Psyllid ID: psy7339

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPGERLDHYARTTEQVKNRVLLNHPVFVLQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASELLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGILRDGHATTQTTRV
ccccHHHHHHHHHHHHHHHHcccccccccccccccEEcccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHcccccEEEEEEccccccEEEEEEEcccccHHHHHHccHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccc
cccHHHHHHHHHHHHHHHHHccccccHccccccEcHEEEEccccHHHHcccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHHcccccccEEHHHHcHHHHHHHHccHHHHHHHcHHHccccEEEEEEEEEcccEEEEEEEEccccccccccEEcccccccEEEHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccc
MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHiytrigfndsiecnASTFALEMKEIAHIIQFLTPRSLILVDELCragiepppsclpgerldhyARTTEQVKNRVLLNHPVFvlqatfhtpftlrgmtpegcssvlfprifgnSVASELLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGIlrdghattqttrv
MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIepppsclpgerLDHYARTTEQVKNRVLLNHPVFVLQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASELLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGIlrdghattqttrv
MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPGERLDHYARTTEQVKNRVLLNHPVFVLQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASELLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGILRDGHATTQTTRV
*****VYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPGERLDHYARTTEQVKNRVLLNHPVFVLQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASELLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGILRD**********
*SGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPGERLDHYARTTEQVKNRVLLNHPVFVLQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASELLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVS**********************
MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPGERLDHYARTTEQVKNRVLLNHPVFVLQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASELLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGILRDGH********
***KSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPGERLDHYARTTEQVKNRVLLNHPVFVLQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASELLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGILRD**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPGERLDHYARTTEQVKNRVLLNHPVFVLQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASELLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGILRDGHATTQTTRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query223 2.2.26 [Sep-21-2011]
Q99MT2958 MutS protein homolog 4 OS yes N/A 0.367 0.085 0.609 2e-22
O15457936 MutS protein homolog 4 OS yes N/A 0.367 0.087 0.597 3e-22
F4JP48792 DNA mismatch repair prote yes N/A 0.367 0.103 0.573 8e-21
Q6CSR11029 DNA mismatch repair prote yes N/A 0.367 0.079 0.548 6e-20
Q24X61862 DNA mismatch repair prote yes N/A 0.367 0.095 0.512 8e-20
Q759V41032 DNA mismatch repair prote yes N/A 0.367 0.079 0.560 4e-19
Q97I19869 DNA mismatch repair prote yes N/A 0.367 0.094 0.512 5e-19
A4XL47863 DNA mismatch repair prote yes N/A 0.367 0.095 0.512 6e-19
B9MJU0863 DNA mismatch repair prote yes N/A 0.367 0.095 0.512 1e-18
Q8RA71869 DNA mismatch repair prote yes N/A 0.367 0.094 0.512 1e-18
>sp|Q99MT2|MSH4_MOUSE MutS protein homolog 4 OS=Mus musculus GN=Msh4 PE=2 SV=1 Back     alignment and function desciption
 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/82 (60%), Positives = 61/82 (74%)

Query: 1   MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKE 60
           MSGKS Y+KQ+AL QIMAQ+G YVPA  A FR+A  I+TRI  +D IE N+STF  EMKE
Sbjct: 705 MSGKSTYLKQIALCQIMAQIGSYVPAEYASFRIAAQIFTRISTDDDIETNSSTFMKEMKE 764

Query: 61  IAHIIQFLTPRSLILVDELCRA 82
           IA+I+     +SLIL+DEL R 
Sbjct: 765 IAYILHNANDKSLILIDELGRG 786
Involved in meiotic recombination. Required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis.
Mus musculus (taxid: 10090)
>sp|O15457|MSH4_HUMAN MutS protein homolog 4 OS=Homo sapiens GN=MSH4 PE=1 SV=2 Back     alignment and function description
>sp|F4JP48|MSH4_ARATH DNA mismatch repair protein MSH4 OS=Arabidopsis thaliana GN=MSH4 PE=2 SV=1 Back     alignment and function description
>sp|Q6CSR1|MSH3_KLULA DNA mismatch repair protein MSH3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MSH3 PE=3 SV=1 Back     alignment and function description
>sp|Q24X61|MUTS_DESHY DNA mismatch repair protein MutS OS=Desulfitobacterium hafniense (strain Y51) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|Q759V4|MSH3_ASHGO DNA mismatch repair protein MSH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MSH3 PE=3 SV=1 Back     alignment and function description
>sp|Q97I19|MUTS_CLOAB DNA mismatch repair protein MutS OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|A4XL47|MUTS_CALS8 DNA mismatch repair protein MutS OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|B9MJU0|MUTS_CALBD DNA mismatch repair protein MutS OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=mutS PE=3 SV=1 Back     alignment and function description
>sp|Q8RA71|MUTS_THETN DNA mismatch repair protein MutS OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mutS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
156367371 916 predicted protein [Nematostella vectensi 0.367 0.089 0.670 4e-25
328714525 645 PREDICTED: mutS protein homolog 4-like [ 0.408 0.141 0.583 1e-24
47230170 836 unnamed protein product [Tetraodon nigro 0.367 0.098 0.621 6e-23
410898419 807 PREDICTED: mutS protein homolog 4-like [ 0.367 0.101 0.634 8e-23
350412728 1112 PREDICTED: mutS protein homolog 4-like [ 0.367 0.073 0.609 8e-23
340720522 1076 PREDICTED: mutS protein homolog 4-like [ 0.367 0.076 0.609 9e-23
390337892 911 PREDICTED: mutS protein homolog 4 [Stron 0.367 0.090 0.597 1e-22
405950552 995 MutS-like protein 4 [Crassostrea gigas] 0.367 0.082 0.585 1e-22
363736703 883 PREDICTED: mutS protein homolog 4 [Gallu 0.367 0.092 0.634 2e-22
198413599 377 PREDICTED: similar to predicted protein, 0.367 0.217 0.597 3e-22
>gi|156367371|ref|XP_001627391.1| predicted protein [Nematostella vectensis] gi|156214299|gb|EDO35291.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (81%)

Query: 1   MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKE 60
           MSGKS Y+KQ+ALLQ+MAQ+GCYVPA  A FRLAD I++RIG +D IE N+STF LEMKE
Sbjct: 634 MSGKSTYLKQIALLQVMAQIGCYVPAEYASFRLADQIFSRIGSDDDIETNSSTFMLEMKE 693

Query: 61  IAHIIQFLTPRSLILVDELCRA 82
           I +IIQ  + +SLI+VDEL R 
Sbjct: 694 INYIIQNASDKSLIIVDELGRG 715

Source: Nematostella vectensis

Species: Nematostella vectensis

Genus: Nematostella

Family: Edwardsiidae

Order: Actiniaria

Class: Anthozoa

Phylum: Cnidaria

Superkingdom: Eukaryota
>gi|328714525|ref|XP_001943834.2| PREDICTED: mutS protein homolog 4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|47230170|emb|CAG10584.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|410898419|ref|XP_003962695.1| PREDICTED: mutS protein homolog 4-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|350412728|ref|XP_003489742.1| PREDICTED: mutS protein homolog 4-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340720522|ref|XP_003398685.1| PREDICTED: mutS protein homolog 4-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|390337892|ref|XP_780878.3| PREDICTED: mutS protein homolog 4 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|405950552|gb|EKC18533.1| MutS-like protein 4 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|363736703|ref|XP_422549.3| PREDICTED: mutS protein homolog 4 [Gallus gallus] Back     alignment and taxonomy information
>gi|198413599|ref|XP_002122852.1| PREDICTED: similar to predicted protein, partial [Ciona intestinalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query223
UNIPROTKB|F1P4E2846 MSH4 "Uncharacterized protein" 0.363 0.095 0.641 3.1e-21
UNIPROTKB|I3L5Z8902 MSH4 "Uncharacterized protein" 0.363 0.089 0.604 8.4e-20
UNIPROTKB|F1P6X2798 MSH4 "Uncharacterized protein" 0.363 0.101 0.604 8.8e-20
UNIPROTKB|F1S9R2934 MSH4 "Uncharacterized protein" 0.363 0.086 0.604 8.9e-20
UNIPROTKB|E1BK76855 MSH4 "Uncharacterized protein" 0.363 0.094 0.592 9.9e-20
UNIPROTKB|E2RJA9930 MSH4 "Uncharacterized protein" 0.363 0.087 0.604 1.1e-19
MGI|MGI:1860077958 Msh4 "mutS homolog 4 (E. coli) 0.363 0.084 0.617 1.2e-19
UNIPROTKB|O15457936 MSH4 "MutS protein homolog 4" 0.363 0.086 0.604 1.9e-19
TAIR|locus:2130913792 MSH4 "AT4G17380" [Arabidopsis 0.367 0.103 0.573 6.2e-19
RGD|1309190958 Msh4 "mutS homolog 4 (E. coli) 0.363 0.084 0.592 8.5e-19
UNIPROTKB|F1P4E2 MSH4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 260 (96.6 bits), Expect = 3.1e-21, P = 3.1e-21
 Identities = 52/81 (64%), Positives = 62/81 (76%)

Query:     1 MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKE 60
             MSGKS YIKQ+AL QIMAQ+G YVPA    FR+A+ I+TRIG +D IE NASTF  EMKE
Sbjct:   596 MSGKSTYIKQIALCQIMAQIGSYVPAEYCSFRIAEQIFTRIGMDDDIETNASTFMKEMKE 655

Query:    61 IAHIIQFLTPRSLILVDELCR 81
             I +IIQ    +SLI++DEL R
Sbjct:   656 ITYIIQNANDKSLIIIDELGR 676
GO:0006298 "mismatch repair" evidence=IEA
GO:0030983 "mismatched DNA binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0000795 "synaptonemal complex" evidence=IEA
GO:0001541 "ovarian follicle development" evidence=IEA
GO:0007129 "synapsis" evidence=IEA
GO:0007283 "spermatogenesis" evidence=IEA
GO:0007292 "female gamete generation" evidence=IEA
UNIPROTKB|I3L5Z8 MSH4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6X2 MSH4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S9R2 MSH4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BK76 MSH4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJA9 MSH4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1860077 Msh4 "mutS homolog 4 (E. coli)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O15457 MSH4 "MutS protein homolog 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2130913 MSH4 "AT4G17380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1309190 Msh4 "mutS homolog 4 (E. coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
pfam00488235 pfam00488, MutS_V, MutS domain V 3e-36
smart00534185 smart00534, MUTSac, ATPase domain of DNA mismatch 6e-36
cd03243202 cd03243, ABC_MutS_homologs, ATP-binding cassette d 4e-33
cd03282204 cd03282, ABC_MSH4_euk, ATP-binding cassette domain 7e-32
COG0249843 COG0249, MutS, Mismatch repair ATPase (MutS family 1e-30
cd03284216 cd03284, ABC_MutS1, ATP-binding cassette domain of 2e-29
cd03287222 cd03287, ABC_MSH3_euk, ATP-binding cassette domain 2e-28
PRK05399854 PRK05399, PRK05399, DNA mismatch repair protein Mu 8e-27
cd03281213 cd03281, ABC_MSH5_euk, ATP-binding cassette domain 9e-27
cd03286218 cd03286, ABC_MSH6_euk, ATP-binding cassette domain 5e-25
TIGR01070840 TIGR01070, mutS1, DNA mismatch repair protein MutS 2e-23
cd03285222 cd03285, ABC_MSH2_euk, ATP-binding cassette domain 1e-22
cd03280200 cd03280, ABC_MutS2, ATP-binding cassette domain of 1e-18
TIGR01069 771 TIGR01069, mutS2, MutS2 family protein 4e-16
cd06558195 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme 5e-15
COG1193 753 COG1193, COG1193, Mismatch repair ATPase (MutS fam 1e-13
PRK00409 782 PRK00409, PRK00409, recombination and DNA strand e 2e-13
pfam00378245 pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami 1e-11
cd03283199 cd03283, ABC_MutS-like, ATP-binding cassette domai 2e-11
COG1024257 COG1024, CaiD, Enoyl-CoA hydratase/carnithine race 3e-11
PRK06688259 PRK06688, PRK06688, enoyl-CoA hydratase; Provision 2e-10
PRK08260296 PRK08260, PRK08260, enoyl-CoA hydratase; Provision 3e-10
PRK06210272 PRK06210, PRK06210, enoyl-CoA hydratase; Provision 2e-08
PRK08258277 PRK08258, PRK08258, enoyl-CoA hydratase; Provision 2e-08
PRK09245266 PRK09245, PRK09245, enoyl-CoA hydratase; Provision 3e-08
PRK06023251 PRK06023, PRK06023, enoyl-CoA hydratase; Provision 6e-07
PLN02600251 PLN02600, PLN02600, enoyl-CoA hydratase 3e-06
PRK03580261 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr 3e-06
PRK05809260 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata 4e-06
PRK05981266 PRK05981, PRK05981, enoyl-CoA hydratase; Provision 4e-06
PRK08290288 PRK08290, PRK08290, enoyl-CoA hydratase; Provision 3e-05
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 5e-05
PRK07799263 PRK07799, PRK07799, enoyl-CoA hydratase; Provision 6e-05
PRK06142272 PRK06142, PRK06142, enoyl-CoA hydratase; Provision 1e-04
PRK07657260 PRK07657, PRK07657, enoyl-CoA hydratase; Provision 3e-04
PRK07260255 PRK07260, PRK07260, enoyl-CoA hydratase; Provision 9e-04
PRK06190258 PRK06190, PRK06190, enoyl-CoA hydratase; Provision 0.001
PRK06127269 PRK06127, PRK06127, enoyl-CoA hydratase; Provision 0.001
PRK08150255 PRK08150, PRK08150, enoyl-CoA hydratase; Provision 0.002
PRK05864276 PRK05864, PRK05864, enoyl-CoA hydratase; Provision 0.002
PRK08259254 PRK08259, PRK08259, enoyl-CoA hydratase; Provision 0.002
PRK05980260 PRK05980, PRK05980, enoyl-CoA hydratase; Provision 0.003
PRK11423261 PRK11423, PRK11423, methylmalonyl-CoA decarboxylas 0.003
TIGR02437 714 TIGR02437, FadB, fatty oxidation complex, alpha su 0.004
PLN02664275 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-d 0.004
PRK07658257 PRK07658, PRK07658, enoyl-CoA hydratase; Provision 0.004
>gnl|CDD|215944 pfam00488, MutS_V, MutS domain V Back     alignment and domain information 
 Score =  126 bits (320), Expect = 3e-36
 Identities = 40/81 (49%), Positives = 56/81 (69%)

Query: 1   MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKE 60
           M GKS Y++QVAL+ IMAQ+G +VPA  A   + D I+TRIG +D +    STF +EM E
Sbjct: 53  MGGKSTYLRQVALIVIMAQIGSFVPAESARIGIVDRIFTRIGASDDLASGRSTFMVEMLE 112

Query: 61  IAHIIQFLTPRSLILVDELCR 81
            A+I+   T +SL+++DEL R
Sbjct: 113 TANILHNATDKSLVILDELGR 133

This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam05190. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain V of Thermus aquaticus MutS as characterized in, which contains a Walker A motif, and is structurally similar to the ATPase domain of ABC transporters. Length = 235
>gnl|CDD|197777 smart00534, MUTSac, ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>gnl|CDD|213210 cd03243, ABC_MutS_homologs, ATP-binding cassette domain of MutS homologs Back     alignment and domain information
>gnl|CDD|213249 cd03282, ABC_MSH4_euk, ATP-binding cassette domain of eukaryotic MutS4 homolog Back     alignment and domain information
>gnl|CDD|223327 COG0249, MutS, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|213251 cd03284, ABC_MutS1, ATP-binding cassette domain of MutS1 homolog Back     alignment and domain information
>gnl|CDD|213254 cd03287, ABC_MSH3_euk, ATP-binding cassette domain of eukaryotic MutS3 homolog Back     alignment and domain information
>gnl|CDD|235444 PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>gnl|CDD|213248 cd03281, ABC_MSH5_euk, ATP-binding cassette domain of eukaryotic MutS5 homolog Back     alignment and domain information
>gnl|CDD|213253 cd03286, ABC_MSH6_euk, ATP-binding cassette domain of eukaryotic MutS6 homolog Back     alignment and domain information
>gnl|CDD|233259 TIGR01070, mutS1, DNA mismatch repair protein MutS Back     alignment and domain information
>gnl|CDD|213252 cd03285, ABC_MSH2_euk, ATP-binding cassette domain of eukaryotic MutS2 homolog Back     alignment and domain information
>gnl|CDD|213247 cd03280, ABC_MutS2, ATP-binding cassette domain of MutS2 Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>gnl|CDD|224114 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>gnl|CDD|213250 cd03283, ABC_MutS-like, ATP-binding cassette domain of MutS-like homolog Back     alignment and domain information
>gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236206 PRK08260, PRK08260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180472 PRK06210, PRK06210, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168351 PRK06023, PRK06023, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>gnl|CDD|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235714 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180910 PRK07260, PRK07260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181254 PRK08150, PRK08150, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168278 PRK05864, PRK05864, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236908 PRK11423, PRK11423, methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|178269 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 223
KOG1680|consensus290 100.0
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 100.0
PRK05980260 enoyl-CoA hydratase; Provisional 100.0
PLN02888265 enoyl-CoA hydratase 100.0
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 100.0
PRK06142272 enoyl-CoA hydratase; Provisional 100.0
PRK06190258 enoyl-CoA hydratase; Provisional 100.0
PRK06143256 enoyl-CoA hydratase; Provisional 100.0
PLN02600251 enoyl-CoA hydratase 100.0
PRK05862257 enoyl-CoA hydratase; Provisional 100.0
PRK06127269 enoyl-CoA hydratase; Provisional 100.0
PRK08140262 enoyl-CoA hydratase; Provisional 100.0
PRK08150255 enoyl-CoA hydratase; Provisional 100.0
PRK07327268 enoyl-CoA hydratase; Provisional 100.0
PRK06563255 enoyl-CoA hydratase; Provisional 100.0
PRK09245266 enoyl-CoA hydratase; Provisional 100.0
PRK06494259 enoyl-CoA hydratase; Provisional 100.0
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 100.0
PRK08138261 enoyl-CoA hydratase; Provisional 100.0
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 100.0
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 100.0
PRK08252254 enoyl-CoA hydratase; Provisional 100.0
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 100.0
PRK09076258 enoyl-CoA hydratase; Provisional 100.0
PRK07260255 enoyl-CoA hydratase; Provisional 100.0
PRK07658257 enoyl-CoA hydratase; Provisional 100.0
PRK05869222 enoyl-CoA hydratase; Validated 100.0
PRK07799263 enoyl-CoA hydratase; Provisional 100.0
PRK06023251 enoyl-CoA hydratase; Provisional 100.0
PRK07657260 enoyl-CoA hydratase; Provisional 100.0
PRK06144262 enoyl-CoA hydratase; Provisional 100.0
PRK08258277 enoyl-CoA hydratase; Provisional 100.0
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 100.0
PRK05870249 enoyl-CoA hydratase; Provisional 100.0
PRK07511260 enoyl-CoA hydratase; Provisional 100.0
PRK08139266 enoyl-CoA hydratase; Validated 100.0
PRK08259254 enoyl-CoA hydratase; Provisional 100.0
PRK05864276 enoyl-CoA hydratase; Provisional 100.0
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 100.0
PRK06688259 enoyl-CoA hydratase; Provisional 100.0
PRK05981266 enoyl-CoA hydratase; Provisional 100.0
PRK05995262 enoyl-CoA hydratase; Provisional 100.0
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PRK07659260 enoyl-CoA hydratase; Provisional 100.0
PRK08260296 enoyl-CoA hydratase; Provisional 100.0
PRK03580261 carnitinyl-CoA dehydratase; Provisional 100.0
PRK06210272 enoyl-CoA hydratase; Provisional 100.0
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 100.0
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 100.0
PRK07468262 enoyl-CoA hydratase; Provisional 100.0
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 100.0
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 100.0
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 100.0
PRK06495257 enoyl-CoA hydratase; Provisional 100.0
PRK07938249 enoyl-CoA hydratase; Provisional 100.0
PLN02921327 naphthoate synthase 100.0
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 100.0
PRK07509262 enoyl-CoA hydratase; Provisional 100.0
PRK07854243 enoyl-CoA hydratase; Provisional 100.0
PRK08290288 enoyl-CoA hydratase; Provisional 100.0
PRK08321302 naphthoate synthase; Validated 99.98
PRK06072248 enoyl-CoA hydratase; Provisional 99.98
PRK06213229 enoyl-CoA hydratase; Provisional 99.98
PRK08272302 enoyl-CoA hydratase; Provisional 99.98
PRK12478298 enoyl-CoA hydratase; Provisional 99.98
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 99.98
PRK07827260 enoyl-CoA hydratase; Provisional 99.98
PRK08788287 enoyl-CoA hydratase; Validated 99.98
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 99.97
PLN02874379 3-hydroxyisobutyryl-CoA hydrolase-like protein 99.97
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 99.97
PLN02267239 enoyl-CoA hydratase/isomerase family protein 99.97
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 99.97
KOG1681|consensus292 99.97
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 99.97
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 99.96
PRK11730 715 fadB multifunctional fatty acid oxidation complex 99.96
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 99.96
KOG1679|consensus291 99.96
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 99.96
KOG0016|consensus266 99.95
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 99.95
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 99.95
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 99.95
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 99.94
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 99.94
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 99.94
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.93
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 99.93
KOG1682|consensus287 99.89
COG0249843 MutS Mismatch repair ATPase (MutS family) [DNA rep 99.88
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 99.87
TIGR01070840 mutS1 DNA mismatch repair protein MutS. 99.83
KOG0220|consensus867 99.82
PRK05399854 DNA mismatch repair protein MutS; Provisional 99.8
KOG1684|consensus 401 99.79
KOG0218|consensus1070 99.79
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 99.77
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 99.72
KOG0219|consensus902 99.69
KOG0221|consensus849 99.66
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.65
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.64
KOG0217|consensus1125 99.62
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.62
PRK00409 782 recombination and DNA strand exchange inhibitor pr 99.59
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 99.59
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.56
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.38
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.35
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 99.32
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.25
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.21
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.07
COG1193 753 Mismatch repair ATPase (MutS family) [DNA replicat 98.94
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 98.59
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 98.48
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 98.39
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 98.31
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 98.28
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 98.01
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 97.76
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 97.74
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 97.56
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 97.4
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 97.06
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 96.62
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 96.34
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 96.07
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 96.06
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 96.05
PRK10949618 protease 4; Provisional 95.67
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 95.6
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 95.44
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 95.37
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 95.04
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 94.99
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 94.95
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 94.85
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 94.67
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 94.4
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 94.36
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 94.06
KOG1683|consensus380 93.85
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 93.77
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 93.54
PRK10949 618 protease 4; Provisional 93.0
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 92.77
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 92.62
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 92.46
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 91.39
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 90.06
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 88.82
PF00004132 AAA: ATPase family associated with various cellula 88.73
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 86.83
PRK09361225 radB DNA repair and recombination protein RadB; Pr 86.18
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 86.18
PRK11778330 putative inner membrane peptidase; Provisional 85.66
PF05729166 NACHT: NACHT domain 85.26
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 84.6
smart0025038 PLEC Plectin repeat. 84.0
cd01393226 recA_like RecA is a bacterial enzyme which has rol 83.99
smart00382148 AAA ATPases associated with a variety of cellular 83.95
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 83.85
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 83.72
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 83.56
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 83.37
COG2087175 CobU Adenosyl cobinamide kinase/adenosyl cobinamid 83.0
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 82.62
COG1126240 GlnQ ABC-type polar amino acid transport system, A 82.58
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 82.57
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 81.59
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 81.49
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 81.2
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 80.98
PRK10646153 ADP-binding protein; Provisional 80.95
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 80.26
>KOG1680|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.7e-36  Score=239.96  Aligned_cols=181  Identities=20%  Similarity=0.156  Sum_probs=159.3

Q ss_pred             cccce-eeecccccccccccchHHHHHHHHHHHHHhcCCCeEEEEcCCCCCcCCCCCCCcchh------hhhHHHHhHHH
Q psy7339          33 LADHI-YTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPGE------RLDHYARTTEQ  105 (223)
Q Consensus        33 ~~d~I-~~~~~~~~~~~~~~s~~~~el~~~~~~l~~~~~~~vvvl~~~g~~F~aG~~~~~~~~------~~~~~~~~~~~  105 (223)
                      .-.+| ...+|+|+.+|+.+..++.||.+++..+++|+.+.++|++|.|++||+|.|+.....      ....+.+.+..
T Consensus        43 ~d~~I~lItlNRP~~~Nal~~~~m~eL~~A~~~~e~D~s~~viVltG~gksFcsG~Dl~e~~~~~~~~~~~~~~~~~~~~  122 (290)
T KOG1680|consen   43 EDNGIALITLNRPKALNALCRATMLELAEAFKDFESDDSVGVIVLTGSGKSFCSGADLKEMKKDEFQDVSDGIFLRVWDL  122 (290)
T ss_pred             cCCCeEEEEeCChHHhccccHHHHHHHHHHHHHhhccCcccEEEEEcCCCccccccCHHHHhhccccccccccccchhhh
Confidence            34567 889999999999999999999999999999999999999999999999999865332      11223333332


Q ss_pred             Hhhhhhcccceee-----------------------ecceeeccccccccCCCCccccchhhhcCHHHHHHHHHcCCCCC
Q psy7339         106 VKNRVLLNHPVFV-----------------------LQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASELLYTGRKLN  162 (223)
Q Consensus       106 ~~~~~~~~~p~ia-----------------------~~a~f~~pe~~~Gl~p~~g~~~~l~~~vg~~~a~~l~l~g~~~~  162 (223)
                      +.   ..++|+|+                       ++++|++|+.++|++|.+|++++|+|.||.++|+++++||++++
T Consensus       123 ~~---~~~KPvIaainG~AlgGG~ELalmCDirva~~~Akfg~~~~~~Gi~p~~GGT~rl~r~vG~s~Ale~~ltg~~~~  199 (290)
T KOG1680|consen  123 VS---RLKKPVIAAINGFALGGGLELALMCDIRVAGEGAKFGFFEIRMGIIPSWGGTQRLPRIVGKSRALEMILTGRRLG  199 (290)
T ss_pred             hh---hcccceeEeeeceeeccchhhhhhcceEeccCCCeecccccccCCccCCCchhhHHHHhChHHHHHHHHhcCccc
Confidence            22   36788876                       89999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCccccccCChhHHHhHHHHHHHHhhcchHHHHHHHHHHHhHHhcCcC
Q psy7339         163 AQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGILRDGHA  216 (223)
Q Consensus       163 a~eA~~~Glv~~v~~~~~l~~~a~~~a~~l~~~~~~a~~~~K~~l~~~~~~~~~  216 (223)
                      |+||+++||||+|+|.++++.+|.+|+++|++.||.+++..|+.++..+...+.
T Consensus       200 AqeA~~~GlVn~Vvp~~~~l~eAv~l~~~Ia~~~~~~v~~~K~svn~~~e~~l~  253 (290)
T KOG1680|consen  200 AQEAKKIGLVNKVVPSGDALGEAVKLAEQIAKNSPLVVRADKESVNAAYETTLF  253 (290)
T ss_pred             HHHHHhCCceeEeecchhHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHhhccHH
Confidence            999999999999999999999999999999999999999999999987665543

>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>KOG1681|consensus Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>KOG1679|consensus Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>KOG0016|consensus Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>KOG1682|consensus Back     alignment and domain information
>COG0249 MutS Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>TIGR01070 mutS1 DNA mismatch repair protein MutS Back     alignment and domain information
>KOG0220|consensus Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>KOG1684|consensus Back     alignment and domain information
>KOG0218|consensus Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>KOG0219|consensus Back     alignment and domain information
>KOG0221|consensus Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>KOG0217|consensus Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>COG1193 Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>KOG1683|consensus Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>smart00250 PLEC Plectin repeat Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>COG2087 CobU Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
1nne_A765 Crystal Structure Of The Muts-adpbef3-dna Complex L 1e-16
3thw_B918 Human Mutsbeta Complexed With An Idl Of 4 Bases (Lo 2e-16
2o8b_B1022 Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M 2e-15
1fw6_A768 Crystal Structure Of A Taq Muts-Dna-Adp Ternary Com 2e-15
1ewq_A765 Crystal Structure Taq Muts Complexed With A Heterod 2e-15
1ewr_A649 Crystal Structure Of Taq Muts Length = 649 2e-15
2f6q_A280 The Crystal Structure Of Human Peroxisomal Delta3, 4e-15
1oh5_A800 The Crystal Structure Of E. Coli Muts Binding To Dn 5e-15
1wbd_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 5e-15
1wb9_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 5e-15
1wbb_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 5e-15
2o8e_A934 Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, 1e-14
2o8b_A934 Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M 1e-14
1ng9_A800 E.Coli Muts R697a: An Atpase-Asymmetry Mutant Lengt 2e-14
3k0s_A799 Crystal Structure Of E.Coli Dna Mismatch Repair Pro 2e-14
2gtr_A261 Human Chromodomain Y-Like Protein Length = 261 1e-13
2fw2_A260 Catalytic Domain Of Cdy Length = 260 4e-13
2fbm_A291 Acetyltransferase Domain Of Cdy1 Length = 291 1e-12
1e3m_A800 The Crystal Structure Of E. Coli Muts Binding To Dn 2e-12
3fdu_A266 Crystal Structure Of A Putative Enoyl-Coa Hydratase 8e-07
3qmj_A256 Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 Fr 2e-05
3hrx_A254 Crystal Structure Of Phenylacetic Acid Degradation 6e-05
3p5m_A255 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 9e-05
3kqf_A265 1.8 Angstrom Resolution Crystal Structure Of Enoyl- 2e-04
1o8u_A257 The 2 Angstrom Structure Of 6-oxo Camphor Hydrolase 3e-04
1szo_A257 Crystal Structure Analysis Of The 6-Oxo Camphor Hyd 3e-04
2q35_A243 Crystal Structure Of The Y82f Variant Of Ech2 Decar 6e-04
2vx2_A287 Crystal Structure Of Human Enoyl Coenzyme A Hydrata 6e-04
4di1_A277 Crystal Structure Of Enoyl-Coa Hydratase Echa17 Fro 8e-04
>pdb|1NNE|A Chain A, Crystal Structure Of The Muts-adpbef3-dna Complex Length = 765 Back     alignment and structure 
Iteration: 1

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 57/82 (69%)
Query: 1   MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKE 60
           M+GKS +++Q AL+ ++AQVG +VPA  A   L D IYTRIG +D +    STF +EM+E
Sbjct: 586 MAGKSTFLRQTALIALLAQVGSFVPAEEAHLPLFDGIYTRIGASDDLAGGKSTFMVEMEE 645
Query: 61  IAHIIQFLTPRSLILVDELCRA 82
           +A I++  T  SL+L+DE+ R 
Sbjct: 646 VALILKEATENSLVLLDEVGRG 667
>pdb|3THW|B Chain B, Human Mutsbeta Complexed With An Idl Of 4 Bases (Loop4) And Adp Length = 918 Back     alignment and structure
>pdb|2O8B|B Chain B, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 1022 Back     alignment and structure
>pdb|1FW6|A Chain A, Crystal Structure Of A Taq Muts-Dna-Adp Ternary Complex Length = 768 Back     alignment and structure
>pdb|1EWQ|A Chain A, Crystal Structure Taq Muts Complexed With A Heteroduplex Dna At 2.2 A Resolution Length = 765 Back     alignment and structure
>pdb|1EWR|A Chain A, Crystal Structure Of Taq Muts Length = 649 Back     alignment and structure
>pdb|2F6Q|A Chain A, The Crystal Structure Of Human Peroxisomal Delta3, Delta2 Enoyl Coa Isomerase (Peci) Length = 280 Back     alignment and structure
>pdb|1OH5|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A C:a Mismatch Length = 800 Back     alignment and structure
>pdb|1WBD|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38q Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1WB9|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38t Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1WBB|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38a Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|2O8E|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, WITH ADP BOUND TO Msh2 Only Length = 934 Back     alignment and structure
>pdb|2O8B|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 934 Back     alignment and structure
>pdb|1NG9|A Chain A, E.Coli Muts R697a: An Atpase-Asymmetry Mutant Length = 800 Back     alignment and structure
>pdb|3K0S|A Chain A, Crystal Structure Of E.Coli Dna Mismatch Repair Protein Muts, D693n Mutant, In Complex With Gt Mismatched Dna Length = 799 Back     alignment and structure
>pdb|2GTR|A Chain A, Human Chromodomain Y-Like Protein Length = 261 Back     alignment and structure
>pdb|2FW2|A Chain A, Catalytic Domain Of Cdy Length = 260 Back     alignment and structure
>pdb|2FBM|A Chain A, Acetyltransferase Domain Of Cdy1 Length = 291 Back     alignment and structure
>pdb|1E3M|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A G:t Mismatch Length = 800 Back     alignment and structure
>pdb|3FDU|A Chain A, Crystal Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Acinetobacter Baumannii Length = 266 Back     alignment and structure
>pdb|3QMJ|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 From Mycobacterium Marinum Length = 256 Back     alignment and structure
>pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 Back     alignment and structure
>pdb|3P5M|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Avium Length = 255 Back     alignment and structure
>pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 Back     alignment and structure
>pdb|1O8U|A Chain A, The 2 Angstrom Structure Of 6-oxo Camphor Hydrolase: New Structural Diversity In The Crotonase Superfamily Length = 257 Back     alignment and structure
>pdb|1SZO|A Chain A, Crystal Structure Analysis Of The 6-Oxo Camphor Hydrolase His122ala Mutant Bound To Its Natural Product (2s,4s)- Alpha-Campholinic Acid Length = 257 Back     alignment and structure
>pdb|2Q35|A Chain A, Crystal Structure Of The Y82f Variant Of Ech2 Decarboxylase Domain Of Curf From Lyngbya Majuscula Length = 243 Back     alignment and structure
>pdb|2VX2|A Chain A, Crystal Structure Of Human Enoyl Coenzyme A Hydratase Domain-Containing Protein 3 (Echdc3) Length = 287 Back     alignment and structure
>pdb|4DI1|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa17 From Mycobacterium Marinum Length = 277 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query223
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 1e-30
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 2e-30
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 2e-30
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 2e-28
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 5e-28
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 1e-21
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 1e-20
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 5e-19
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 1e-17
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 3e-15
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 1e-13
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 5e-13
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 7e-13
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 3e-11
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 3e-11
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 8e-11
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 9e-11
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, struct 1e-10
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 2e-10
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 2e-10
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 3e-10
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 3e-10
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 5e-10
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 7e-10
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 7e-10
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 2e-09
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 2e-09
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 4e-09
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 4e-09
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 4e-09
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 5e-09
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 6e-09
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 7e-09
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 8e-09
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 1e-08
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 2e-08
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 3e-08
3t3w_A279 Probable enoyl-COA hydratase; ssgcid, structural g 3e-08
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 4e-08
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 4e-08
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 7e-08
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 1e-07
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 1e-07
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 1e-07
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 1e-07
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 1e-07
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 2e-07
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 2e-07
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 2e-07
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 2e-07
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 2e-07
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 2e-07
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 2e-07
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 2e-07
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 2e-07
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 2e-07
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 3e-07
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 3e-07
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 4e-07
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 4e-07
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 5e-07
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 6e-07
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 6e-07
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 1e-06
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 2e-06
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 2e-06
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 3e-06
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 4e-06
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 4e-06
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 5e-06
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 6e-06
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 1e-05
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Length = 918 Back     alignment and structure
 Score =  117 bits (296), Expect = 1e-30
 Identities = 42/81 (51%), Positives = 55/81 (67%)

Query: 1   MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKE 60
           M GKS YIKQVAL+ IMAQ+G YVPA  A   + D I+TR+G  D+I    STF  E+ +
Sbjct: 683 MGGKSSYIKQVALITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGRSTFMEELTD 742

Query: 61  IAHIIQFLTPRSLILVDELCR 81
            A II+  T +SL+++DEL R
Sbjct: 743 TAEIIRKATSQSLVILDELGR 763
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Length = 1022 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Length = 934 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Length = 765 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Length = 800 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 Back     alignment and structure
>3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 100.0
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 100.0
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 100.0
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 100.0
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 100.0
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 100.0
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 100.0
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 100.0
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 100.0
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 100.0
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 100.0
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 100.0
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 100.0
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 100.0
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 100.0
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 100.0
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 100.0
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 100.0
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 100.0
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 100.0
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 100.0
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 100.0
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 100.0
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 100.0
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 100.0
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 100.0
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 100.0
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 100.0
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 100.0
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 100.0
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 100.0
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 100.0
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 100.0
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 100.0
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 100.0
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 100.0
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 100.0
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 100.0
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 100.0
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 100.0
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 100.0
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 100.0
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 100.0
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 100.0
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 100.0
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 100.0
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 100.0
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 100.0
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 100.0
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 100.0
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 100.0
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 100.0
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 100.0
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 100.0
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 100.0
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 100.0
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 100.0
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 100.0
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 100.0
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 100.0
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 100.0
4hdt_A353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 100.0
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 100.0
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 100.0
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 100.0
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 100.0
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 100.0
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 100.0
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 99.96
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 99.96
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 99.96
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.96
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.96
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.33
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.3
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.29
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.18
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.18
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.16
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.1
3viv_A230 441AA long hypothetical NFED protein; protein-pept 98.97
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 98.7
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 98.63
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 98.39
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 98.23
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 97.6
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 96.25
2f6i_A215 ATP-dependent CLP protease, putative; structural g 96.05
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 96.02
2w3p_A556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 95.94
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 95.86
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 95.54
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 95.5
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 95.49
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 90.06
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 88.12
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 86.17
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 84.63
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 81.87
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 81.78
3io5_A333 Recombination and repair protein; storage dimer, i 80.84
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=1.7e-38  Score=260.33  Aligned_cols=190  Identities=15%  Similarity=0.163  Sum_probs=166.3

Q ss_pred             Ccceeccccce-eeecccccccccccchHHHHHHHHHHHHHhcCCCeEEEEcCCCCCcCCCCCCCcch--------hhhh
Q psy7339          27 SLAEFRLADHI-YTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPG--------ERLD   97 (223)
Q Consensus        27 ~~~~~~~~d~I-~~~~~~~~~~~~~~s~~~~el~~~~~~l~~~~~~~vvvl~~~g~~F~aG~~~~~~~--------~~~~   97 (223)
                      +...+++.|+| ...+|+|+..|..+..|+.||.++++.+++|+++++||++|.|++||+|.|+....        +...
T Consensus        15 e~il~~~~~gVa~itlnRP~~~NAl~~~m~~~L~~al~~~~~d~~vr~vVltg~G~~FcaG~Dl~~~~~~~~~~~~~~~~   94 (274)
T 4fzw_C           15 EFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLNDRNVDPTGPAPDLGM   94 (274)
T ss_dssp             -CEEEEEETTEEEEEECCTTTTSCBCHHHHHHHHHHHHHHHHCTTCCEEEEEESSSCSBCCBCCC---------CCCHHH
T ss_pred             ccEEEEEECCEEEEEEcCcCccCCCCHHHHHHHHHHHHHHHhCCCceEEEEECCCCceeCCcChHhhhccccccchHHHH
Confidence            45567788999 88899999999999999999999999999999999999999999999998886421        1222


Q ss_pred             HHHHhHHHHhhhh-hcccceee-----------------------ecceeeccccccccCCCCccccchhhhcCHHHHHH
Q psy7339          98 HYARTTEQVKNRV-LLNHPVFV-----------------------LQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASE  153 (223)
Q Consensus        98 ~~~~~~~~~~~~~-~~~~p~ia-----------------------~~a~f~~pe~~~Gl~p~~g~~~~l~~~vg~~~a~~  153 (223)
                      .+.+.++.+...+ .+|+|+|+                       ++++|++||+++|++|++|++++|++++|+.+|++
T Consensus        95 ~~~~~~~~l~~~l~~~~kPvIAav~G~a~GgG~~lalacD~ria~~~a~f~~pe~~~Gl~p~~g~~~~L~r~vG~~~A~~  174 (274)
T 4fzw_C           95 SVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGRARAMG  174 (274)
T ss_dssp             HHHHTHHHHHHHHHHCSSCEEEEECSCEETHHHHHHHTSSEEEEETTCEEECCGGGTTCCCTTTHHHHHHHHTCHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCceeecCceeeeccceEEECCCCEEECcccCcccCCCccHHHHHHHHhhHHHHHH
Confidence            3344444444444 39999997                       79999999999999999999999999999999999


Q ss_pred             HHHcCCCCCHHHHHHcCccccccCChhHHHhHHHHHHHHhhcchHHHHHHHHHHHhHHhcCcC
Q psy7339         154 LLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGILRDGHA  216 (223)
Q Consensus       154 l~l~g~~~~a~eA~~~Glv~~v~~~~~l~~~a~~~a~~l~~~~~~a~~~~K~~l~~~~~~~~~  216 (223)
                      ++++|++++|+||+++||||+|||++++++++.+++++++..||.+++.+|++++......++
T Consensus       175 llltg~~i~A~eA~~~GLv~~vv~~~~l~~~a~~~a~~la~~~~~a~~~~K~~l~~~~~~~l~  237 (274)
T 4fzw_C          175 LALLGNQLSAEQAHEWGMIWQVVDDETLADTAQQLARHLATQPTFGLGLIKQAINSAETNTLD  237 (274)
T ss_dssp             HHHHCCCEEHHHHHHTTSSSEEECGGGHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHTSSCHH
T ss_pred             HHHhCCcCCHHHHHHCCCceEEeChHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhhhCCHH
Confidence            999999999999999999999999999999999999999999999999999999987655544
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 223
d1ewqa2224 c.37.1.12 (A:542-765) DNA repair protein MutS, the 4e-13
d1wb9a2234 c.37.1.12 (A:567-800) DNA repair protein MutS, the 9e-13
d1mj3a_260 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat 2e-10
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Thermus aquaticus [TaxId: 271]

 Score = 64.1 bits (155), Expect = 4e-13
 Identities = 39/83 (46%), Positives = 57/83 (68%)

Query: 1   MSGKSVYIKQVALLQIMAQVGCYVPASLAEFRLADHIYTRIGFNDSIECNASTFALEMKE 60
           M+GKS +++Q AL+ ++AQVG +VPA  A   L D IYTRIG +D +    STF +EM+E
Sbjct: 45  MAGKSTFLRQTALIALLAQVGSFVPAEEAHLPLFDGIYTRIGASDDLAGGKSTFMVEMEE 104

Query: 61  IAHIIQFLTPRSLILVDELCRAG 83
           +A I++  T  SL+L+DE+ R  
Sbjct: 105 VALILKEATENSLVLLDEVGRGT 127
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Length = 234 Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query223
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 100.0
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 100.0
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 100.0
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 100.0
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 100.0
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 100.0
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 100.0
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 100.0
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 99.98
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 99.97
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 99.97
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 99.97
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 99.87
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 99.86
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.46
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.85
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.8
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 86.45
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 85.46
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 84.68
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 83.11
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 81.33
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 81.22
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 80.28
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 80.13
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Peroxisomal 3,2-trans-enoyl-CoA isomerase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9.6e-36  Score=238.64  Aligned_cols=188  Identities=23%  Similarity=0.307  Sum_probs=161.4

Q ss_pred             Ccceeccccce-eeecccccccccccchHHHHHHHHHHHHHhcCCCeEEEEcCCCCCcCCCCCCCcch--------hhhh
Q psy7339          27 SLAEFRLADHI-YTRIGFNDSIECNASTFALEMKEIAHIIQFLTPRSLILVDELCRAGIEPPPSCLPG--------ERLD   97 (223)
Q Consensus        27 ~~~~~~~~d~I-~~~~~~~~~~~~~~s~~~~el~~~~~~l~~~~~~~vvvl~~~g~~F~aG~~~~~~~--------~~~~   97 (223)
                      +...++.-|+| ...+++|+..|..+.+|+.||.++++.+++|+.+ +||++|.|+.||+|.|+....        ....
T Consensus         3 ~~i~~~~~~gi~~Itlnrp~~~Nals~~~~~~l~~~l~~~~~d~~v-~vvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~~   81 (245)
T d2f6qa1           3 ETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSI-ITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKAK   81 (245)
T ss_dssp             SSEEEEEETTEEEEEECCGGGTTCBCHHHHHHHHHHHHHHHHSSCS-EEEEEESTTCSBCCBCC----CCCTTHHHHHHH
T ss_pred             ceEEEEEECCEEEEEEcCCCcCCCCCHHHHHHHHHHHHHHhcCCce-EEeecCCCccccCCccchhhhcccccccccccc
Confidence            45567788999 8889999999999999999999999999998776 899999999999998875421        1122


Q ss_pred             HHHHhHHHHhhhh-hcccceee-----------------------ecceeeccccccccCCCCccccchhhhcCHHHHHH
Q psy7339          98 HYARTTEQVKNRV-LLNHPVFV-----------------------LQATFHTPFTLRGMTPEGCSSVLFPRIFGNSVASE  153 (223)
Q Consensus        98 ~~~~~~~~~~~~~-~~~~p~ia-----------------------~~a~f~~pe~~~Gl~p~~g~~~~l~~~vg~~~a~~  153 (223)
                      .+...+..+...+ .+|+|+|+                       ++++|++||+++|++|++|+++++++++|+.+|++
T Consensus        82 ~~~~~~~~~~~~i~~~~kpvIa~v~G~a~GgG~~la~~~D~~ia~~~a~f~~pe~~~G~~p~~g~~~~l~~~~g~~~a~~  161 (245)
T d2f6qa1          82 NNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATE  161 (245)
T ss_dssp             HHHHHHHHHHHHHHSCCSCEEEEECSCEETHHHHGGGGCSEEEEETTCEEECCTGGGTCCCCTTHHHHHHHHHCHHHHHH
T ss_pred             hhhhHHHHHHhhhhhcCCceEEEECCccccccccchhhhhhhhhhccCeEecccccCCCCccccchhhcccccccchhhh
Confidence            2333333444434 39999997                       79999999999999999999999999999999999


Q ss_pred             HHHcCCCCCHHHHHHcCccccccCChhHHHhHHHHHHHHhhcchHHHHHHHHHHHhHHhcCc
Q psy7339         154 LLYTGRKLNAQEALQYGFVSGVFTTEEIERDLWPRIHAWAKLSSCIVSLLAHLMRGILRDGH  215 (223)
Q Consensus       154 l~l~g~~~~a~eA~~~Glv~~v~~~~~l~~~a~~~a~~l~~~~~~a~~~~K~~l~~~~~~~~  215 (223)
                      ++++|++++|+||+++||||+|+|++++++++.++++++++.||.+++.+|+.++......+
T Consensus       162 l~l~g~~~~a~eA~~~Glv~~vv~~~~l~~~a~~~a~~la~~~~~a~~~~K~~l~~~~~~~l  223 (245)
T d2f6qa1         162 MLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKEVIRKREREKL  223 (245)
T ss_dssp             HHTTCCCEEHHHHHHTTSCSEEECTTTHHHHHHHHHHHHTTSCHHHHHHHHHHHHGGGHHHH
T ss_pred             hcccccccccccccccccccccCCcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhhhcCH
Confidence            99999999999999999999999999999999999999999999999999999987655544
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure