Psyllid ID: psy6770

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--

YLLCTSFDTELVTAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNFMLNIGNLQVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLPKDFEKGYKKCAGMHAVRENRYIVLPKDFEKGYKNNTKKDESEHEFYK

ccHHHHHHcccccEEEEEEcHHHHHHHHccccHHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccHHHHHHcccccccccccccccc

cHHHHHHHccccccEEEEEcccHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccHHHccccccccEEEEcccccccHHHHHHHHHccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccEEEcccccccEEEEcccccccHHHHHHHHHHcccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHEHcccHHHcccEccHHHHHHHHHHHHHHHccccccc

YLLCTSFDTELVTAFIRVVGSEFVQkylgegprMVRDVFRLAkenspaiifiDEIDAIATKrfdaqtgadREVQRILLELLNQmdgfdqttNVKVIMAtnradtldpallrpgrldrkiefplpdrrqkRLVFSTITAkmnlsdevdledyvarpdrisgaDINAICQEVIMAtnradtldpallrpgrldrkiefplpdrrqkRLVFSTITAKMNFMLNIGNLQVIMatnradtldpallrpgrldrkiefplpdrrqkRLVFSTITAkmnlsdevdledyvarpdrisgaDINAICQEAGmhavrenryivlpkdfekgYKKCagmhavrenryivlpkdfekgyknntkkdesehefyk

yllctsfdTELVTAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMatnradtldpallrpgrldrkiefplpdrrqkrlVFSTItakmnlsdevdleDYVARPDRISGADINAICQEVIMatnradtldpallrpgrldrkiefplpdrrqkrLVFSTITAKMNFMLNIGNLQVIMATNRADtldpallrpgrldrkiefplpdrrqkrlVFSTItakmnlsdevdleDYVARPDRISGADINAICQEagmhavrenRYIVLPKDFEKGYKKCAGmhavrenryivlpkdfekgyknntkkdesehefyk

YLLCTSFDTELVTAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPaiifideidaiaTKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNFMLNIGNLQVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLPKDFEKGYKKCAGMHAVRENRYIVLPKDFEKGYKNNTKKDESEHEFYK

*LLCTSFDTELVTAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNFMLNIGNLQVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLPKDFEKGYKKCAGMHAVRENRYIVLPKDF*******************

YLLCTSFDTELVTAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIA***************RILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEVIMATNRADTLDPALLRPGR****************LVFSTITAKMNFMLNIGNLQVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLPKDFEKGYKKCA************LPKDFEKGYKNNTKKDE*E*E*Y*

YLLCTSFDTELVTAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRF*A**GADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNFMLNIGNLQVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEAGMHAVRENRYIVLPKDFEKGYKKCAGMHAVRENRYIVLPKDFEKGYKNNTKKDESEHEFYK

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		362	2.2.26 [Sep-21-2011]
P46507		415	26S protease regulatory s	N/A	N/A	0.417	0.363	0.870	6e-85
Q4R7L3		418	26S protease regulatory s	N/A	N/A	0.417	0.361	0.853	1e-83
P43686		418	26S protease regulatory s	yes	N/A	0.417	0.361	0.853	1e-83
Q3T030		418	26S protease regulatory s	yes	N/A	0.417	0.361	0.853	1e-83
Q63570		418	26S protease regulatory s	yes	N/A	0.417	0.361	0.853	2e-83
P54775		418	26S protease regulatory s	yes	N/A	0.417	0.361	0.853	2e-83
P46502		414	Probable 26S protease reg	yes	N/A	0.378	0.330	0.895	2e-81
P85200		414	26S protease regulatory s	N/A	N/A	0.480	0.420	0.834	2e-80
Q9SEI4		408	26S protease regulatory s	yes	N/A	0.411	0.365	0.828	4e-80
P54778		413	26S protease regulatory s	N/A	N/A	0.411	0.360	0.828	8e-80

>sp\|P46507\|PRS6B_MANSE 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1	Back alignment and function desciption

 Score =  314 bits (805), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 162/177 (91%)

Query: 2   LLCTSFDTELVTAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATK 61
           +L  +       AFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATK
Sbjct: 211 MLANAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATK 270

Query: 62  RFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEF 121
           RFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEF
Sbjct: 271 RFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEF 330

Query: 122 PLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEVIMATNRAD 178
           PLPDRRQKRL+FSTITAKMNLS+EVDLE++VARPDR+SGADINAICQE  M   R +
Sbjct: 331 PLPDRRQKRLIFSTITAKMNLSEEVDLEEFVARPDRVSGADINAICQEAGMNAVREN 387

The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex.
Manduca sexta (taxid: 7130)

>sp\|Q4R7L3\|PRS6B_MACFA 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1	Back alignment and function description

>sp\|P43686\|PRS6B_HUMAN 26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2	Back alignment and function description

>sp\|Q3T030\|PRS6B_BOVIN 26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1	Back alignment and function description

>sp\|Q63570\|PRS6B_RAT 26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1	Back alignment and function description

>sp\|P54775\|PRS6B_MOUSE 26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2	Back alignment and function description

>sp\|P46502\|PRS6B_CAEEL Probable 26S protease regulatory subunit 6B OS=Caenorhabditis elegans GN=rpt-3 PE=3 SV=1	Back alignment and function description

>sp\|P85200\|PRS6B_HELAN 26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1	Back alignment and function description

>sp\|Q9SEI4\|PRS6B_ARATH 26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1	Back alignment and function description

>sp\|P54778\|PRS6B_SOLTU 26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		362
193596505		414	PREDICTED: 26S protease regulatory subun	0.411	0.359	0.902	2e-84
322796622		373	hypothetical protein SINV_07148 [Solenop	0.417	0.404	0.881	4e-84
307204193		369	26S protease regulatory subunit 6B [Harp	0.411	0.403	0.891	5e-84
340727569		415	PREDICTED: 26S protease regulatory subun	0.411	0.359	0.891	5e-84
328790712		405	PREDICTED: 26S protease regulatory subun	0.411	0.367	0.891	5e-84
350412132		405	PREDICTED: 26S protease regulatory subun	0.411	0.367	0.891	6e-84
340727571		405	PREDICTED: 26S protease regulatory subun	0.411	0.367	0.891	6e-84
350412129		415	PREDICTED: 26S protease regulatory subun	0.411	0.359	0.891	6e-84
307172856		405	26S protease regulatory subunit 6B [Camp	0.411	0.367	0.891	6e-84
383859768		415	PREDICTED: 26S protease regulatory subun	0.411	0.359	0.891	6e-84

>gi\|193596505\|ref\|XP_001945593.1\| PREDICTED: 26S protease regulatory subunit 6B-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  318 bits (816), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 161/175 (92%)

Query: 2   LLCTSFDTELVTAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATK 61
           +L  +       AFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATK
Sbjct: 210 MLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATK 269

Query: 62  RFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEF 121
           RFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEF
Sbjct: 270 RFDAQTGADREVQRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEF 329

Query: 122 PLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPDRISGADINAICQEVIMATNR 176
           PLPDRRQKRLVFSTITAKMNLS+EVDLEDYVARPDRISGADINAICQE  M   R
Sbjct: 330 PLPDRRQKRLVFSTITAKMNLSEEVDLEDYVARPDRISGADINAICQEAGMHAVR 384

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|322796622\|gb\|EFZ19093.1\| hypothetical protein SINV_07148 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|307204193\|gb\|EFN83017.1\| 26S protease regulatory subunit 6B [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|340727569\|ref\|XP_003402114.1\| PREDICTED: 26S protease regulatory subunit 6B-like isoform 1 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|328790712\|ref\|XP_393513.3\| PREDICTED: 26S protease regulatory subunit 6B isoform 2 [Apis mellifera]	Back alignment and taxonomy information

>gi\|350412132\|ref\|XP_003489551.1\| PREDICTED: 26S protease regulatory subunit 6B-like isoform 2 [Bombus impatiens]	Back alignment and taxonomy information

>gi\|340727571\|ref\|XP_003402115.1\| PREDICTED: 26S protease regulatory subunit 6B-like isoform 2 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|350412129\|ref\|XP_003489550.1\| PREDICTED: 26S protease regulatory subunit 6B-like isoform 1 [Bombus impatiens]	Back alignment and taxonomy information

>gi\|307172856\|gb\|EFN64061.1\| 26S protease regulatory subunit 6B [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|383859768\|ref\|XP_003705364.1\| PREDICTED: 26S protease regulatory subunit 6B-like [Megachile rotundata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		362
FB\|FBgn0028686		413	Rpt3 "Regulatory particle trip	0.439	0.384	0.861	1.5e-85
UNIPROTKB\|F1MG70		417	PSMC4 "26S protease regulatory	0.430	0.374	0.871	9.4e-82
UNIPROTKB\|Q3T030		418	PSMC4 "26S protease regulatory	0.430	0.373	0.871	9.4e-82
UNIPROTKB\|E2RH48		418	PSMC4 "Uncharacterized protein	0.430	0.373	0.871	9.4e-82
UNIPROTKB\|P43686		418	PSMC4 "26S protease regulatory	0.430	0.373	0.871	9.4e-82
UNIPROTKB\|Q4R7L3		418	PSMC4 "26S protease regulatory	0.430	0.373	0.871	9.4e-82
MGI\|MGI:1346093		418	Psmc4 "proteasome (prosome, ma	0.430	0.373	0.871	9.4e-82
RGD\|621102		418	Psmc4 "proteasome (prosome, ma	0.430	0.373	0.871	9.4e-82
ZFIN\|ZDB-GENE-030131-5083		418	psmc4 "proteasome (prosome, ma	0.450	0.389	0.846	1.5e-81
WB\|WBGene00004503		414	rpt-3 [Caenorhabditis elegans	0.483	0.422	0.777	9.5e-80

FB\|FBgn0028686 Rpt3 "Regulatory particle triple-A ATPase 3" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 692 (248.7 bits), Expect = 1.5e-85, Sum P(2) = 1.5e-85
 Identities = 137/159 (86%), Positives = 145/159 (91%)

Query:    14 AFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPXXXXXXXXXXXXTKRFDAQTGADREV 73
             +FIRVVGSEFVQKYLGEGPRMVRDVFRLAKEN+P            TKRFDAQTGADREV
Sbjct:   221 SFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREV 280

Query:    74 QRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF 133
             QRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF
Sbjct:   281 QRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF 340

Query:   134 STITAKMNLSDEVDLEDYVARPDRISGADINAICQEVIM 172
             STIT+KMNLS++VDLE++VARPD+ISGADINAICQE  M
Sbjct:   341 STITSKMNLSEDVDLEEFVARPDKISGADINAICQEAGM 379

GO:0008540 "proteasome regulatory particle, base subcomplex" evidence=ISS;NAS

GO:0004175 "endopeptidase activity" evidence=IDA

GO:0006508 "proteolysis" evidence=ISS;IDA

GO:0005838 "proteasome regulatory particle" evidence=ISS;IDA

GO:0001673 "male germ cell nucleus" evidence=IDA

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=IEA

GO:0030163 "protein catabolic process" evidence=IEA

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

GO:0006974 "response to DNA damage stimulus" evidence=IMP

UNIPROTKB\|F1MG70 PSMC4 "26S protease regulatory subunit 6B" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3T030 PSMC4 "26S protease regulatory subunit 6B" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RH48 PSMC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P43686 PSMC4 "26S protease regulatory subunit 6B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4R7L3 PSMC4 "26S protease regulatory subunit 6B" [Macaca fascicularis (taxid:9541)]	Back alignment and assigned GO terms

MGI\|MGI:1346093 Psmc4 "proteasome (prosome, macropain) 26S subunit, ATPase, 4" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|621102 Psmc4 "proteasome (prosome, macropain) 26S subunit, ATPase, 4" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-5083 psmc4 "proteasome (prosome, macropain) 26S subunit, ATPase, 4" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

WB\|WBGene00004503 rpt-3 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
A4G0S4	PAN_METM5	No assigned EC number	0.5254	0.4861	0.4324	yes	N/A
P34123	PRS6B_DICDI	No assigned EC number	0.8022	0.4861	0.4367	yes	N/A
O28303	PAN_ARCFU	No assigned EC number	0.5367	0.4889	0.4447	yes	N/A
A6UQT3	PAN_METVS	No assigned EC number	0.5438	0.4696	0.4176	yes	N/A
Q63570	PRS6B_RAT	No assigned EC number	0.8531	0.4171	0.3612	yes	N/A
Q8SQI9	PRS6B_ENCCU	No assigned EC number	0.7288	0.4861	0.4547	yes	N/A
Q6LWR0	PAN_METMP	No assigned EC number	0.5254	0.4861	0.4324	yes	N/A
D4GUJ7	PAN1_HALVD	No assigned EC number	0.5028	0.4889	0.4359	yes	N/A
P33298	PRS6B_YEAST	No assigned EC number	0.7337	0.4640	0.3925	yes	N/A
Q9SEI4	PRS6B_ARATH	No assigned EC number	0.8285	0.4116	0.3651	yes	N/A
O74894	PRS6B_SCHPO	No assigned EC number	0.7810	0.4640	0.4318	yes	N/A
Q0W257	PAN_UNCMA	No assigned EC number	0.5163	0.5027	0.4364	yes	N/A
P54775	PRS6B_MOUSE	No assigned EC number	0.8531	0.4171	0.3612	yes	N/A
P78578	PRS6B_ASPNG	No assigned EC number	0.7692	0.4640	0.3971	yes	N/A
Q58576	PAN_METJA	No assigned EC number	0.5485	0.4806	0.4046	yes	N/A
Q3T030	PRS6B_BOVIN	No assigned EC number	0.8531	0.4171	0.3612	yes	N/A
A6VHR1	PAN_METM7	No assigned EC number	0.5254	0.4861	0.4324	yes	N/A
A9A916	PAN_METM6	No assigned EC number	0.5254	0.4861	0.4324	yes	N/A
Q90732	PRS4_CHICK	No assigned EC number	0.5833	0.4502	0.3704	yes	N/A
O26824	PAN_METTH	No assigned EC number	0.5438	0.4640	0.4097	yes	N/A
P43686	PRS6B_HUMAN	No assigned EC number	0.8531	0.4171	0.3612	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		362
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	1e-119
COG1222		406	COG1222, RPT1, ATP-dependent 26S proteasome regula	5e-96
PTZ00361		438	PTZ00361, PTZ00361, 26 proteosome regulatory subun	2e-80
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	1e-74
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	6e-67
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	5e-66
COG1222		406	COG1222, RPT1, ATP-dependent 26S proteasome regula	4e-47
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	8e-42
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	1e-41
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	2e-41
CHL00176		638	CHL00176, ftsH, cell division protein; Validated	2e-38
PTZ00361		438	PTZ00361, PTZ00361, 26 proteosome regulatory subun	3e-37
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	3e-37
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	2e-34
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	5e-34
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	5e-33
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	4e-30
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	3e-27
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	4e-27
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	1e-24
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	1e-23
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	4e-23
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	9e-23
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	5e-22
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	2e-18
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	1e-15
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	1e-15
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	5e-14
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	1e-13
CHL00176		638	CHL00176, ftsH, cell division protein; Validated	3e-13
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	9e-13
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	3e-12
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	1e-10
smart00382		148	smart00382, AAA, ATPases associated with a variety	1e-10
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	2e-09
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	2e-09
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	7e-09
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	9e-09
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	3e-08
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	7e-08
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	4e-07
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	4e-07
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	7e-07
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	9e-07
CHL00195		489	CHL00195, ycf46, Ycf46; Provisional	5e-05
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	6e-05
PRK05201		443	PRK05201, hslU, ATP-dependent protease ATP-binding	0.001
smart00382		148	smart00382, AAA, ATPases associated with a variety	0.002

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

 Score =  349 bits (898), Expect = e-119
 Identities = 142/163 (87%), Positives = 154/163 (94%)

Query: 14  AFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDAQTGADREV 73
            FIRVVGSEFVQKYLGEGPRMVRDVFRLA+EN+P+IIFIDE+D+IATKRFDAQTGADREV
Sbjct: 206 TFIRVVGSEFVQKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGADREV 265

Query: 74  QRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVF 133
           QRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRL+F
Sbjct: 266 QRILLELLNQMDGFDQTTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIF 325

Query: 134 STITAKMNLSDEVDLEDYVARPDRISGADINAICQEVIMATNR 176
            TIT+KMNLS+EVDLED+V+RP++IS ADI AICQE  M   R
Sbjct: 326 QTITSKMNLSEEVDLEDFVSRPEKISAADIAAICQEAGMQAVR 368

Length = 398

>gnl\|CDD\|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|214386 CHL00176, ftsH, cell division protein; Validated	Back alignment and domain information

>gnl\|CDD\|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|214386 CHL00176, ftsH, cell division protein; Validated	Back alignment and domain information

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|177094 CHL00195, ycf46, Ycf46; Provisional	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|235364 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		362
KOG0733\|consensus		802		100.0
KOG0730\|consensus		693		100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	100.0
KOG0736\|consensus		953		100.0
KOG0734\|consensus		752		100.0
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	100.0
KOG0735\|consensus		952		100.0
KOG0738\|consensus		491		100.0
KOG0727\|consensus		408		100.0
KOG0733\|consensus		802		100.0
KOG0730\|consensus		693		100.0
KOG0739\|consensus		439		100.0
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	100.0
KOG0726\|consensus		440		100.0
KOG0736\|consensus		953		100.0
KOG0728\|consensus		404		100.0
KOG0731\|consensus		774		100.0
CHL00195		489	ycf46 Ycf46; Provisional	100.0
KOG0735\|consensus		952		100.0
CHL00206		2281	ycf2 Ycf2; Provisional	99.98
KOG0652\|consensus		424		99.97
KOG0737\|consensus		386		99.97
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.97
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.97
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.97
KOG0729\|consensus		435		99.97
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.97
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.97
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	99.97
CHL00176		638	ftsH cell division protein; Validated	99.96
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.96
KOG0734\|consensus		752		99.96
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.96
KOG0740\|consensus		428		99.96
KOG0651\|consensus		388		99.96
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.95
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.95
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.94
KOG0741\|consensus		744		99.94
KOG0732\|consensus		1080		99.93
KOG0731\|consensus		774		99.93
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.93
KOG0652\|consensus		424		99.91
KOG0729\|consensus		435		99.91
KOG0728\|consensus		404		99.9
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.89
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.89
KOG0741\|consensus		744		99.88
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.87
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.86
KOG0737\|consensus		386		99.86
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.86
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.83
CHL00176		638	ftsH cell division protein; Validated	99.83
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.81
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	99.81
KOG0651\|consensus		388		99.78
KOG0740\|consensus		428		99.77
KOG0732\|consensus		1080		99.75
PF00004		132	AAA: ATPase family associated with various cellula	99.72
KOG0744\|consensus		423		99.7
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.64
KOG0742\|consensus		630		99.62
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.62
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.62
KOG0738\|consensus		491		99.62
CHL00206		2281	ycf2 Ycf2; Provisional	99.61
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.56
KOG0743\|consensus		457		99.51
CHL00195		489	ycf46 Ycf46; Provisional	99.48
KOG0727\|consensus		408		99.39
KOG0726\|consensus		440		99.33
CHL00181		287	cbbX CbbX; Provisional	99.32
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.28
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.23
KOG0739\|consensus		439		99.2
KOG0742\|consensus		630		99.13
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.11
KOG0743\|consensus		457		99.07
PRK10865		857	protein disaggregation chaperone; Provisional	99.02
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	98.97
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	98.93
CHL00095		821	clpC Clp protease ATP binding subunit	98.86
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	98.68
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	98.6
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	98.56
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	98.53
PRK00149		450	dnaA chromosomal replication initiation protein; R	98.52
KOG0744\|consensus		423		98.44
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	98.44
COG2256		436	MGS1 ATPase related to the helicase subunit of the	98.43
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	98.43
PRK04195		482	replication factor C large subunit; Provisional	98.4
PRK14086		617	dnaA chromosomal replication initiation protein; P	98.36
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	98.31
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	98.29
PRK14088		440	dnaA chromosomal replication initiation protein; P	98.25
PRK04132		846	replication factor C small subunit; Provisional	98.22
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	98.21
PRK13342		413	recombination factor protein RarA; Reviewed	98.21
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	98.2
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	98.19
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	98.19
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	98.17
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	98.17
PRK06893		229	DNA replication initiation factor; Validated	98.16
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	98.14
PHA02544		316	44 clamp loader, small subunit; Provisional	98.14
PRK07940		394	DNA polymerase III subunit delta'; Validated	98.13
KOG2004\|consensus		906		98.13
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	98.12
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	98.1
PRK00411		394	cdc6 cell division control protein 6; Reviewed	98.1
PTZ00112		1164	origin recognition complex 1 protein; Provisional	98.1
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	98.09
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	98.08
PRK12422		445	chromosomal replication initiation protein; Provis	98.06
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	98.04
PRK12402		337	replication factor C small subunit 2; Reviewed	98.03
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	98.0
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	97.98
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	97.97
PRK14087		450	dnaA chromosomal replication initiation protein; P	97.96
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	97.95
PF00004		132	AAA: ATPase family associated with various cellula	97.95
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	97.94
PRK05642		234	DNA replication initiation factor; Validated	97.93
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	97.92
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	97.88
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	97.83
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	97.83
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	97.82
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	97.82
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	97.81
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	97.8
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	97.79
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	97.79
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	97.77
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	97.76
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	97.76
PRK08903		227	DnaA regulatory inactivator Hda; Validated	97.76
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	97.76
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	97.7
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	97.7
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	97.68
COG0714		329	MoxR-like ATPases [General function prediction onl	97.67
PLN03025		319	replication factor C subunit; Provisional	97.67
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	97.67
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	97.66
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	97.66
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	97.64
PRK13341		725	recombination factor protein RarA/unknown domain f	97.63
KOG2028\|consensus		554		97.62
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	97.61
PRK08727		233	hypothetical protein; Validated	97.59
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	97.59
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	97.58
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	97.56
PRK08084		235	DNA replication initiation factor; Provisional	97.55
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	97.53
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	97.51
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	97.48
CHL00181		287	cbbX CbbX; Provisional	97.48
smart00382		148	AAA ATPases associated with a variety of cellular	97.48
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	97.46
PHA02244		383	ATPase-like protein	97.46
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	97.44
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	97.4
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	97.39
PRK00440		319	rfc replication factor C small subunit; Reviewed	97.38
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	97.37
KOG1969\|consensus		877		97.28
KOG0745\|consensus		564		97.26
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	97.25
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	97.2
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	97.11
COG0593		408	DnaA ATPase involved in DNA replication initiation	97.09
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	97.05
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	97.04
PF09336		62	Vps4_C: Vps4 C terminal oligomerisation domain; In	97.03
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	97.02
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	96.96
PRK06620		214	hypothetical protein; Validated	96.95
CHL00095		821	clpC Clp protease ATP binding subunit	96.93
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	96.93
PRK00411		394	cdc6 cell division control protein 6; Reviewed	96.86
PRK09087		226	hypothetical protein; Validated	96.86
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	96.84
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	96.82
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	96.8
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	96.74
PRK05707		328	DNA polymerase III subunit delta'; Validated	96.71
PRK09112		351	DNA polymerase III subunit delta'; Validated	96.7
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	96.7
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	96.63
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	96.6
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	96.48
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	96.42
PRK10865		857	protein disaggregation chaperone; Provisional	96.42
PRK06964		342	DNA polymerase III subunit delta'; Validated	96.42
PRK00149		450	dnaA chromosomal replication initiation protein; R	96.41
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	96.36
PRK07471		365	DNA polymerase III subunit delta'; Validated	96.2
PRK06871		325	DNA polymerase III subunit delta'; Validated	96.17
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	96.16
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	96.16
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	96.14
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	96.03
PRK05564		313	DNA polymerase III subunit delta'; Validated	95.92
KOG0989\|consensus		346		95.9
PRK06090		319	DNA polymerase III subunit delta'; Validated	95.86
PRK07993		334	DNA polymerase III subunit delta'; Validated	95.81
KOG1514\|consensus		767		95.8
PRK08769		319	DNA polymerase III subunit delta'; Validated	95.55
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	95.53
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	95.27
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	95.27
PRK13531		498	regulatory ATPase RavA; Provisional	95.25
PRK06893		229	DNA replication initiation factor; Validated	95.19
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	95.19
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	95.17
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	95.13
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	95.05
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	95.03
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	95.02
PRK08116		268	hypothetical protein; Validated	94.84
PRK14088		440	dnaA chromosomal replication initiation protein; P	94.79
PRK08058		329	DNA polymerase III subunit delta'; Validated	94.68
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	94.39
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	94.38
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	94.34
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	94.31
PRK13342		413	recombination factor protein RarA; Reviewed	94.28
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	94.26
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	94.25
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	94.13
PRK07399		314	DNA polymerase III subunit delta'; Validated	94.12
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	94.11
PRK12422		445	chromosomal replication initiation protein; Provis	94.07
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	94.07
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	94.06
PRK08727		233	hypothetical protein; Validated	94.04
PRK07276		290	DNA polymerase III subunit delta'; Validated	93.96
PRK14087		450	dnaA chromosomal replication initiation protein; P	93.9
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	93.83
PRK09087		226	hypothetical protein; Validated	93.7
PRK07952		244	DNA replication protein DnaC; Validated	93.65
PF13173		128	AAA_14: AAA domain	93.54
PRK08903		227	DnaA regulatory inactivator Hda; Validated	93.41
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	93.35
PRK04195		482	replication factor C large subunit; Provisional	93.27
PRK06581		263	DNA polymerase III subunit delta'; Validated	93.26
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	93.12
KOG2680\|consensus		454		93.07
KOG1051\|consensus		898		93.03
PRK12402		337	replication factor C small subunit 2; Reviewed	92.89
PF14516		331	AAA_35: AAA-like domain	92.78
PRK14086		617	dnaA chromosomal replication initiation protein; P	92.67
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	92.65
PTZ00112		1164	origin recognition complex 1 protein; Provisional	92.52
PRK08699		325	DNA polymerase III subunit delta'; Validated	92.3
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	92.25
PRK08084		235	DNA replication initiation factor; Provisional	92.12
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	92.09
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	92.04
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	91.96
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	91.91
KOG2227\|consensus		529		91.82
KOG1942\|consensus		456		91.8
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	91.78
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	91.59
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	91.51
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	91.47
PRK06620		214	hypothetical protein; Validated	91.41
PF07693		325	KAP_NTPase: KAP family P-loop domain; InterPro: IP	91.35
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	91.24
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	91.09
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	91.01
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	90.84
PRK07940		394	DNA polymerase III subunit delta'; Validated	90.79
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	90.68
PRK05642		234	DNA replication initiation factor; Validated	90.55
smart00350		509	MCM minichromosome maintenance proteins.	90.46
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	90.43
PRK05022		509	anaerobic nitric oxide reductase transcription reg	90.34
COG0714		329	MoxR-like ATPases [General function prediction onl	90.27
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	90.2
PRK09183		259	transposase/IS protein; Provisional	90.06
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	90.02
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	89.93
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	89.78
PRK05818		261	DNA polymerase III subunit delta'; Validated	89.74
KOG2035\|consensus		351		89.72
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	89.68
PF05729		166	NACHT: NACHT domain	89.65
PRK08181		269	transposase; Validated	89.45
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	89.42
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	89.4
smart00350		509	MCM minichromosome maintenance proteins.	89.34
PRK10365		441	transcriptional regulatory protein ZraR; Provision	89.3
PRK08485		206	DNA polymerase III subunit delta'; Validated	89.15
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	89.14
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	89.12
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	89.06
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	88.99
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	88.94
PRK00440		319	rfc replication factor C small subunit; Reviewed	88.93
PRK11608		326	pspF phage shock protein operon transcriptional ac	88.85
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	88.83
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	88.82
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	88.81
PRK12377		248	putative replication protein; Provisional	88.8
PRK07132		299	DNA polymerase III subunit delta'; Validated	88.75
COG1221		403	PspF Transcriptional regulators containing an AAA-	88.73
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	88.65
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	88.64
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	88.28
KOG1051\|consensus		898		88.25
KOG2228\|consensus		408		87.92
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	87.73
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	87.61
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	87.59
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	87.59
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	87.5
KOG1968\|consensus		871		87.5
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	87.48
PF13304		303	AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T	87.35
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	87.28
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	87.21
PRK05917		290	DNA polymerase III subunit delta'; Validated	87.11
PF05707		193	Zot: Zonular occludens toxin (Zot); InterPro: IPR0	87.1
PRK06921		266	hypothetical protein; Provisional	87.06
PRK13341		725	recombination factor protein RarA/unknown domain f	86.59
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	86.48
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	86.39
PF07726		131	AAA_3: ATPase family associated with various cellu	86.31
COG1067		647	LonB Predicted ATP-dependent protease [Posttransla	86.22
PRK06964		342	DNA polymerase III subunit delta'; Validated	86.06
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	86.01
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	85.95
PRK06526		254	transposase; Provisional	85.94
COG0593		408	DnaA ATPase involved in DNA replication initiation	85.69
PRK06835		329	DNA replication protein DnaC; Validated	85.29
PRK08939		306	primosomal protein DnaI; Reviewed	85.02
KOG2028\|consensus		554		84.76
PRK14700		300	recombination factor protein RarA; Provisional	84.72
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	83.93
COG2204		464	AtoC Response regulator containing CheY-like recei	83.86
PF12846		304	AAA_10: AAA-like domain	83.83
KOG0478\|consensus		804		83.53
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	83.31
COG2256		436	MGS1 ATPase related to the helicase subunit of the	83.31
PLN03025		319	replication factor C subunit; Provisional	82.9
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	82.68
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	82.41
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	81.6
PHA02544		316	44 clamp loader, small subunit; Provisional	81.43
PRK15115		444	response regulator GlrR; Provisional	81.3
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	81.04
PRK13765		637	ATP-dependent protease Lon; Provisional	80.54
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	80.1
PRK13531		498	regulatory ATPase RavA; Provisional	80.06

>KOG0733\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.7e-71  Score=531.78  Aligned_cols=341  Identities=35%  Similarity=0.540  Sum_probs=301.1

Q ss_pred             CcHHHHHHhhhCCcEEEEechhhhhhhcCchHHHHHHHHHHHHHcCCeEEEeccccccccccCCCCCCCcHHHHHHHHHH
Q psy6770           1 YLLCTSFDTELVTAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLEL   80 (362)
Q Consensus         1 slLakaiA~e~~~~~~~v~~s~l~~~~~gese~~l~~~F~~a~~~~P~II~iDeiD~l~~~r~~~~~~~~~~~~~~l~~l   80 (362)
                      ++||+|||+|+|+||+.|++.++++.+.||||++|+++|+.|+..+|||+||||||+|.++|..++..+   .++++.+|
T Consensus       237 T~lA~AiAgel~vPf~~isApeivSGvSGESEkkiRelF~~A~~~aPcivFiDeIDAI~pkRe~aqreM---ErRiVaQL  313 (802)
T KOG0733|consen  237 TSLANAIAGELGVPFLSISAPEIVSGVSGESEKKIRELFDQAKSNAPCIVFIDEIDAITPKREEAQREM---ERRIVAQL  313 (802)
T ss_pred             HHHHHHHhhhcCCceEeecchhhhcccCcccHHHHHHHHHHHhccCCeEEEeecccccccchhhHHHHH---HHHHHHHH
Confidence            479999999999999999999999999999999999999999999999999999999999996644333   26999999


Q ss_pred             HHhccCCCC----CCCeEEEEEcCCCCCCCccccCCCcceeEEEccCCCHHHHHHHHHHHHccCCCCCcCCHHHHHhcCC
Q psy6770          81 LNQMDGFDQ----TTNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITAKMNLSDEVDLEDYVARPD  156 (362)
Q Consensus        81 L~~ld~l~~----~~~v~vi~tTn~~~~ld~al~r~gRf~~~i~i~~P~~~~r~~il~~~~~~~~~~~~~dl~~la~~t~  156 (362)
                      |+.||++..    +.+|+||++||+|+.+||||+|+||||..|.++.|+..+|.+|++..++++++..++|+.+||..|.
T Consensus       314 lt~mD~l~~~~~~g~~VlVIgATnRPDslDpaLRRaGRFdrEI~l~vP~e~aR~~IL~~~~~~lrl~g~~d~~qlA~lTP  393 (802)
T KOG0733|consen  314 LTSMDELSNEKTKGDPVLVIGATNRPDSLDPALRRAGRFDREICLGVPSETAREEILRIICRGLRLSGDFDFKQLAKLTP  393 (802)
T ss_pred             HHhhhcccccccCCCCeEEEecCCCCcccCHHHhccccccceeeecCCchHHHHHHHHHHHhhCCCCCCcCHHHHHhcCC
Confidence            999999853    3679999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcHhhHHHHHHHHHHhhcccc------cC--------------------------------------------------
Q psy6770         157 RISGADINAICQEVIMATNRAD------TL--------------------------------------------------  180 (362)
Q Consensus       157 g~s~~di~~l~~~a~~~~~r~~------~~--------------------------------------------------  180 (362)
                      ||+|+|+.++|.+|..-|+++-      ..                                                  
T Consensus       394 GfVGADL~AL~~~Aa~vAikR~ld~~~~p~~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~~i~~~~d~~S~  473 (802)
T KOG0733|consen  394 GFVGADLMALCREAAFVAIKRILDQSSSPLTKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQDAILNNPDPLSK  473 (802)
T ss_pred             CccchhHHHHHHHHHHHHHHHHhhcccCccccCCccccccCCCccchhhhhhcCCcccccccHHHHHHHHHHhCCCCcCh
Confidence            9999999999999987765430      00                                                  


Q ss_pred             --------------------CCcccCc-------------c-------chhhhhccCC---------------------C
Q psy6770         181 --------------------DPALLRP-------------G-------RLDRKIEFPL---------------------P  199 (362)
Q Consensus       181 --------------------~~~~i~~-------------~-------~l~~~~~~~~---------------------~  199 (362)
                                          .|+..++             |       .|...+.||.                     |
T Consensus       474 E~~~~L~i~~eDF~~Al~~iQPSakREGF~tVPdVtW~dIGaL~~vR~eL~~aI~~PiK~pd~~k~lGi~~PsGvLL~GP  553 (802)
T KOG0733|consen  474 ELLEGLSIKFEDFEEALSKIQPSAKREGFATVPDVTWDDIGALEEVRLELNMAILAPIKRPDLFKALGIDAPSGVLLCGP  553 (802)
T ss_pred             HHhccceecHHHHHHHHHhcCcchhcccceecCCCChhhcccHHHHHHHHHHHHhhhccCHHHHHHhCCCCCCceEEeCC
Confidence                                0000000             1       1233444443                     7


Q ss_pred             hhhhhhh----------------------------------------------------------------------hhh
Q psy6770         200 DRRQKRL----------------------------------------------------------------------VFS  209 (362)
Q Consensus       200 ~~~~k~~----------------------------------------------------------------------~~~  209 (362)
                      ||||||+                                                                      ++|
T Consensus       554 PGCGKTLlAKAVANEag~NFisVKGPELlNkYVGESErAVR~vFqRAR~saPCVIFFDEiDaL~p~R~~~~s~~s~RvvN  633 (802)
T KOG0733|consen  554 PGCGKTLLAKAVANEAGANFISVKGPELLNKYVGESERAVRQVFQRARASAPCVIFFDEIDALVPRRSDEGSSVSSRVVN  633 (802)
T ss_pred             CCccHHHHHHHHhhhccCceEeecCHHHHHHHhhhHHHHHHHHHHHhhcCCCeEEEecchhhcCcccCCCCchhHHHHHH
Confidence            9999987                                                                      889


Q ss_pred             hhhhhhhhhhccCCeEEEEecCCCCCCCccccCCCCcceeEEecCCCHHHHHHHHHHHhc--cCCCCCCCCHHHHhhCCC
Q psy6770         210 TITAKMNFMLNIGNLQVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFSTITA--KMNLSDEVDLEDYVARPD  287 (362)
Q Consensus       210 ~~l~~~~~~~~~~~v~vi~aTn~~~~lD~a~~RpgRfd~~i~~~~P~~~~r~~i~~~~l~--~~~~~~~~~~~~la~~~~  287 (362)
                      +||++|||++++.+|+||+||||||.||||+|||||||+.+||++|+.++|..|+|.+++  +.++++++|++.||+.+.
T Consensus       634 qLLtElDGl~~R~gV~viaATNRPDiIDpAiLRPGRlDk~LyV~lPn~~eR~~ILK~~tkn~k~pl~~dVdl~eia~~~~  713 (802)
T KOG0733|consen  634 QLLTELDGLEERRGVYVIAATNRPDIIDPAILRPGRLDKLLYVGLPNAEERVAILKTITKNTKPPLSSDVDLDEIARNTK  713 (802)
T ss_pred             HHHHHhcccccccceEEEeecCCCcccchhhcCCCccCceeeecCCCHHHHHHHHHHHhccCCCCCCcccCHHHHhhccc
Confidence            999999999999999999999999999999999999999999999999999999999999  888889999999999865


Q ss_pred             --CCCHHHHHHHHHHHHHHHHHhcC----------------CCCCHHHHHHHHHHHhCchH-HHHHHHHhchHHHh
Q psy6770         288 --RISGADINAICQEAGMHAVRENR----------------YIVLPKDFEKGYKKCAGMHA-VRENRYIVLPKDFE  344 (362)
Q Consensus       288 --g~sgadi~~~~~~a~~~a~~~~~----------------~~v~~~~~~~a~~~~~~~~~-~~~~~~~~~~~~~~  344 (362)
                        |||||||..+|++|++.|+++.-                -.+++.||+.|+++++|++. .+.+.|+.+++.++
T Consensus       714 c~gftGADLaaLvreAsi~AL~~~~~~~~~~~~~~~~~~~~~~~t~~hF~eA~~~i~pSv~~~dr~~Yd~l~k~~~  789 (802)
T KOG0733|consen  714 CEGFTGADLAALVREASILALRESLFEIDSSEDDVTVRSSTIIVTYKHFEEAFQRIRPSVSERDRKKYDRLNKSRS  789 (802)
T ss_pred             ccCCchhhHHHHHHHHHHHHHHHHHhhccccCcccceeeeeeeecHHHHHHHHHhcCCCccHHHHHHHHHHhhhhc
Confidence              99999999999999999998721                14678899999999999997 67788988887755

>KOG0730\|consensus	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0736\|consensus	Back alignment and domain information

>KOG0734\|consensus	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735\|consensus	Back alignment and domain information

>KOG0738\|consensus	Back alignment and domain information

>KOG0727\|consensus	Back alignment and domain information

>KOG0733\|consensus	Back alignment and domain information

>KOG0730\|consensus	Back alignment and domain information

>KOG0739\|consensus	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0726\|consensus	Back alignment and domain information

>KOG0736\|consensus	Back alignment and domain information

>KOG0728\|consensus	Back alignment and domain information

>KOG0731\|consensus	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>KOG0735\|consensus	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>KOG0652\|consensus	Back alignment and domain information

>KOG0737\|consensus	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0729\|consensus	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG0734\|consensus	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>KOG0740\|consensus	Back alignment and domain information

>KOG0651\|consensus	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>KOG0741\|consensus	Back alignment and domain information

>KOG0732\|consensus	Back alignment and domain information

>KOG0731\|consensus	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0652\|consensus	Back alignment and domain information

>KOG0729\|consensus	Back alignment and domain information

>KOG0728\|consensus	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>KOG0741\|consensus	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG0737\|consensus	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0651\|consensus	Back alignment and domain information

>KOG0740\|consensus	Back alignment and domain information

>KOG0732\|consensus	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>KOG0744\|consensus	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>KOG0742\|consensus	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>KOG0738\|consensus	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>KOG0743\|consensus	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>KOG0727\|consensus	Back alignment and domain information

>KOG0726\|consensus	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>KOG0739\|consensus	Back alignment and domain information

>KOG0742\|consensus	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>KOG0743\|consensus	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>KOG0744\|consensus	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2004\|consensus	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>KOG2028\|consensus	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1969\|consensus	Back alignment and domain information

>KOG0745\|consensus	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0989\|consensus	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1514\|consensus	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK06581 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>KOG2680\|consensus	Back alignment and domain information

>KOG1051\|consensus	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>KOG2227\|consensus	Back alignment and domain information

>KOG1942\|consensus	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2035\|consensus	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>PRK08485 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>KOG1051\|consensus	Back alignment and domain information

>KOG2228\|consensus	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>KOG1968\|consensus	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot)	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>KOG2028\|consensus	Back alignment and domain information

>PRK14700 recombination factor protein RarA; Provisional	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>KOG0478\|consensus	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		362
4b4t_K		428	Near-Atomic Resolution Structural Model Of The Yeas		5e-60
4b4t_K		428	Near-Atomic Resolution Structural Model Of The Yeas		2e-33
4b4t_I		437	Near-Atomic Resolution Structural Model Of The Yeas		9e-47
4b4t_I		437	Near-Atomic Resolution Structural Model Of The Yeas		3e-24
3h4m_A		285	Aaa Atpase Domain Of The Proteasome- Activating Nuc		9e-42
3h4m_A		285	Aaa Atpase Domain Of The Proteasome- Activating Nuc		2e-21
4b4t_J		405	Near-Atomic Resolution Structural Model Of The Yeas		6e-40
4b4t_J		405	Near-Atomic Resolution Structural Model Of The Yeas		6e-22
4b4t_M		434	Near-Atomic Resolution Structural Model Of The Yeas		3e-36
4b4t_M		434	Near-Atomic Resolution Structural Model Of The Yeas		2e-17
4b4t_L		437	Near-Atomic Resolution Structural Model Of The Yeas		5e-35
4b4t_L		437	Near-Atomic Resolution Structural Model Of The Yeas		4e-23
4b4t_H		467	Near-Atomic Resolution Structural Model Of The Yeas		2e-34
4b4t_H		467	Near-Atomic Resolution Structural Model Of The Yeas		2e-18
2dvw_B		83	Structure Of The Oncoprotein Gankyrin In Complex Wi		4e-32
2ce7_A		476	Edta Treated Length = 476		2e-21
2ce7_A		476	Edta Treated Length = 476		1e-12
3kds_E		465	Apo-ftsh Crystal Structure Length = 465		2e-21
3kds_E		465	Apo-ftsh Crystal Structure Length = 465		1e-12
3cf1_A		806	Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len		2e-21
3cf1_A		806	Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len		1e-13
3cf0_A		301	Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH		2e-21
3cf0_A		301	Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH		1e-13
1r7r_A		816	The Crystal Structure Of Murine P97VCP AT 3.6A Leng		2e-21
1r7r_A		816	The Crystal Structure Of Murine P97VCP AT 3.6A Leng		1e-13
1lv7_A		257	Crystal Structure Of The Aaa Domain Of Ftsh Length		3e-21
1lv7_A		257	Crystal Structure Of The Aaa Domain Of Ftsh Length		1e-12
1iy2_A		278	Crystal Structure Of The Ftsh Atpase Domain From Th		6e-21
1iy2_A		278	Crystal Structure Of The Ftsh Atpase Domain From Th		1e-08
4eiw_A		508	Whole Cytosolic Region Of Atp-Dependent Metalloprot		6e-21
4eiw_A		508	Whole Cytosolic Region Of Atp-Dependent Metalloprot		1e-08
1ixz_A		254	Crystal Structure Of The Ftsh Atpase Domain From Th		7e-21
1ixz_A		254	Crystal Structure Of The Ftsh Atpase Domain From Th		1e-08
2dhr_A		499	Whole Cytosolic Region Of Atp-Dependent Metalloprot		7e-21
2dhr_A		499	Whole Cytosolic Region Of Atp-Dependent Metalloprot		1e-08
2x8a_A		274	Human Nuclear Valosin Containing Protein Like (Nvl)		3e-20
2x8a_A		274	Human Nuclear Valosin Containing Protein Like (Nvl)		1e-09
2qz4_A		262	Human Paraplegin, Aaa Domain In Complex With Adp Le		2e-19
2qz4_A		262	Human Paraplegin, Aaa Domain In Complex With Adp Le		7e-13
3hu3_A		489	Structure Of P97 N-D1 R155h Mutant In Complex With		2e-18
3hu3_A		489	Structure Of P97 N-D1 R155h Mutant In Complex With		1e-12
3hu1_A		489	Structure Of P97 N-D1 R95g Mutant In Complex With A		2e-18
3hu1_A		489	Structure Of P97 N-D1 R95g Mutant In Complex With A		1e-12
1e32_A		458	Structure Of The N-Terminal Domain And The D1 Aaa D		2e-18
1e32_A		458	Structure Of The N-Terminal Domain And The D1 Aaa D		1e-12
3hu2_A		489	Structure Of P97 N-D1 R86a Mutant In Complex With A		2e-18
3hu2_A		489	Structure Of P97 N-D1 R86a Mutant In Complex With A		1e-12
2r62_A		268	Crystal Structure Of Helicobacter Pylori Atp Depend		3e-17
2r62_A		268	Crystal Structure Of Helicobacter Pylori Atp Depend		4e-09
3d8b_A		357	Crystal Structure Of Human Fidgetin-Like Protein 1		5e-14
3d8b_A		357	Crystal Structure Of Human Fidgetin-Like Protein 1		1e-05
2dzn_B		82	Crystal Structure Analysis Of Yeast Nas6p Complexed		6e-14
2qp9_X		355	Crystal Structure Of S.Cerevisiae Vps4 Length = 355		2e-13
2rko_A		331	Crystal Structure Of The Vps4p-Dimer Length = 331		3e-13
3eih_A		340	Crystal Structure Of S.Cerevisiae Vps4 In The Prese		4e-13
3eie_A		322	Crystal Structure Of S.Cerevisiae Vps4 In The So4-B		4e-13
2zam_A		444	Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt		4e-13
2zam_A		444	Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt		5e-04
1xwi_A		322	Crystal Structure Of Vps4b Length = 322		2e-12
3b9p_A		297	Spastin Length = 297		9e-08
3vfd_A		389	Human Spastin Aaa Domain Length = 389		1e-07
2krk_A		86	Solution Nmr Structure Of 26s Protease Regulatory S		6e-05
3kw6_A		78	Crystal Structure Of A Domain Of 26s Proteasome Reg		5e-04

>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428