.+.... . ..+||++
T Consensus       543 l~i~a~ls~~~~f~~~~~~~~~~~~~~~~f~~~~~D~~~~l~~~~~~~~~~~~~~~~~~~c~~  605 (773)
T 2xau_A          543 LTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRD  605 (773)
T ss_dssp             HHHHHHHTSCCCBCCCTTCHHHHHHHHHTTCCTTBHHHHHHHHHHHHTSHHHHHHCHHHHHHH
T ss_pred             HHHHHhcccCCcccCChHHHHHHHHHHHhccCCCCcHHHHHHHHHHHHHhccccchHHHHHHH
Confidence            99999999    8888899999999999999 899999999999999775421 1 2589997



>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 455
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 9e-22
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 8e-14
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]
 Score = 93.1 bits (231), Expect = 9e-22
 Identities = 32/121 (26%), Positives = 48/121 (39%), Gaps = 12/121 (9%)

Query: 189 ILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLA 248
              FLP     N +  S+ ++         ++ L+         +I    P      +LA
Sbjct: 39  TAWFLPSIRAANVMAASLRKAGK------SVVVLNRKTFEREYPTIKQKKP----DFILA 88

Query: 249 TNIAETSITIDDIVYVVDCGKT-KMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKR 307
           T+IAE    +  +  V+DC    K    D    +A   P  IS ++A QRRGR GR   R
Sbjct: 89  TDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPNR 147

Query: 308 S 308
            
Sbjct: 148 D 148


>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query455
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.95
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.93
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.83
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.83
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.83
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.82
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.82
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.82
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.81
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.81
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.79
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.76
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.63
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.62
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.61
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.58
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.54
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.44
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.3
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.26
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.25
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.22
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.2
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.2
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.18
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.09
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.01
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.81
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.62
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.31
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.29
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.22
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.2
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.16
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.15
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.09
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.62
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.56
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.36
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.3
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.66
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.32
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.06
d1okkd2207 GTPase domain of the signal recognition particle r 94.96
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.73
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.64
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.14
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.13
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.76
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.49
d2qy9a2211 GTPase domain of the signal recognition particle r 93.44
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.36
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.36
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.3
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.07
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 93.04
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.92
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.77
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.37
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 92.31
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.24
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.15
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.14
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.88
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.77
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.49
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.45
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.42
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.25
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 91.18
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 91.12
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.08
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 91.06
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 91.06
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.9
d1vmaa2213 GTPase domain of the signal recognition particle r 90.78
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 90.75
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 90.73
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 90.73
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 90.64
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 90.63
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 90.51
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 90.51
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 90.28
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.25
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 90.24
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 89.92
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 89.76
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 89.71
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 89.69
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 89.58
d2awna2232 Maltose transport protein MalK, N-terminal domain 89.55
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 89.48
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 89.43
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.39
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.25
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.95
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 88.88
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.83
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 88.59
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 88.4
d2p6ra185 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 88.38
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 88.37
d1g2912240 Maltose transport protein MalK, N-terminal domain 88.33
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 88.31
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 88.22
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 88.16
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 88.12
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 87.6
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 87.54
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 87.38
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 87.11
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 86.79
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 86.78
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 86.73
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.59
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 86.59
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 86.43
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 86.35
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 85.94
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 85.87
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 85.8
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 85.71
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 85.62
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 85.55
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 85.48
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 85.47
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 85.42
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 85.18
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 85.18
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 85.15
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 84.94
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 84.81
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 84.77
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 84.7
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 84.64
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 83.58
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 83.51
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 83.42
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.32
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 82.98
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 82.81
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 82.61
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 82.5
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 80.98
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 80.69
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 80.08
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]
Probab=99.95  E-value=1.2e-30  Score=252.58  Aligned_cols=226  Identities=19%  Similarity=0.115  Sum_probs=165.6

Q ss_pred             cCCCCEEEEcCCHHHHHHHHHHHHhcCCCCCCCeEEEeecCCCChhhHhhhhcCCCCCceEEEEeCCCCccCCCCCCeeE
Q psy6094         184 MLVVPILVFLPGWDTINSLHRSMCQSSFFNSSRFQIIPLHSMLPTVSQKSIFNTPPEGVRKIVLATNIAETSITIDDIVY  263 (455)
Q Consensus       184 ~~~g~iLVFlp~~~ei~~l~~~L~~~~~~~~~~~~v~~lhs~l~~~~r~~v~~~~~~g~~kVivaTniae~gitI~~V~~  263 (455)
                      ..+|++||||||..+++.+++.|+..+      +.|++|||.++.+++.+    +++|.++|||||||||+|+|| ||++
T Consensus        34 ~~~g~~~~F~~s~~~~~~~a~~L~~~g------~~V~~l~~~~~~~e~~~----~~~~~~~~~~~t~~~~~~~~~-~~~~  102 (299)
T d1yksa2          34 ADKRPTAWFLPSIRAANVMAASLRKAG------KSVVVLNRKTFEREYPT----IKQKKPDFILATDIAEMGANL-CVER  102 (299)
T ss_dssp             HCCSCEEEECSCHHHHHHHHHHHHHTT------CCEEECCSSSCC------------CCCSEEEESSSTTCCTTC-CCSE
T ss_pred             hcCCCEEEEeCCHHHHHHHHHHHHhcC------CeEEEEcCcCcHhHHhh----hhcCCcCEEEEechhhhceec-CceE
Confidence            458999999999999999999999875      67999999999988765    457889999999999999999 6999


Q ss_pred             EEeCCCC-cccccccCCCcccccccccchhhHHhhhcccCCCCCC-eEEecCChhhhccC------CCCcccccChHHHH
Q psy6094         264 VVDCGKT-KMSNFDVKDNIATLKPEWISLANAKQRRGRAGRTLKR-SETQQYPNDVLNML------KDPELEGVNNDVIF  335 (455)
Q Consensus       264 VID~g~~-k~~~yd~~~~~~~l~~~~iSka~~~QR~GRaGR~~~G-~c~~L~t~~~~~~~------~~PEi~r~~~~~~L  335 (455)
                      |||+|+. |...||+.+++..+...|+|++++.||+||+||.+.+ .||.+|+....++.      +.++|...+-.+.+
T Consensus       103 vid~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~qr~gr~gr~~~~~~~~~~y~~~~~~d~~~~~~~te~~i~l~~i~l~~  182 (299)
T d1yksa2         103 VLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRNPNRDGDSYYYSEPTSENNAHHVCWLEASMLLDNMEVRG  182 (299)
T ss_dssp             EEECCEEEEEEEETTTTEEEEEEEEECCHHHHHHHHTTSSCCTTCCCEEEEECSCCCCCCTTBHHHHHHHHHHTTSCCGG
T ss_pred             EEecCceeceeeecCCCCeeEEeeeecCHHHHHHhcccccccCCCceEEEEeCCCCCCcccchhhhhhHHHHhhCccccc
Confidence            9999995 8889999999999999999999999999999998653 56777774322111      11233332200011


Q ss_pred             -------HHHhhhcCCCChhhHHhHHhhhhhcccccCCCCCCcccCChHHHHHhhCCCChhHHHHHHHhhcCcCCcChHH
Q psy6094         336 -------SLLQHICTTQRPGAILVFLPGWDTINSLHRSMCQSSFFNSCLLYEFAMVDNKPKEIITVRDCLSFECKPSTAK  408 (455)
Q Consensus       336 -------~~l~~~~~~P~~~~i~~al~~L~~lgald~~~~l~~~~~T~lG~~l~~lp~~p~~~l~iaa~lsf~~p~~~~~  408 (455)
                             ....+++++|+.+....+++.+..+|||+..+..     +.+|+.++.+++.+...     -..|+.|....-
T Consensus       183 ~~~g~~~~~e~~~~~~p~g~~~L~~~~~l~~l~aL~~~d~p-----~~La~~va~~~~~~~~~-----~~~f~~P~e~~i  252 (299)
T d1yksa2         183 GMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELVRNCDLP-----VWLSWQVAKAGLKTNDR-----KWCFEGPEEHEI  252 (299)
T ss_dssp             GCCCCCSTTHHHHSSSCTTTTCCCHHHHHHHHHHHHTTCCC-----HHHHHHHHHTTCCTTCC-----GGGSCSCGGGCC
T ss_pred             ccccccchhhhccccCCCchhhhhHhHHHHHHHHHhhcCCC-----cchHHHHHhcccccccc-----cceeECchhchh
Confidence                   0112577888888777889999999999887766     89999999998876111     122666655432


Q ss_pred             HHHHHH-hhhC-CCCcHHHHHHHH
Q psy6094         409 IIKELR-ARLD-MLLAHKLSHPGT  430 (455)
Q Consensus       409 ~~~~~~-~~~~-~~sD~~~~~~~~  430 (455)
                      ..+..+ .+|. +.|||+++++.|
T Consensus       253 ~~~~~~~~~f~~~~Gd~~~L~~r~  276 (299)
T d1yksa2         253 LNDSGETVKCRAPGGAKKPLRPRW  276 (299)
T ss_dssp             BCTTSCBCEEECTTSCEEECCCSS
T ss_pred             hhhhccccceeCCCcceeeeeeeE
Confidence            222222 3466 899999988765



>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure