Psyllid ID: psy7220


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MLVTSLQTVDSHLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMDLVR
cccccHHEEEEccEEEEccccccEEEEEEEEcccEEEEEEccccccHHHHHHHHHcccccccEEEEEEEEcccccccHHc
ccEEEEEEEEEEccEEEcccEEEEEcEEEEEcccEEEEEEEcccccHHHHHHHHHccccccccEEEEEcccccccHHHcc
MLVTSLqtvdshletfpydtkpavnqisfgvgrgecfgllglngagkttTFKMLTgaikptsgnayvmnhsirdsmdlvr
mlvtslqtvdshletfpydtkpaVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGaikptsgnayvmnhsirdsmdlvr
MLVTSLQTVDSHLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMDLVR
***********HLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVM************
****SLQTVDSHLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSM****
MLVTSLQTVDSHLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMDLVR
MLVTSLQTVDSHLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSM****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVTSLQTVDSHLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMDLVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query80 2.2.26 [Sep-21-2011]
Q99758 1704 ATP-binding cassette sub- yes N/A 0.725 0.034 0.603 3e-13
Q8R420 1704 ATP-binding cassette sub- no N/A 0.787 0.036 0.575 8e-13
Q86UK0 2595 ATP-binding cassette sub- no N/A 0.612 0.018 0.673 2e-12
P78363 2273 Retinal-specific ATP-bind no N/A 0.737 0.025 0.593 4e-12
P41233 2261 ATP-binding cassette sub- no N/A 0.65 0.022 0.615 6e-12
Q86UQ4 5058 ATP-binding cassette sub- no N/A 0.887 0.014 0.479 1e-11
O35600 2310 Retinal-specific ATP-bind no N/A 0.712 0.024 0.614 1e-11
Q91V24 2159 ATP-binding cassette sub- no N/A 0.6 0.022 0.549 1e-11
Q7TNJ2 2170 ATP-binding cassette sub- no N/A 0.6 0.022 0.549 1e-11
O95477 2261 ATP-binding cassette sub- no N/A 0.65 0.022 0.596 2e-11
>sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 Back     alignment and function desciption
 Score = 73.6 bits (179), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 42/58 (72%)

Query: 23   AVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMDLVR 80
            AV+++S  V +GECFGLLG NGAGKTTTFKMLTG    TSG+A+V  H I   +  VR
Sbjct: 1398 AVDRLSLAVQKGECFGLLGFNGAGKTTTFKMLTGEESLTSGDAFVGGHRISSDVGKVR 1455




Plays an important role in the formation of pulmonary surfactant, probably by transporting lipids such as cholesterol.
Homo sapiens (taxid: 9606)
>sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=2 SV=3 Back     alignment and function description
>sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 Back     alignment and function description
>sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 Back     alignment and function description
>sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 Back     alignment and function description
>sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 Back     alignment and function description
>sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 Back     alignment and function description
>sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 Back     alignment and function description
>sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 Back     alignment and function description
>sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
427784385 2338 Putative lipid exporter abca1 [Rhipiceph 0.737 0.025 0.644 5e-14
427794409 797 Putative lipid exporter abca1, partial [ 0.737 0.074 0.644 5e-14
449681672 345 PREDICTED: ATP-binding cassette sub-fami 0.712 0.165 0.684 8e-14
449673705 1206 PREDICTED: ATP-binding cassette sub-fami 0.675 0.044 0.666 1e-13
145530237 1760 hypothetical protein [Paramecium tetraur 0.737 0.033 0.633 2e-13
405950989 2208 ATP-binding cassette sub-family A member 0.725 0.026 0.603 3e-13
443734953 2255 hypothetical protein CAPTEDRAFT_226736 [ 0.675 0.023 0.685 4e-13
145530173 1762 hypothetical protein [Paramecium tetraur 0.75 0.034 0.566 5e-13
291414610 1703 PREDICTED: ATP-binding cassette, sub-fam 0.725 0.034 0.655 5e-13
118363720 2778 ABC transporter family protein [Tetrahym 0.75 0.021 0.55 6e-13
>gi|427784385|gb|JAA57644.1| Putative lipid exporter abca1 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 45/59 (76%)

Query: 22   PAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMDLVR 80
            PAVN +  GV  GECFGLLG+NGAGKTTTFKMLTG  + T GNA++  +SIR  +DL R
Sbjct: 1971 PAVNHLCVGVRAGECFGLLGVNGAGKTTTFKMLTGNTEVTEGNAFISGYSIRTQIDLAR 2029




Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|427794409|gb|JAA62656.1| Putative lipid exporter abca1, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|449681672|ref|XP_002156679.2| PREDICTED: ATP-binding cassette sub-family A member 2-like, partial [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|449673705|ref|XP_002167290.2| PREDICTED: ATP-binding cassette sub-family A member 2-like, partial [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|145530237|ref|XP_001450896.1| hypothetical protein [Paramecium tetraurelia strain d4-2] gi|124418529|emb|CAK83499.1| unnamed protein product [Paramecium tetraurelia] Back     alignment and taxonomy information
>gi|405950989|gb|EKC18939.1| ATP-binding cassette sub-family A member 1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|443734953|gb|ELU18808.1| hypothetical protein CAPTEDRAFT_226736 [Capitella teleta] Back     alignment and taxonomy information
>gi|145530173|ref|XP_001450864.1| hypothetical protein [Paramecium tetraurelia strain d4-2] gi|124418497|emb|CAK83467.1| unnamed protein product [Paramecium tetraurelia] Back     alignment and taxonomy information
>gi|291414610|ref|XP_002723549.1| PREDICTED: ATP-binding cassette, sub-family A member 3 [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|118363720|ref|XP_001015084.1| ABC transporter family protein [Tetrahymena thermophila] gi|89296851|gb|EAR94839.1| ABC transporter family protein [Tetrahymena thermophila SB210] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
UNIPROTKB|H3BTP1 411 ABCA3 "ATP-binding cassette su 0.725 0.141 0.603 1.8e-12
UNIPROTKB|F5H5R2 392 ABCA4 "Retinal-specific ATP-bi 0.712 0.145 0.614 2.1e-12
UNIPROTKB|E1BM08 787 ABCA13 "Uncharacterized protei 0.625 0.063 0.68 3.5e-12
UNIPROTKB|B4DWY6 543 ABCA4 "cDNA FLJ51128, highly s 0.712 0.104 0.614 4.1e-12
ZFIN|ZDB-GENE-050517-3 2277 abca4a "ATP-binding cassette, 0.737 0.025 0.627 4.8e-12
UNIPROTKB|E1BVQ5 1706 ABCA3 "Uncharacterized protein 0.687 0.032 0.637 5.7e-12
UNIPROTKB|F1MAJ3 1447 Abca3 "Protein Abca3" [Rattus 0.787 0.043 0.590 9.8e-12
UNIPROTKB|E9PTI4 1702 Abca3 "Protein Abca3" [Rattus 0.787 0.037 0.590 1.2e-11
UNIPROTKB|E9PU20 1704 Abca3 "Protein Abca3" [Rattus 0.787 0.036 0.590 1.2e-11
MGI|MGI:1351617 1704 Abca3 "ATP-binding cassette, s 0.787 0.036 0.590 1.2e-11
UNIPROTKB|H3BTP1 ABCA3 "ATP-binding cassette sub-family A member 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 173 (66.0 bits), Expect = 1.8e-12, P = 1.8e-12
 Identities = 35/58 (60%), Positives = 42/58 (72%)

Query:    23 AVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMDLVR 80
             AV+++S  V +GECFGLLG NGAGKTTTFKMLTG    TSG+A+V  H I   +  VR
Sbjct:   179 AVDRLSLAVQKGECFGLLGFNGAGKTTTFKMLTGEESLTSGDAFVGGHRISSDVGKVR 236




GO:0016887 "ATPase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|F5H5R2 ABCA4 "Retinal-specific ATP-binding cassette transporter" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BM08 ABCA13 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4DWY6 ABCA4 "cDNA FLJ51128, highly similar to Retinal-specific ATP-binding cassette transporter" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050517-3 abca4a "ATP-binding cassette, sub-family A (ABC1), member 4a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVQ5 ABCA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAJ3 Abca3 "Protein Abca3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTI4 Abca3 "Protein Abca3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PU20 Abca3 "Protein Abca3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1351617 Abca3 "ATP-binding cassette, sub-family A (ABC1), member 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q63TX3NODI_BURPS3, ., 6, ., 3, ., -0.61700.58750.1546yesN/A
P26050NODI_BRAJA3, ., 6, ., 3, ., -0.50900.68750.1797yesN/A
Q1BWI2NODI_BURCA3, ., 6, ., 3, ., -0.60860.5750.1513yesN/A
Q62K72NODI_BURMA3, ., 6, ., 3, ., -0.61700.58750.1546yesN/A
P0A9U2YBHF_SHIFLNo assigned EC number0.54710.66250.0916yesN/A
Q54DT1ABCA9_DICDINo assigned EC number0.54380.71250.0674yesN/A
Q39GT7NODI_BURS33, ., 6, ., 3, ., -0.58690.5750.1513yesN/A
Q1PEH6AB3A_ARATHNo assigned EC number0.54230.73750.0633yesN/A
Q99758ABCA3_HUMANNo assigned EC number0.60340.7250.0340yesN/A
Q13ZJ1NODI_BURXL3, ., 6, ., 3, ., -0.58690.5750.1513yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
cd03263 220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 8e-29
cd03230 173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 1e-24
COG1131 293 COG1131, CcmA, ABC-type multidrug transport system 8e-22
cd03265 220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 1e-19
cd03267 236 cd03267, ABC_NatA_like, ATP-binding cassette domai 8e-18
cd03218 232 cd03218, ABC_YhbG, ATP-binding cassette component 2e-17
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-17
TIGR01188 302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-17
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-16
cd03269 210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-16
COG1137 243 COG1137, YhbG, ABC-type (unclassified) transport s 3e-16
cd03268 208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 5e-16
COG4586 325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-15
cd03214 180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 1e-15
COG4152 300 COG4152, COG4152, ABC-type uncharacterized transpo 1e-15
cd03219 236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 3e-15
PRK13536 340 PRK13536, PRK13536, nodulation factor exporter sub 8e-15
PRK13537 306 PRK13537, PRK13537, nodulation ABC transporter Nod 9e-15
cd03266 218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 1e-14
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 1e-14
TIGR03522 301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 2e-14
COG4608 268 COG4608, AppF, ABC-type oligopeptide transport sys 3e-14
COG1120 258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 3e-14
COG4555 245 COG4555, NatA, ABC-type Na+ transport system, ATPa 4e-14
COG1134 249 COG1134, TagH, ABC-type polysaccharide/polyol phos 5e-14
TIGR03740 223 TIGR03740, galliderm_ABC, gallidermin-class lantib 1e-13
TIGR03864 236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 1e-13
COG0411 250 COG0411, LivG, ABC-type branched-chain amino acid 3e-13
TIGR01288 303 TIGR01288, nodI, ATP-binding ABC transporter famil 3e-13
cd03220 224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 4e-13
cd03225 211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 9e-13
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 9e-13
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-12
cd03235 213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 2e-12
cd03264 211 cd03264, ABC_drug_resistance_like, ABC-type multid 2e-12
cd03224 222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 3e-12
COG1121 254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 4e-12
COG1125 309 COG1125, OpuBA, ABC-type proline/glycine betaine t 4e-12
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 8e-12
COG1122 235 COG1122, CbiO, ABC-type cobalt transport system, A 1e-11
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 2e-11
PRK11300 255 PRK11300, livG, leucine/isoleucine/valine transpor 3e-11
COG1123 539 COG1123, COG1123, ATPase components of various ABC 5e-11
COG0410 237 COG0410, LivF, ABC-type branched-chain amino acid 5e-11
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 6e-11
cd03259 213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 6e-11
cd03300 232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 7e-11
cd03257 228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 8e-11
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 9e-11
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 1e-10
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-10
cd03294 269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 1e-10
COG1124 252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 2e-10
COG1119 257 COG1119, ModF, ABC-type molybdenum transport syste 2e-10
cd03256 241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 2e-10
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 3e-10
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 3e-10
PRK13632 271 PRK13632, cbiO, cobalt transporter ATP-binding sub 4e-10
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-b 5e-10
cd03295 242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 6e-10
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 8e-10
TIGR03411 242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 8e-10
TIGR03375 694 TIGR03375, type_I_sec_LssB, type I secretion syste 9e-10
COG4618 580 COG4618, ArpD, ABC-type protease/lipase transport 1e-09
cd03301 213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 1e-09
PRK13639 275 PRK13639, cbiO, cobalt transporter ATP-binding sub 1e-09
COG1116 248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 2e-09
TIGR01166 190 TIGR01166, cbiO, cobalt transport protein ATP-bind 2e-09
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, A 2e-09
PRK13548 258 PRK13548, hmuV, hemin importer ATP-binding subunit 2e-09
cd03229 178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-09
cd03245 220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 3e-09
PRK13650 279 PRK13650, cbiO, cobalt transporter ATP-binding sub 3e-09
cd03255 218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 4e-09
PRK13540 200 PRK13540, PRK13540, cytochrome c biogenesis protei 5e-09
PRK13635 279 PRK13635, cbiO, cobalt transporter ATP-binding sub 5e-09
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 5e-09
cd03261 235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 5e-09
COG2274 709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 6e-09
TIGR02324 224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 7e-09
cd03293 220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 8e-09
COG3638 258 COG3638, COG3638, ABC-type phosphate/phosphonate t 8e-09
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding 8e-09
COG0444 316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 1e-08
TIGR01842 544 TIGR01842, type_I_sec_PrtD, type I secretion syste 1e-08
TIGR02769 265 TIGR02769, nickel_nikE, nickel import ATP-binding 1e-08
PRK13633 280 PRK13633, PRK13633, cobalt transporter ATP-binding 2e-08
COG4167 267 COG4167, SapF, ABC-type antimicrobial peptide tran 2e-08
COG1135 339 COG1135, AbcC, ABC-type metal ion transport system 2e-08
PRK10895 241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 2e-08
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 2e-08
cd03258 233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-08
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-08
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transpor 2e-08
TIGR02315 243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 3e-08
cd03247 178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 3e-08
COG4674 249 COG4674, COG4674, Uncharacterized ABC-type transpo 3e-08
PRK15112 267 PRK15112, PRK15112, antimicrobial peptide ABC syst 3e-08
COG2884 223 COG2884, FtsE, Predicted ATPase involved in cell d 3e-08
PRK13640 282 PRK13640, cbiO, cobalt transporter ATP-binding sub 5e-08
PRK13637 287 PRK13637, cbiO, cobalt transporter ATP-binding sub 6e-08
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase compone 7e-08
COG4778 235 COG4778, PhnL, ABC-type phosphonate transport syst 7e-08
cd03251 234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 7e-08
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 8e-08
TIGR03410 230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 8e-08
cd03215 182 cd03215, ABC_Carb_Monos_II, Second domain of the A 9e-08
PRK15064 530 PRK15064, PRK15064, ABC transporter ATP-binding pr 1e-07
PRK13652 277 PRK13652, cbiO, cobalt transporter ATP-binding sub 1e-07
cd03226 205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-07
cd03292 214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 1e-07
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 1e-07
PRK13546 264 PRK13546, PRK13546, teichoic acids export protein 2e-07
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provision 2e-07
COG1101 263 COG1101, PhnK, ABC-type uncharacterized transport 2e-07
cd03237 246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 3e-07
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP bindi 3e-07
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 3e-07
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-07
PRK10522 547 PRK10522, PRK10522, multidrug transporter membrane 5e-07
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 6e-07
TIGR02673 214 TIGR02673, FtsE, cell division ATP-binding protein 6e-07
COG1127 263 COG1127, Ttg2A, ABC-type transport system involved 6e-07
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 6e-07
TIGR02203 571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 7e-07
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP- 7e-07
PRK13657 588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 8e-07
cd03299 235 cd03299, ABC_ModC_like, ATP-binding cassette domai 9e-07
PRK13636 283 PRK13636, cbiO, cobalt transporter ATP-binding sub 9e-07
COG4559 259 COG4559, COG4559, ABC-type hemin transport system, 1e-06
COG4987 573 COG4987, CydC, ABC-type transport system involved 1e-06
TIGR02857 529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 1e-06
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 2e-06
PRK15064 530 PRK15064, PRK15064, ABC transporter ATP-binding pr 2e-06
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transpor 2e-06
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-b 2e-06
COG4619 223 COG4619, COG4619, ABC-type uncharacterized transpo 2e-06
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-bind 2e-06
PRK13644 274 PRK13644, cbiO, cobalt transporter ATP-binding sub 2e-06
cd03296 239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 2e-06
PRK13648 269 PRK13648, cbiO, cobalt transporter ATP-binding sub 2e-06
COG1136 226 COG1136, SalX, ABC-type antimicrobial peptide tran 2e-06
TIGR03771 223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 2e-06
cd03260 227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 3e-06
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; 3e-06
cd03254 229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 3e-06
COG4615 546 COG4615, PvdE, ABC-type siderophore export system, 4e-06
COG4133 209 COG4133, CcmA, ABC-type transport system involved 5e-06
cd03222 177 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett 5e-06
TIGR02211 221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 6e-06
PRK11614 237 PRK11614, livF, leucine/isoleucine/valine transpor 7e-06
TIGR02204 576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 8e-06
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provision 1e-05
cd03253 236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 1e-05
PRK15056 272 PRK15056, PRK15056, manganese/iron transporter ATP 1e-05
TIGR01189 198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 1e-05
PRK11248 255 PRK11248, tauB, taurine transporter ATP-binding su 1e-05
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-05
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 2e-05
COG4988 559 COG4988, CydD, ABC-type transport system involved 2e-05
COG4604 252 COG4604, CeuD, ABC-type enterochelin transport sys 2e-05
cd03231 201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 2e-05
PRK11176 582 PRK11176, PRK11176, lipid transporter ATP-binding/ 2e-05
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 2e-05
COG1123 539 COG1123, COG1123, ATPase components of various ABC 3e-05
PRK13543 214 PRK13543, PRK13543, cytochrome c biogenesis protei 3e-05
PRK10419 268 PRK10419, nikE, nickel transporter ATP-binding pro 3e-05
PRK13538 204 PRK13538, PRK13538, cytochrome c biogenesis protei 3e-05
cd03250 204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 4e-05
PRK09544 251 PRK09544, znuC, high-affinity zinc transporter ATP 4e-05
cd03252 237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 5e-05
PRK13642 277 PRK13642, cbiO, cobalt transporter ATP-binding sub 5e-05
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 5e-05
PRK13647 274 PRK13647, cbiO, cobalt transporter ATP-binding sub 5e-05
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 6e-05
PRK13541 195 PRK13541, PRK13541, cytochrome c biogenesis protei 8e-05
TIGR03873 256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 8e-05
TIGR00968 237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 8e-05
cd03291 282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 9e-05
PRK11160 574 PRK11160, PRK11160, cysteine/glutathione ABC trans 9e-05
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter AT 1e-04
PRK13539 207 PRK13539, PRK13539, cytochrome c biogenesis protei 1e-04
TIGR02323 253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 1e-04
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-b 2e-04
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-04
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 2e-04
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 2e-04
PRK10938 490 PRK10938, PRK10938, putative molybdenum transport 2e-04
cd03236 255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 2e-04
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP 2e-04
PRK10247 225 PRK10247, PRK10247, putative ABC transporter ATP-b 2e-04
COG4525 259 COG4525, TauB, ABC-type taurine transport system, 2e-04
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 3e-04
PRK13638 271 PRK13638, cbiO, cobalt transporter ATP-binding sub 3e-04
COG4107 258 COG4107, PhnK, ABC-type phosphonate transport syst 3e-04
PRK11231 255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 3e-04
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 4e-04
TIGR02314 343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 4e-04
TIGR01192 585 TIGR01192, chvA, glucan exporter ATP-binding prote 4e-04
PRK10575 265 PRK10575, PRK10575, iron-hydroxamate transporter A 4e-04
PRK11629 233 PRK11629, lolD, lipoprotein transporter ATP-bindin 4e-04
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding sub 4e-04
cd03248 226 cd03248, ABCC_TAP, ATP-binding cassette domain of 6e-04
COG4181 228 COG4181, COG4181, Predicted ABC-type transport sys 6e-04
PRK11308 327 PRK11308, dppF, dipeptide transporter ATP-binding 7e-04
TIGR02770 230 TIGR02770, nickel_nikD, nickel import ATP-binding 7e-04
PRK10789 569 PRK10789, PRK10789, putative multidrug transporter 7e-04
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 7e-04
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 8e-04
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 8e-04
COG0396 251 COG0396, sufC, Cysteine desulfurase activator ATPa 8e-04
cd03249 238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 8e-04
cd03369 207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 9e-04
PRK13646 286 PRK13646, cbiO, cobalt transporter ATP-binding sub 0.001
TIGR02868 530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 0.001
TIGR01277 213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 0.001
smart00382148 smart00382, AAA, ATPases associated with a variety 0.001
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 0.001
PLN03073 718 PLN03073, PLN03073, ABC transporter F family; Prov 0.001
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 0.002
TIGR01193 708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 0.002
TIGR03797 686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 0.002
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 0.002
PRK11831 269 PRK11831, PRK11831, putative ABC transporter ATP-b 0.002
PRK11701 258 PRK11701, phnK, phosphonate C-P lyase system prote 0.002
PRK13651 305 PRK13651, PRK13651, cobalt transporter ATP-binding 0.003
TIGR01184 230 TIGR01184, ntrCD, nitrate transport ATP-binding su 0.003
COG1126 240 COG1126, GlnQ, ABC-type polar amino acid transport 0.003
PRK10908 222 PRK10908, PRK10908, cell division protein FtsE; Pr 0.003
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporte 0.003
cd03297 214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 0.003
PRK13641 287 PRK13641, cbiO, cobalt transporter ATP-binding sub 0.003
cd03217 200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 0.003
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
 Score =  101 bits (255), Expect = 8e-29
 Identities = 38/66 (57%), Positives = 46/66 (69%)

Query: 15 TFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRD 74
          T+   TKPAV+ +S  V +GE FGLLG NGAGKTTT KMLTG ++PTSG AY+  +SIR 
Sbjct: 9  TYKKGTKPAVDDLSLNVYKGEIFGLLGHNGAGKTTTLKMLTGELRPTSGTAYINGYSIRT 68

Query: 75 SMDLVR 80
               R
Sbjct: 69 DRKAAR 74


The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages. Length = 220

>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|184131 PRK13546, PRK13546, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184128 PRK13541, PRK13541, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 80
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.87
COG0411 250 LivG ABC-type branched-chain amino acid transport 99.86
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.84
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.84
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.83
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 99.83
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.83
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.83
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.83
COG4152 300 ABC-type uncharacterized transport system, ATPase 99.83
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.83
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 99.83
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.82
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.82
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 99.82
PRK13537 306 nodulation ABC transporter NodI; Provisional 99.82
COG4555 245 NatA ABC-type Na+ transport system, ATPase compone 99.82
PRK13536 340 nodulation factor exporter subunit NodI; Provision 99.82
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 99.82
cd03269 210 ABC_putative_ATPase This subfamily is involved in 99.82
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 99.82
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.82
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 99.82
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.81
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.81
cd03226 205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.81
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 99.81
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.81
COG1137 243 YhbG ABC-type (unclassified) transport system, ATP 99.81
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 99.81
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.81
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.81
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 99.81
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.81
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.81
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 99.81
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.81
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.81
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 99.81
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.81
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 99.81
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.81
cd03229 178 ABC_Class3 This class is comprised of all BPD (Bin 99.81
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.81
TIGR01189 198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.81
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.81
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.81
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.81
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 99.81
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.81
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 99.81
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 99.81
COG0410 237 LivF ABC-type branched-chain amino acid transport 99.8
PRK11614 237 livF leucine/isoleucine/valine transporter ATP-bin 99.8
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 99.8
COG1127 263 Ttg2A ABC-type transport system involved in resist 99.8
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 99.8
COG3638 258 ABC-type phosphate/phosphonate transport system, A 99.8
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 99.8
cd03231 201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.8
PRK10908 222 cell division protein FtsE; Provisional 99.8
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.8
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 99.8
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 99.8
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 99.8
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 99.8
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 99.8
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.8
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.8
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.8
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 99.8
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.8
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.8
cd03230 173 ABC_DR_subfamily_A This family of ATP-binding prot 99.8
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 99.8
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.8
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.8
cd03214 180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.8
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 99.79
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 99.79
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 99.79
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 99.79
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 99.79
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 99.79
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.79
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 99.79
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.79
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 99.79
cd03247 178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.79
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 99.79
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.79
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.79
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 99.79
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.79
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.78
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.78
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 99.78
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.78
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.78
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
cd03246173 ABCC_Protease_Secretion This family represents the 99.78
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 99.78
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.78
TIGR03740 223 galliderm_ABC gallidermin-class lantibiotic protec 99.78
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.78
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
TIGR01166 190 cbiO cobalt transport protein ATP-binding subunit. 99.78
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 99.78
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.78
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 99.78
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 99.78
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 99.78
COG4604 252 CeuD ABC-type enterochelin transport system, ATPas 99.78
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 99.78
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.78
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.78
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 99.78
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.78
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 99.78
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 99.77
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 99.77
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.77
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.77
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.77
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.77
PRK13541 195 cytochrome c biogenesis protein CcmA; Provisional 99.77
TIGR02982 220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.77
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
cd03217 200 ABC_FeS_Assembly ABC-type transport system involve 99.77
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.77
cd03300 232 ABC_PotA_N PotA is an ABC-type transporter and the 99.77
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 99.77
COG4559 259 ABC-type hemin transport system, ATPase component 99.77
TIGR00968 237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.77
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 99.77
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 99.77
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.77
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.77
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.77
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 99.77
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 99.77
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 99.77
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 99.77
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 99.77
cd03213 194 ABCG_EPDR ABCG transporters are involved in eye pi 99.77
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 99.77
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 99.76
COG4133 209 CcmA ABC-type transport system involved in cytochr 99.76
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 99.76
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 99.76
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.76
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 99.76
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK14251 251 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.76
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 99.76
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 99.76
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK10938 490 putative molybdenum transport ATP-binding protein 99.76
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.76
cd03215 182 ABC_Carb_Monos_II This family represents domain II 99.76
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 99.76
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.76
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 99.76
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 99.76
PRK10419 268 nikE nickel transporter ATP-binding protein NikE; 99.76
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 99.76
cd03369 207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.76
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.76
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 99.76
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 99.76
PRK09984 262 phosphonate/organophosphate ester transporter subu 99.76
cd03298 211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.76
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 99.75
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 99.75
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 99.75
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 99.75
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.75
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 99.75
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 99.75
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 99.75
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.75
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.75
cd03299 235 ABC_ModC_like Archeal protein closely related to M 99.75
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 99.75
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 99.75
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.75
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.74
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.74
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.74
cd03232 192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.74
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 99.74
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 99.74
PRK14254 285 phosphate ABC transporter ATP-binding protein; Pro 99.74
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 99.74
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.74
PRK14249 251 phosphate ABC transporter ATP-binding protein; Pro 99.74
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 99.74
PRK14253 249 phosphate ABC transporter ATP-binding protein; Pro 99.74
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.74
COG2884 223 FtsE Predicted ATPase involved in cell division [C 99.74
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 99.74
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.74
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 99.74
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 99.74
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 99.74
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.74
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 99.74
PRK10771 232 thiQ thiamine transporter ATP-binding subunit; Pro 99.74
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 99.74
TIGR01277 213 thiQ thiamine ABC transporter, ATP-binding protein 99.74
PRK14236 272 phosphate transporter ATP-binding protein; Provisi 99.74
PRK14246 257 phosphate ABC transporter ATP-binding protein; Pro 99.74
PRK14275 286 phosphate ABC transporter ATP-binding protein; Pro 99.74
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.73
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 99.73
PRK14244 251 phosphate ABC transporter ATP-binding protein; Pro 99.73
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 99.73
PRK14245 250 phosphate ABC transporter ATP-binding protein; Pro 99.73
PRK14255 252 phosphate ABC transporter ATP-binding protein; Pro 99.73
TIGR03796 710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.73
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 99.73
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 99.73
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 99.73
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 99.73
cd03222 177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.73
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 99.73
cd03234 226 ABCG_White The White subfamily represents ABC tran 99.73
PRK14266 250 phosphate ABC transporter ATP-binding protein; Pro 99.73
PRK10938 490 putative molybdenum transport ATP-binding protein 99.73
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.73
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 99.72
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 99.72
PRK11147 635 ABC transporter ATPase component; Reviewed 99.72
TIGR02857 529 CydD thiol reductant ABC exporter, CydD subunit. U 99.72
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 99.72
COG1132 567 MdlB ABC-type multidrug transport system, ATPase a 99.72
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 99.72
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.72
COG1122 235 CbiO ABC-type cobalt transport system, ATPase comp 99.72
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.72
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.72
PRK10522 547 multidrug transporter membrane component/ATP-bindi 99.72
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.72
PRK11160 574 cysteine/glutathione ABC transporter membrane/ATP- 99.71
COG4619 223 ABC-type uncharacterized transport system, ATPase 99.71
TIGR00958 711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.71
cd03297 214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.71
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.71
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.71
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.71
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 99.71
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 99.71
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 99.71
COG1119 257 ModF ABC-type molybdenum transport system, ATPase 99.71
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.71
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.71
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.71
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 99.7
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.7
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.7
PRK11147 635 ABC transporter ATPase component; Reviewed 99.7
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.7
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 99.7
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.7
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 99.69
TIGR01842 544 type_I_sec_PrtD type I secretion system ABC transp 99.69
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.69
TIGR02203 571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.69
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.69
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 99.69
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 99.69
TIGR02204 576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.69
TIGR01194 555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.69
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 99.69
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 99.69
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.69
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.69
COG4525 259 TauB ABC-type taurine transport system, ATPase com 99.68
TIGR01846 694 type_I_sec_HlyB type I secretion system ABC transp 99.68
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.68
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.68
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.68
COG4586 325 ABC-type uncharacterized transport system, ATPase 99.68
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.68
KOG0058|consensus 716 99.68
COG4674 249 Uncharacterized ABC-type transport system, ATPase 99.67
KOG0057|consensus 591 99.67
PRK03695 248 vitamin B12-transporter ATPase; Provisional 99.67
PRK14257 329 phosphate ABC transporter ATP-binding protein; Pro 99.67
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.66
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.66
PRK13546 264 teichoic acids export protein ATP-binding subunit; 99.66
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttr 99.66
COG1101 263 PhnK ABC-type uncharacterized transport system, AT 99.65
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.65
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.65
COG4987 573 CydC ABC-type transport system involved in cytochr 99.65
COG4988 559 CydD ABC-type transport system involved in cytochr 99.65
PLN03232 1495 ABC transporter C family member; Provisional 99.64
PLN03130 1622 ABC transporter C family member; Provisional 99.64
PLN03211 659 ABC transporter G-25; Provisional 99.64
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.64
PLN03073 718 ABC transporter F family; Provisional 99.64
COG0488 530 Uup ATPase components of ABC transporters with dup 99.63
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.63
COG4167 267 SapF ABC-type antimicrobial peptide transport syst 99.63
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.63
PTZ00243 1560 ABC transporter; Provisional 99.63
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.63
PLN03073 718 ABC transporter F family; Provisional 99.63
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.63
COG4615 546 PvdE ABC-type siderophore export system, fused ATP 99.63
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.62
KOG0055|consensus 1228 99.62
COG1123 539 ATPase components of various ABC-type transport sy 99.62
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.6
COG4598 256 HisP ABC-type histidine transport system, ATPase c 99.6
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.59
COG3840 231 ThiQ ABC-type thiamine transport system, ATPase co 99.59
TIGR00954 659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.59
PRK13409 590 putative ATPase RIL; Provisional 99.58
PRK13409 590 putative ATPase RIL; Provisional 99.57
COG4181 228 Predicted ABC-type transport system involved in ly 99.56
KOG0056|consensus 790 99.55
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.55
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase 99.54
TIGR03771 223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.53
KOG0055|consensus 1228 99.53
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.52
cd03238 176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.52
COG0488 530 Uup ATPase components of ABC transporters with dup 99.52
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.52
COG1123 539 ATPase components of various ABC-type transport sy 99.5
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.49
KOG0059|consensus 885 99.48
KOG0054|consensus 1381 99.47
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.47
COG4618 580 ArpD ABC-type protease/lipase transport system, AT 99.47
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 99.46
PLN03140 1470 ABC transporter G family member; Provisional 99.45
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.43
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.43
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.42
PLN03130 1622 ABC transporter C family member; Provisional 99.41
PLN03140 1470 ABC transporter G family member; Provisional 99.4
COG4136 213 ABC-type uncharacterized transport system, ATPase 99.4
COG4778 235 PhnL ABC-type phosphonate transport system, ATPase 99.39
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 99.38
PTZ00243 1560 ABC transporter; Provisional 99.38
PLN03232 1495 ABC transporter C family member; Provisional 99.37
COG4161 242 ArtP ABC-type arginine transport system, ATPase co 99.37
COG5265 497 ATM1 ABC-type transport system involved in Fe-S cl 99.33
COG4172 534 ABC-type uncharacterized transport system, duplica 99.22
cd03270 226 ABC_UvrA_I The excision repair protein UvrA domain 99.22
KOG2355|consensus 291 99.19
KOG0061|consensus 613 99.19
cd03272 243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.15
KOG0927|consensus 614 99.14
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 99.13
COG4172 534 ABC-type uncharacterized transport system, duplica 99.12
cd03278 197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.11
COG4178 604 ABC-type uncharacterized transport system, permeas 99.1
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 99.09
COG4138 248 BtuD ABC-type cobalamin transport system, ATPase c 99.07
KOG0927|consensus 614 99.03
cd03274 212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.0
cd01130 186 VirB11-like_ATPase Type IV secretory pathway compo 99.0
KOG0060|consensus 659 98.95
KOG0064|consensus 728 98.93
KOG0066|consensus 807 98.92
cd03279 213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 98.92
KOG0054|consensus 1381 98.92
COG2401 593 ABC-type ATPase fused to a predicted acetyltransfe 98.89
cd03280 200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 98.89
cd03283 199 ABC_MutS-like MutS-like homolog in eukaryotes. The 98.88
KOG0062|consensus 582 98.88
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 98.87
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 98.82
PRK07594 433 type III secretion system ATPase SsaN; Validated 98.81
cd03273 251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 98.81
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 98.81
TIGR02858 270 spore_III_AA stage III sporulation protein AA. Mem 98.79
PRK09862 506 putative ATP-dependent protease; Provisional 98.78
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 98.77
cd03282 204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 98.76
cd03287 222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 98.75
PRK08149 428 ATP synthase SpaL; Validated 98.73
PRK09099 441 type III secretion system ATPase; Provisional 98.73
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 98.72
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.72
cd03243 202 ABC_MutS_homologs The MutS protein initiates DNA m 98.71
cd03240 204 ABC_Rad50 The catalytic domains of Rad50 are simil 98.7
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 98.67
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 98.66
COG3845 501 ABC-type uncharacterized transport systems, ATPase 98.66
PRK00300 205 gmk guanylate kinase; Provisional 98.64
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 98.64
TIGR00235 207 udk uridine kinase. Model contains a number of lon 98.63
TIGR02788 308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.61
PRK10078 186 ribose 1,5-bisphosphokinase; Provisional 98.61
PRK09270 229 nucleoside triphosphate hydrolase domain-containin 98.6
PRK09825 176 idnK D-gluconate kinase; Provisional 98.59
PRK00635 1809 excinuclease ABC subunit A; Provisional 98.59
KOG0065|consensus 1391 98.58
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 98.57
PF1355562 AAA_29: P-loop containing region of AAA domain 98.56
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 98.55
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 98.54
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 98.53
cd03271 261 ABC_UvrA_II The excision repair protein UvrA domai 98.52
PRK05922 434 type III secretion system ATPase; Validated 98.52
cd03284 216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 98.52
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 98.52
cd03275 247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 98.5
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 98.5
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 98.49
PLN02796 347 D-glycerate 3-kinase 98.48
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 98.48
COG4170 330 SapD ABC-type antimicrobial peptide transport syst 98.47
PRK06315 442 type III secretion system ATPase; Provisional 98.45
cd03285 222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 98.44
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 98.44
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 98.43
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 98.42
TIGR00767 415 rho transcription termination factor Rho. Members 98.39
PRK10416 318 signal recognition particle-docking protein FtsY; 98.39
PRK01889 356 GTPase RsgA; Reviewed 98.39
PRK04863 1486 mukB cell division protein MukB; Provisional 98.38
PRK06936 439 type III secretion system ATPase; Provisional 98.38
PRK00635 1809 excinuclease ABC subunit A; Provisional 98.36
TIGR02322 179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.36
cd02025 220 PanK Pantothenate kinase (PanK) catalyzes the phos 98.36
cd00879 190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.35
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 98.35
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Pr 98.35
cd02023 198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.34
PRK06820 440 type III secretion system ATPase; Validated 98.32
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involve 98.3
PF13476 202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 98.3
cd03281 213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 98.29
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 98.28
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 98.27
cd04155 173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.26
TIGR03263 180 guanyl_kin guanylate kinase. Members of this famil 98.26
cd03276 198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 98.25
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 98.23
PRK05480 209 uridine/cytidine kinase; Provisional 98.23
PRK03846 198 adenylylsulfate kinase; Provisional 98.22
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.22
KOG0066|consensus 807 98.21
cd04159 159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.19
PRK00098298 GTPase RsgA; Reviewed 98.18
cd03286 218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 98.17
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 98.12
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 98.11
TIGR01360 188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.11
PF13304 303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.11
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 98.09
cd04104 197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.09
PRK08533 230 flagellar accessory protein FlaH; Reviewed 98.08
PTZ00132 215 GTP-binding nuclear protein Ran; Provisional 98.08
KOG0065|consensus 1391 98.08
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 98.07
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.06
PRK00889 175 adenylylsulfate kinase; Provisional 98.06
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 98.03
PLN02318 656 phosphoribulokinase/uridine kinase 98.03
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 98.02
PRK13851 344 type IV secretion system protein VirB11; Provision 98.01
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.01
PLN03046 460 D-glycerate 3-kinase; Provisional 98.01
cd01876 170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.01
PRK15494 339 era GTPase Era; Provisional 98.0
PRK05541 176 adenylylsulfate kinase; Provisional 98.0
PRK09183 259 transposase/IS protein; Provisional 97.99
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 97.99
PRK10246 1047 exonuclease subunit SbcC; Provisional 97.98
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.97
smart00382148 AAA ATPases associated with a variety of cellular 97.97
KOG0063|consensus 592 97.97
TIGR00101 199 ureG urease accessory protein UreG. This model rep 97.96
PLN02165 334 adenylate isopentenyltransferase 97.96
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.96
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 97.94
cd01128 249 rho_factor Transcription termination factor rho is 97.94
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 97.93
COG3950 440 Predicted ATP-binding protein involved in virulenc 97.93
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.93
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
Probab=99.87  E-value=8.5e-24  Score=144.64  Aligned_cols=67  Identities=36%  Similarity=0.663  Sum_probs=63.2

Q ss_pred             hhccccccCCCCCccccceeeeeeccceeeeeecccCCCceeEeeeeeceeecCCCceeeeeccccc
Q psy7220           8 TVDSHLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRD   74 (80)
Q Consensus         8 ~~~~~~~~~~~~~~~vl~~isl~i~~g~~~~iiG~nGsGKsTll~~l~gl~~~~~G~i~~~~~~i~~   74 (80)
                      .++.+++++.|+++++++++||++++|++++|+||||||||||+|+|+|+++|.+|+|+++|+++.+
T Consensus         2 ~L~~~~ls~~y~~~~il~~ls~~i~~G~i~~iiGpNG~GKSTLLk~l~g~l~p~~G~V~l~g~~i~~   68 (258)
T COG1120           2 MLEVENLSFGYGGKPILDDLSFSIPKGEITGILGPNGSGKSTLLKCLAGLLKPKSGEVLLDGKDIAS   68 (258)
T ss_pred             eeEEEEEEEEECCeeEEecceEEecCCcEEEEECCCCCCHHHHHHHHhccCCCCCCEEEECCCchhh
Confidence            3567888999999999999999999999999999999999999999999999999999999998765



>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG2355|consensus Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>KOG0064|consensus Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0063|consensus Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
1vpl_A 256 Crystal Structure Of Abc Transporter Atp-binding Pr 8e-08
2yyz_A 359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 5e-07
4g1u_C 266 X-Ray Structure Of The Bacterial Heme Transporter H 4e-06
1z47_A 355 Structure Of The Atpase Subunit Cysa Of The Putativ 6e-06
2ix8_A 976 Model For Eef3 Bound To An 80s Ribosome Length = 97 7e-06
2iwh_A 986 Structure Of Yeast Elongation Factor 3 In Complex W 7e-06
2iw3_A 986 Elongation Factor 3 In Complex With Adp Length = 98 7e-06
1v43_A 372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 3e-05
1vci_A 373 Crystal Structure Of The Atp-binding Cassette Of Mu 3e-05
1g29_1 372 Malk Length = 372 4e-05
3gfo_A 275 Structure Of Cbio1 From Clostridium Perfringens: Pa 6e-05
2d62_A 375 Crystal Structure Of Multiple Sugar Binding Transpo 8e-05
3b5x_A 582 Crystal Structure Of Msba From Vibrio Cholerae Leng 1e-04
4hlu_A 268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 1e-04
2yz2_A 266 Crystal Structure Of The Abc Transporter In The Cob 1e-04
2it1_A 362 Structure Of Ph0203 Protein From Pyrococcus Horikos 1e-04
1oxx_K 353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 2e-04
1oxs_C 353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 2e-04
2pzf_A 228 Minimal Human Cftr First Nucleotide Binding Domain 5e-04
2bbo_A 291 Human Nbd1 With Phe508 Length = 291 5e-04
1xmj_A 290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 5e-04
2pzg_A 241 Minimal Human Cftr First Nucleotide Binding Domain 5e-04
2pze_A 229 Minimal Human Cftr First Nucleotide Binding Domain 5e-04
3j15_B 593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 6e-04
3bk7_A 607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 6e-04
2bbt_A 290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 6e-04
1xmi_A 291 Crystal Structure Of Human F508a Nbd1 Domain With A 6e-04
2bbs_A 290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 6e-04
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure

Iteration: 1

Score = 52.0 bits (123), Expect = 8e-08, Method: Composition-based stats. Identities = 26/60 (43%), Positives = 37/60 (61%) Query: 21 KPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMDLVR 80 K + ISF + GE FGL+G NGAGKTTT ++++ IKP+SG V ++ + VR Sbjct: 28 KEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEVR 87
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|2IX8|A Chain A, Model For Eef3 Bound To An 80s Ribosome Length = 976 Back     alignment and structure
>pdb|2IWH|A Chain A, Structure Of Yeast Elongation Factor 3 In Complex With Adpnp Length = 986 Back     alignment and structure
>pdb|2IW3|A Chain A, Elongation Factor 3 In Complex With Adp Length = 986 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 6e-25
1sgw_A 214 Putative ABC transporter; structural genomics, P p 4e-24
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-16
1g6h_A 257 High-affinity branched-chain amino acid transport 1e-15
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 4e-14
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 4e-13
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-12
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 4e-11
1ji0_A 240 ABC transporter; ATP binding protein, structural g 2e-12
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 4e-12
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 4e-09
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-12
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-09
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 5e-12
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 6e-11
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 6e-12
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 1e-11
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 2e-08
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 2e-10
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 5e-10
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 2e-09
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 3e-09
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 1e-08
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 2e-08
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 4e-07
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 2e-06
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 2e-06
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 2e-06
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 3e-06
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 1e-05
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 3e-05
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 4e-05
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 6e-05
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 7e-05
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 8e-05
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 1e-04
2ghi_A 260 Transport protein; multidrug resistance protein, M 1e-04
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 1e-04
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 2e-04
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 3e-04
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 3e-04
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 6e-04
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 7e-04
2ged_A193 SR-beta, signal recognition particle receptor beta 9e-04
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score = 92.2 bits (230), Expect = 6e-25
 Identities = 26/63 (41%), Positives = 37/63 (58%)

Query: 18 YDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMD 77
             K  +  ISF +  GE FGL+G NGAGKTTT ++++  IKP+SG   V   ++ +   
Sbjct: 25 IGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPH 84

Query: 78 LVR 80
           VR
Sbjct: 85 EVR 87


>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 99.86
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 99.85
1ji0_A 240 ABC transporter; ATP binding protein, structural g 99.85
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 99.85
1g6h_A 257 High-affinity branched-chain amino acid transport 99.85
1b0u_A 262 Histidine permease; ABC transporter, transport pro 99.84
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 99.84
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.84
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 99.84
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 99.84
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 99.84
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 99.84
1sgw_A 214 Putative ABC transporter; structural genomics, P p 99.83
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.83
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.83
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.83
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.82
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.82
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 99.82
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.82
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.82
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 99.82
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 99.81
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.81
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 99.81
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 99.81
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.81
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.8
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.8
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.8
2ghi_A 260 Transport protein; multidrug resistance protein, M 99.79
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 99.78
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.78
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 99.78
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 99.77
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 99.76
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 99.76
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 99.76
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 99.76
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 99.76
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 99.75
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 99.75
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 99.74
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.72
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.7
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.67
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.66
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.64
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.64
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.58
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.58
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.57
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 99.56
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.54
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 99.54
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.54
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 99.51
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.51
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 99.49
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.49
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.48
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 99.46
2eyu_A 261 Twitching motility protein PILT; pilus retraction 99.46
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 99.44
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.44
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 99.43
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.43
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.42
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 99.42
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.41
4gp7_A 171 Metallophosphoesterase; polynucleotide kinase phos 99.39
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.38
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.37
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.37
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.36
2og2_A 359 Putative signal recognition particle receptor; nuc 99.35
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.34
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.31
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 99.3
1p9r_A 418 General secretion pathway protein E; bacterial typ 99.29
1qhl_A 227 Protein (cell division protein MUKB); SMC, chromos 99.28
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.27
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 99.26
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 99.25
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.23
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 99.23
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 99.2
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 99.19
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.19
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 99.18
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.17
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 99.17
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 99.17
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 99.17
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.16
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.15
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.15
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 99.13
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.12
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 99.12
4a74_A 231 DNA repair and recombination protein RADA; hydrola 99.12
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.11
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 99.09
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.09
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.08
2ewv_A 372 Twitching motility protein PILT; pilus retraction 99.07
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.07
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 99.07
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.04
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.04
3kta_A 182 Chromosome segregation protein SMC; structural mai 99.03
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.02
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.01
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 99.0
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.0
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 98.99
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 98.96
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.92
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.92
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 98.9
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 98.9
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 98.89
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 98.88
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 98.88
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 98.87
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.87
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.87
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 98.86
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 98.86
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 98.86
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.86
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.86
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.86
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.85
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.85
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 98.84
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.84
2f1r_A 171 Molybdopterin-guanine dinucleotide biosynthesis pr 98.83
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 98.81
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 98.8
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 98.8
1kgd_A 180 CASK, peripheral plasma membrane CASK; maguk, guan 98.8
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 98.79
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 98.79
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.79
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 98.78
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 98.77
1ye8_A 178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.77
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.74
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.74
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 98.73
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 98.72
1e69_A 322 Chromosome segregation SMC protein; structural mai 98.72
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 98.71
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.66
1knq_A 175 Gluconate kinase; ALFA/beta structure, transferase 98.64
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.63
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.62
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.61
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 98.6
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.58
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 98.56
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 98.56
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 98.54
2cvh_A 220 DNA repair and recombination protein RADB; filamen 98.51
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 98.47
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.46
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 98.46
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 98.43
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 98.39
2f9l_A 199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.39
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 98.38
2pez_A 179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.38
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 98.38
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 98.37
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 98.36
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 98.36
1kag_A 173 SKI, shikimate kinase I; transferase, structural g 98.35
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 98.33
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.33
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 98.31
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 98.3
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 98.29
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.27
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 98.26
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.26
3ice_A 422 Transcription termination factor RHO; transcriptio 98.18
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 98.12
2yvu_A 186 Probable adenylyl-sulfate kinase; transferase, str 98.11
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 98.04
3qks_A 203 DNA double-strand break repair RAD50 ATPase; RECA- 98.03
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.02
1y63_A 184 LMAJ004144AAA protein; structural genomics, protei 98.02
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 98.01
1f6b_A 198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.01
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.98
1m2o_B 190 GTP-binding protein SAR1, GTP binding protein; zin 97.96
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 97.96
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.95
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 97.94
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 97.93
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 97.92
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.91
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 97.9
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 97.9
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 97.89
2gj8_A 172 MNME, tRNA modification GTPase TRME; G-domain dime 97.88
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 97.86
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.85
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 97.84
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.82
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 97.82
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 97.81
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 97.8
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 97.78
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.77
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.76
2zej_A 184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.74
2r6a_A 454 DNAB helicase, replicative helicase; replication, 97.73
2wji_A 165 Ferrous iron transport protein B homolog; membrane 97.69
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.69
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 97.67
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.66
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 97.66
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 97.65
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.65
3kb2_A 173 SPBC2 prophage-derived uncharacterized protein YOR 97.57
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 97.56
1np6_A 174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.55
3lw7_A 179 Adenylate kinase related protein (ADKA-like); AMP, 97.52
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 97.51
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 97.49
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 97.49
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 97.48
1qhx_A 178 CPT, protein (chloramphenicol phosphotransferase); 97.47
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 97.44
3iij_A 180 Coilin-interacting nuclear ATPase protein; alpha a 97.43
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.43
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 97.42
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 97.41
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.38
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 97.35
1via_A 175 Shikimate kinase; structural genomics, transferase 97.35
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.35
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.33
1ly1_A 181 Polynucleotide kinase; PNK, phosphatase, transfera 97.32
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 97.32
1ex7_A 186 Guanylate kinase; substrate-induced FIT, domain mo 97.32
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.32
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.31
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.31
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.3
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 97.29
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.29
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 97.27
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 97.26
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 97.24
2vli_A 183 Antibiotic resistance protein; transferase, tunica 97.24
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.18
3llm_A 235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.17
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 97.16
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 97.15
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 97.14
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.12
3q72_A 166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 97.11
3ihw_A 184 Centg3; RAS, centaurin, GTPase, structural genomic 97.11
1xjc_A 169 MOBB protein homolog; structural genomics, midwest 97.1
2ged_A193 SR-beta, signal recognition particle receptor beta 97.09
2fu5_C 183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 97.09
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.09
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.08
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.08
1moz_A 183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 97.07
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 97.07
1fzq_A 181 ADP-ribosylation factor-like protein 3; protein-GD 97.07
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 97.07
3bos_A 242 Putative DNA replication factor; P-loop containing 97.05
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 97.04
3tw8_B 181 RAS-related protein RAB-35; longin domain, RAB GTP 97.04
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.03
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.02
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.02
2z43_A 324 DNA repair and recombination protein RADA; archaea 97.01
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 97.01
1e6c_A 173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.01
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.01
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 97.01
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 97.01
2nzj_A 175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 97.01
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 97.01
2yc2_C 208 IFT27, small RAB-related GTPase; transport protein 97.0
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.0
1z2a_A 168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.0
2ce2_X 166 GTPase HRAS; signaling protein, guanine nucleotide 96.99
2erx_A 172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 96.99
3pqc_A 195 Probable GTP-binding protein ENGB; rossmann fold, 96.98
1svi_A 195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 96.98
2pt5_A 168 Shikimate kinase, SK; aromatic amino acid biosynth 96.98
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.96
3q85_A 169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 96.96
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 96.96
1kao_A 167 RAP2A; GTP-binding protein, small G protein, GDP, 96.94
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 96.94
2dyk_A 161 GTP-binding protein; GTPase, ribosome-binding prot 96.94
1u8z_A 168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 96.94
1zuh_A 168 Shikimate kinase; alpha-beta protein, transferase; 96.94
2lkc_A 178 Translation initiation factor IF-2; NMR {Geobacill 96.93
3cbq_A 195 GTP-binding protein REM 2; FLJ38964A, structural g 96.93
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 96.93
1z08_A 170 RAS-related protein RAB-21; RAB GTPase, vesicular 96.93
2cxx_A 190 Probable GTP-binding protein ENGB; structural geno 96.92
1z0j_A 170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.92
1ky3_A 182 GTP-binding protein YPT7P; vesicular traffic, GTP 96.92
1g16_A 170 RAS-related protein SEC4; G protein RAB, signaling 96.91
2fn4_A 181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 96.91
1c1y_A 167 RAS-related protein RAP-1A; GTP-binding proteins, 96.9
3l0i_B 199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 96.89
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 96.89
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.89
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 96.89
1ek0_A 170 Protein (GTP-binding protein YPT51); vesicular tra 96.88
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.88
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 96.87
1wms_A 177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 96.87
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 96.87
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.87
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 96.86
1ko7_A 314 HPR kinase/phosphatase; protein kinase, phosphotra 96.85
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.85
4dsu_A 189 GTPase KRAS, isoform 2B; small G-protein, signalin 96.84
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 96.84
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.84
1r2q_A 170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 96.84
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.83
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 96.83
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.82
2oil_A 193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 96.82
2hxs_A 178 RAB-26, RAS-related protein RAB-28; GTPase, signal 96.82
2h57_A 190 ADP-ribosylation factor-like protein 6; GTP, GTPas 96.81
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 96.8
1upt_A 171 ARL1, ADP-ribosylation factor-like protein 1; hydr 96.79
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 96.77
2a9k_A 187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 96.77
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 96.77
2y8e_A 179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 96.77
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 96.76
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 96.76
3con_A 190 GTPase NRAS; structural genomics consortium, SGC, 96.76
1z0f_A 179 RAB14, member RAS oncogene family; RAB GTPase, ves 96.76
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 96.76
1r8s_A 164 ADP-ribosylation factor 1; protein transport/excha 96.75
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.75
2g6b_A 180 RAS-related protein RAB-26; G-protein, GTP analogu 96.75
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 96.73
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 96.73
1nrj_B 218 SR-beta, signal recognition particle receptor beta 96.73
1ksh_A 186 ARF-like protein 2; small GTPase, small GTP-bindin 96.72
4bas_A 199 ADP-ribosylation factor, putative (small GTPase, p 96.71
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 96.7
2bme_A 186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 96.7
2efe_B 181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 96.7
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 96.7
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.69
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 96.69
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 96.68
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 96.68
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 96.68
2il1_A 192 RAB12; G-protein, GDP, GTPase, predicted, structur 96.68
1m7b_A 184 RND3/RHOE small GTP-binding protein; small GTPase, 96.68
1jbk_A 195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.67
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 95.7
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.67
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 96.67
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 96.66
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 96.66
2fg5_A 192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 96.65
3kkq_A 183 RAS-related protein M-RAS; GTP-binding, GTPase, si 96.64
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 96.64
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 96.64
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 96.64
2gf9_A 189 RAS-related protein RAB-3D; G-protein, structural 96.63
1mh1_A 186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 96.63
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 96.63
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 96.62
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.62
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 96.61
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 96.61
3t5g_A 181 GTP-binding protein RHEB; immunoglobulin-like beta 96.61
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 96.61
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 96.61
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 96.6
3dz8_A 191 RAS-related protein RAB-3B; GDP, GTPase, structura 96.6
1zj6_A 187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 96.6
2h17_A 181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 96.6
3llu_A 196 RAS-related GTP-binding protein C; structural geno 96.6
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.59
1z06_A 189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 96.58
2o52_A 200 RAS-related protein RAB-4B; G-protein, GDP, struct 96.57
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.57
2a5j_A 191 RAS-related protein RAB-2B; GTPase, signal transdu 96.56
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 96.56
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 96.56
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 96.55
1u94_A 356 RECA protein, recombinase A; homologous recombinat 96.55
1x3s_A 195 RAS-related protein RAB-18; GTPase, GNP, structura 96.55
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 96.55
2cjw_A 192 GTP-binding protein GEM; nucleotide-binding, small 96.55
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 96.54
2ew1_A 201 RAS-related protein RAB-30; G-protein, GTP analogu 96.54
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 96.53
3reg_A 194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 96.53
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 96.51
2atv_A 196 RERG, RAS-like estrogen-regulated growth inhibitor 96.51
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 96.51
2p5s_A 199 RAS and EF-hand domain containing; G-protein, RAB, 96.5
2x77_A 189 ADP-ribosylation factor; GTP-binding protein, smal 96.5
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 96.49
1zd9_A 188 ADP-ribosylation factor-like 10B; transport protei 96.49
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 96.49
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 96.49
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 96.48
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 96.48
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 96.47
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 96.47
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 96.46
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 96.45
2fh5_B 214 SR-beta, signal recognition particle receptor beta 96.45
2h92_A 219 Cytidylate kinase; rossmann fold, transferase; HET 96.44
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.44
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.42
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 96.41
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.41
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.4
4tmk_A 213 Protein (thymidylate kinase); ATP:DTMP phosphotran 96.4
3c5c_A 187 RAS-like protein 12; GDP, GTPase, structural genom 96.4
2gco_A 201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 96.4
2iwr_A 178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 96.4
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 96.36
2atx_A 194 Small GTP binding protein TC10; GTPase, P-loop, al 96.35
2hf9_A 226 Probable hydrogenase nickel incorporation protein 96.33
3tmk_A 216 Thymidylate kinase; phosphotransferase; HET: T5A; 96.3
3ld9_A 223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 96.28
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.28
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.24
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.23
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 96.22
3pvs_A 447 Replication-associated recombination protein A; ma 96.2
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 96.19
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 96.19
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 96.19
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 96.17
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.17
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 96.14
4hlc_A 205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 96.12
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.12
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.11
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 96.09
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 96.09
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 96.04
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 96.01
2orw_A 184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.01
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 95.97
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.96
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 95.95
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 95.93
1xp8_A 366 RECA protein, recombinase A; recombination, radior 95.92
1lnz_A 342 SPO0B-associated GTP-binding protein; GTPase, OBG, 95.92
2r44_A 331 Uncharacterized protein; putative ATPase, structur 95.92
2chg_A 226 Replication factor C small subunit; DNA-binding pr 95.89
3co5_A143 Putative two-component system transcriptional RES 95.89
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 95.88
1wxq_A 397 GTP-binding protein; structural genomics, riken st 95.87
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 95.79
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.76
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 95.74
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.73
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 95.71
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 95.68
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 95.67
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 95.6
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 95.59
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 95.57
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 95.57
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.56
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.55
2qgz_A 308 Helicase loader, putative primosome component; str 95.53
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 95.51
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 95.47
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 95.41
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.4
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 95.39
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 95.39
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.38
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 95.36
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 95.36
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 95.35
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 95.34
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 95.34
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 95.33
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 95.31
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
Probab=99.86  E-value=1.1e-23  Score=142.78  Aligned_cols=68  Identities=24%  Similarity=0.551  Sum_probs=63.5

Q ss_pred             hhhccccccCCCCCccccceeeeeeccceeeeeecccCCCceeEeeeeeceeecCCCceeeeeccccc
Q psy7220           7 QTVDSHLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRD   74 (80)
Q Consensus         7 ~~~~~~~~~~~~~~~~vl~~isl~i~~g~~~~iiG~nGsGKsTll~~l~gl~~~~~G~i~~~~~~i~~   74 (80)
                      ..++++++++.|+++++|+++||+|++||+++|+||||||||||+++|+|+++|++|+|.++|+++..
T Consensus        10 ~~l~~~~l~~~~~~~~vL~~vsl~i~~Ge~~~liG~nGsGKSTLl~~l~Gl~~p~~G~I~~~g~~~~~   77 (266)
T 4g1u_C           10 ALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGPNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNS   77 (266)
T ss_dssp             CEEEEEEEEEEETTEEEEEEEEEEEETTCEEEEECCTTSCHHHHHHHHTSSSCCSSCEEEETTEETTT
T ss_pred             ceEEEEeEEEEeCCeeEEEeeEEEEcCCCEEEEECCCCCcHHHHHHHHhcCCCCCCcEEEECCEECCc
Confidence            35788889999999999999999999999999999999999999999999999999999999987653



>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 80
d1vpla_ 238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 2e-18
d1g6ha_ 254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-16
d1sgwa_ 200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 1e-15
d1b0ua_ 258 c.37.1.12 (A:) ATP-binding subunit of the histidin 7e-15
d1ji0a_ 240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-14
d1oxxk2 242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-14
d1v43a3 239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-14
d1l7vc_ 231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-13
d1mv5a_ 242 c.37.1.12 (A:) Multidrug resistance ABC transporte 1e-13
d2awna2 232 c.37.1.12 (A:4-235) Maltose transport protein MalK 2e-13
d1g2912 240 c.37.1.12 (1:1-240) Maltose transport protein MalK 3e-13
d1r0wa_ 281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 9e-13
d3d31a2 229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-12
d2hyda1 255 c.37.1.12 (A:324-578) Putative multidrug export AT 3e-12
d3dhwc1 240 c.37.1.12 (C:1-240) Methionine import ATP-binding 3e-12
d1l2ta_ 230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-11
d3b60a1 253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 3e-11
d2pmka1 241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 9e-11
d1jj7a_ 251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 1e-10
d2onka1 240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 1e-10
d1ye8a1 178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 6e-07
d1ni3a1 296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 2e-04
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter TM0544
species: Thermotoga maritima [TaxId: 2336]
 Score = 73.5 bits (180), Expect = 2e-18
 Identities = 26/63 (41%), Positives = 37/63 (58%)

Query: 18 YDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRDSMD 77
             K  +  ISF +  GE FGL+G NGAGKTTT ++++  IKP+SG   V   ++ +   
Sbjct: 12 IGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPH 71

Query: 78 LVR 80
           VR
Sbjct: 72 EVR 74


>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 99.89
d2awna2 232 Maltose transport protein MalK, N-terminal domain 99.89
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 99.88
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 99.87
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 99.87
d1g2912 240 Maltose transport protein MalK, N-terminal domain 99.87
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.87
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 99.87
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 99.87
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.86
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 99.86
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 99.86
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 99.85
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.85
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 99.85
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 99.84
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 99.83
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 99.75
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 99.75
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 99.71
d1ye8a1 178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.01
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.46
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.36
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 98.32
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.11
d1np6a_ 170 Molybdopterin-guanine dinucleotide biosynthesis pr 98.04
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 98.02
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.01
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 97.96
d1znwa1 182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.95
d1zp6a1 176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.88
d1knqa_ 171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.88
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.87
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.87
d1xjca_ 165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.78
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 97.78
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.75
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.74
d1svia_ 195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.72
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.7
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.66
d1kaga_ 169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.66
d1qhxa_ 178 Chloramphenicol phosphotransferase {Streptomyces v 97.63
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.62
d1rkba_ 173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.6
d1ly1a_ 152 Polynucleotide kinase, kinase domain {Bacteriophag 97.59
d2bdta1 176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.58
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.57
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.52
d1lnza2 185 Obg GTP-binding protein middle domain {Bacillus su 97.52
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.48
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.45
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 97.45
d1f6ba_ 186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.45
d2cxxa1 184 GTP-binding protein engB {Pyrococcus horikoshii [T 97.41
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.4
d1mkya1 171 Probable GTPase Der, N-terminal and middle domains 97.4
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.4
d1puia_ 188 Probable GTPase EngB {Escherichia coli [TaxId: 562 97.39
d1egaa1 179 GTPase Era, N-terminal domain {Escherichia coli [T 97.38
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.35
d1udxa2 180 Obg GTP-binding protein middle domain {Thermus the 97.33
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.33
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.3
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.3
d2qtvb1 166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.29
d1wf3a1 178 GTPase Era, N-terminal domain {Thermus thermophilu 97.29
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 97.28
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 97.28
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.28
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 97.27
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.27
d1kgda_ 178 Guanylate kinase-like domain of Cask {Human (Homo 97.26
d1upta_ 169 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.26
d2gj8a1 161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.25
d2qy9a2 211 GTPase domain of the signal recognition particle r 97.25
d1r8sa_ 160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.25
d1okkd2 207 GTPase domain of the signal recognition particle r 97.25
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 97.23
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 97.23
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.22
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 97.21
d1viaa_ 161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.2
d1vmaa2 213 GTPase domain of the signal recognition particle r 97.19
d1yj5a2 172 5' polynucleotide kinase-3' phosphatase, C-termina 97.18
d1e6ca_ 170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.18
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.15
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 97.14
d1j8yf2 211 GTPase domain of the signal sequence recognition p 97.12
d2iyva1 165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.11
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.1
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.1
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 97.09
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 97.09
d1ksha_ 165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.08
d1zina1 182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.08
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 97.04
d1s3ga1 182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.03
d1xzpa2 160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 97.03
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.02
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 97.0
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.99
d1ls1a2 207 GTPase domain of the signal sequence recognition p 96.98
d1e4va1 179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.94
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.93
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 96.92
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 96.92
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.92
d1zj6a1 177 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.91
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.91
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 96.9
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 96.89
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.87
d2cdna1 181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.86
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 96.85
d1wb1a4 179 Elongation factor SelB, N-terminal domain {Methano 96.83
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 96.82
d2fh5b1 207 Signal recognition particle receptor beta-subunit 96.8
d1akya1 180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.79
d2fu5c1 173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 96.78
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.76
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.76
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 96.76
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 96.74
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 96.74
d1zd9a1 164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.73
d1fzqa_ 176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.7
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.68
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 96.66
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 96.65
d1ky3a_ 175 Rab-related protein ypt7p {Baker's yeast (Saccharo 96.64
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.64
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 96.63
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 96.63
d3raba_ 169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.62
d1moza_ 182 ADP-ribosylation factor {Baker's yeast (Saccharomy 96.62
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.62
d1ctqa_ 166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 96.59
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 96.57
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.54
d2f9la1 175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 96.51
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.47
d1z2aa1 164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.44
d1g16a_ 166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.44
d2erxa1 171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.42
d2f7sa1 186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 96.42
d1xtqa1 167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 96.41
d2a5ja1 173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 96.39
d2gjsa1 168 Rad {Human (Homo sapiens) [TaxId: 9606]} 96.38
d2erya1 171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.38
d1i2ma_ 170 Ran {Human (Homo sapiens) [TaxId: 9606]} 96.37
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.37
d2ew1a1 171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.36
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.34
d1yzqa1 164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 96.31
d1kaoa_ 167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.3
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 96.3
d1e0sa_ 173 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.29
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 96.29
d1kmqa_ 177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 96.25
d1z0fa1 166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.23
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 96.22
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.21
d1z0ja1 167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.21
d1z08a1 167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.19
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 96.18
d1z06a1 165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 96.17
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 96.17
d2g3ya1 172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 96.16
d1svsa1 195 Transducin (alpha subunit) {Rat (Rattus norvegicus 96.16
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 96.11
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 96.1
d1x3sa1 177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 96.1
d1wmsa_ 174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 96.1
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.03
d2fn4a1 173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 96.03
d2bmea1 174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.03
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.03
d1ek0a_ 170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 96.01
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.99
d1r2qa_ 170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.97
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 95.96
d2atva1 168 Ras-like estrogen-regulated growth inhibitor, RERG 95.96
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.94
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 95.93
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 95.89
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 95.88
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.87
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 95.86
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 95.85
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 95.81
d1c1ya_ 167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.8
d1m7ba_ 179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 95.77
d1x1ra1 169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 95.76
d2g6ba1 170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.75
d1xpua3 289 Transcription termination factor Rho, ATPase domai 95.74
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 95.74
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.72
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 95.71
d1knxa2 177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.7
d1u8za_ 168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.69
d1mh1a_ 183 Rac {Human (Homo sapiens) [TaxId: 9606]} 95.65
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.57
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 95.57
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 95.54
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.53
d2bmja1 175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.49
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 95.48
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 95.4
d1kk1a3 195 Initiation factor eIF2 gamma subunit, N-terminal ( 95.36
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 95.31
d2bcjq2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.3
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 95.21
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 95.19
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 95.1
d1kkma_ 176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.01
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.0
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.91
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 94.6
d1ko7a2 169 HPr kinase HprK C-terminal domain {Staphylococcus 94.58
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 94.58
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 94.55
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.48
d2c78a3 204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 94.37
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.31
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 94.21
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 94.17
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 93.99
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 93.98
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 93.94
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 93.92
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 93.81
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 93.75
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.73
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 93.49
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 93.38
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 93.37
d2qn6a3 205 Initiation factor eIF2 gamma subunit, N-terminal ( 93.17
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 92.97
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 92.67
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 92.28
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 92.16
d1jnya3 224 Elongation factor eEF-1alpha, N-terminal (G) domai 92.15
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.82
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 91.79
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 91.79
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 91.61
d1jbka_ 195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 91.27
d1d2ea3 196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 90.71
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 89.99
d1tuea_ 205 Replication protein E1 helicase domain {Human papi 89.75
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 89.68
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 89.53
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 89.01
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 88.64
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 88.58
d1r5ba3 245 Eukaryotic peptide chain release factor ERF2, G do 88.55
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 88.26
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 88.08
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.77
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 87.73
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 87.7
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 87.34
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 86.91
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 85.89
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 85.06
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 83.93
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 83.27
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 80.63
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 80.48
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=99.89  E-value=1.1e-25  Score=149.97  Aligned_cols=68  Identities=32%  Similarity=0.487  Sum_probs=64.3

Q ss_pred             hhhccccccCCCCCccccceeeeeeccceeeeeecccCCCceeEeeeeeceeecCCCceeeeeccccc
Q psy7220           7 QTVDSHLETFPYDTKPAVNQISFGVGRGECFGLLGLNGAGKTTTFKMLTGAIKPTSGNAYVMNHSIRD   74 (80)
Q Consensus         7 ~~~~~~~~~~~~~~~~vl~~isl~i~~g~~~~iiG~nGsGKsTll~~l~gl~~~~~G~i~~~~~~i~~   74 (80)
                      .+++++++++.|++..+|+++||+|++||+++|+||||||||||+++|+|+++|++|+|+++|+++..
T Consensus         5 ~~I~v~nlsk~yg~~~al~~vsl~v~~Ge~~~liGpsGaGKSTLl~~i~Gl~~p~sG~I~i~g~~i~~   72 (239)
T d1v43a3           5 VEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTY   72 (239)
T ss_dssp             CCEEEEEEEEEETTEEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECTT
T ss_pred             CeEEEEEEEEEECCEEEEcceeEEECCCCEEEEECCCCChHHHHHHHHHcCCCCCCCEEEEcceeccc
Confidence            34788899999999999999999999999999999999999999999999999999999999998764



>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure