Psyllid ID: psy7786


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTCLAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIGSF
cccccccccEEEEEccccccHHHHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHcccccccccccccccccccccccHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccccc
cccEEccccEEEEEccccHHHHHHHHHHHHHHHccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHccccccccEcccccccHHHHHccHHHHHHHHHHcEEEEEccccccccccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHcccccc
mvtyrnsrDIIGIaftgsgktLVFVLPILMFCLeqetklpflpgegpygliicpsrelaRQTHDIIQYYCaalpiplrtclaiggvpmnqsldvikkgiqyndpiktswraprcilslpdqVHDIIRRNLRilvegddvppaccsfrlmkLPESLVRALEakgikkptpiqvqgipaalsgrdiigiaftgsgktLVFVLPILMFCLeqetklpflpgegpygliicpsrelaRQTHDIIQYYCAALPIGSF
mvtyrnsrdiigiaftgsgktlVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTCLAIGGVPMNQSLDVIKKGIQYNdpiktswraprCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEakgikkptpiqVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIGSF
MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTCLAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIGSF
*******RDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTCLAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPI***
MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQE******PGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTCL********************NDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETK****PGEGPYGLIICPSRELARQTHDIIQYYCAALPIG**
MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTCLAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIGSF
MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTCLAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPI***
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTCLAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIGSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query252 2.2.26 [Sep-21-2011]
Q9UJV9 622 Probable ATP-dependent RN yes N/A 0.607 0.245 0.636 4e-56
Q91VN6 622 Probable ATP-dependent RN yes N/A 0.607 0.245 0.636 9e-56
Q9V3C0 619 ATP-dependent RNA helicas yes N/A 0.591 0.240 0.627 3e-52
Q5Z6G5 619 DEAD-box ATP-dependent RN yes N/A 0.722 0.294 0.515 1e-50
Q0E3X4 627 DEAD-box ATP-dependent RN no N/A 0.626 0.251 0.549 2e-48
Q54KG1 671 Probable ATP-dependent RN yes N/A 0.579 0.217 0.569 5e-48
Q9LU46 591 DEAD-box ATP-dependent RN yes N/A 0.607 0.258 0.515 2e-43
Q9SZB4 542 Putative DEAD-box ATP-dep no N/A 0.607 0.282 0.503 2e-42
Q0J7Y8 947 DEAD-box ATP-dependent RN no N/A 0.476 0.126 0.455 2e-23
Q7ZY47 947 ATP-dependent RNA helicas N/A N/A 0.456 0.121 0.445 8e-23
>sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 Back     alignment and function desciption
 Score =  218 bits (554), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 100/157 (63%), Positives = 123/157 (78%)

Query: 91  SLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMK 150
           S+  + KGI Y+DPIKTSW  PR +LS+ ++ H+ +R+   ILVEGD +PP   SF+ MK
Sbjct: 128 SVKEMAKGITYDDPIKTSWTPPRYVLSMSEERHERVRKKYHILVEGDGIPPPIKSFKEMK 187

Query: 151 LPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQE 210
            P +++R L+ KGI  PTPIQ+QGIP  LSGRD+IGIAFTGSGKTLVF LP++MFCLEQE
Sbjct: 188 FPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQE 247

Query: 211 TKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAAL 247
            +LPF   EGPYGLIICPSRELARQTH I++YYC  L
Sbjct: 248 KRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLL 284




Probable ATP-dependent RNA helicase. Is required during post-transcriptional gene expression. May be involved in pre-mRNA splicing.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 Back     alignment and function description
>sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 Back     alignment and function description
>sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 Back     alignment and function description
>sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 Back     alignment and function description
>sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 Back     alignment and function description
>sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 Back     alignment and function description
>sp|Q0J7Y8|RH45_ORYSJ DEAD-box ATP-dependent RNA helicase 45 OS=Oryza sativa subsp. japonica GN=Os08g0154200 PE=3 SV=2 Back     alignment and function description
>sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
157130314 619 DEAD box ATP-dependent RNA helicase [Aed 0.603 0.245 0.692 2e-59
270014204 619 hypothetical protein TcasGA2_TC016289 [T 0.583 0.237 0.701 1e-58
158298027 613 AGAP004711-PA [Anopheles gambiae str. PE 0.583 0.239 0.712 2e-58
193683780 615 PREDICTED: ATP-dependent RNA helicase ab 0.603 0.247 0.679 3e-57
170059153 619 ATP-dependent RNA helicase abstrakt [Cul 0.583 0.237 0.673 7e-57
357623365 613 putative ATP-dependent RNA helicase abst 0.611 0.251 0.664 7e-57
383858565 625 PREDICTED: ATP-dependent RNA helicase ab 0.591 0.238 0.686 2e-56
47222980 509 unnamed protein product [Tetraodon nigro 0.607 0.300 0.662 2e-56
340725455 625 PREDICTED: ATP-dependent RNA helicase ab 0.591 0.238 0.692 3e-56
350415294 625 PREDICTED: ATP-dependent RNA helicase ab 0.591 0.238 0.692 3e-56
>gi|157130314|ref|XP_001661885.1| DEAD box ATP-dependent RNA helicase [Aedes aegypti] gi|108871945|gb|EAT36170.1| AAEL011744-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  235 bits (599), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 129/156 (82%)

Query: 95  IKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPES 154
           + KGIQY DPIKTSW+ PR ILS  D  H+ +R  +RILV+G++VPP  CSFR MK P++
Sbjct: 131 LAKGIQYEDPIKTSWKPPRYILSRTDASHERVREKMRILVDGENVPPPICSFREMKFPKA 190

Query: 155 LVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLP 214
           ++ ALE + I+KP+PIQVQGIPA LSGRD+IGIAFTGSGKTLVFVLPI+MF LEQE +LP
Sbjct: 191 ILAALEKRNIRKPSPIQVQGIPAVLSGRDLIGIAFTGSGKTLVFVLPIVMFSLEQELRLP 250

Query: 215 FLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIG 250
           F+  EGPYGLIICPSRELA+QTHDIIQYYC  L + 
Sbjct: 251 FISKEGPYGLIICPSRELAKQTHDIIQYYCQHLQMS 286




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270014204|gb|EFA10652.1| hypothetical protein TcasGA2_TC016289 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158298027|ref|XP_318117.4| AGAP004711-PA [Anopheles gambiae str. PEST] gi|157014611|gb|EAA13218.5| AGAP004711-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|193683780|ref|XP_001952119.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|170059153|ref|XP_001865238.1| ATP-dependent RNA helicase abstrakt [Culex quinquefasciatus] gi|167878066|gb|EDS41449.1| ATP-dependent RNA helicase abstrakt [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|357623365|gb|EHJ74551.1| putative ATP-dependent RNA helicase abstrakt [Danaus plexippus] Back     alignment and taxonomy information
>gi|383858565|ref|XP_003704771.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|47222980|emb|CAF99136.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|340725455|ref|XP_003401085.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415294|ref|XP_003490595.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
UNIPROTKB|F1NAH6 607 LOC100859810 "Uncharacterized 0.623 0.258 0.649 2.4e-53
RGD|1311758 622 Ddx41 "DEAD (Asp-Glu-Ala-Asp) 0.623 0.252 0.643 6.3e-53
RGD|1559513 621 RGD1559513 "similar to DEAD (A 0.623 0.252 0.643 6.3e-53
UNIPROTKB|A3KN07 622 DDX41 "Uncharacterized protein 0.623 0.252 0.636 1.3e-52
UNIPROTKB|E2R052 622 DDX41 "Uncharacterized protein 0.623 0.252 0.636 1.3e-52
UNIPROTKB|J9NZF6 649 DDX41 "Uncharacterized protein 0.623 0.241 0.636 1.3e-52
UNIPROTKB|J3KNN5 640 DDX41 "Probable ATP-dependent 0.623 0.245 0.636 1.3e-52
UNIPROTKB|Q9UJV9 622 DDX41 "Probable ATP-dependent 0.623 0.252 0.636 1.3e-52
MGI|MGI:1920185 622 Ddx41 "DEAD (Asp-Glu-Ala-Asp) 0.623 0.252 0.636 1.7e-52
FB|FBgn0015331 619 abs "abstrakt" [Drosophila mel 0.591 0.240 0.637 1.1e-48
UNIPROTKB|F1NAH6 LOC100859810 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 552 (199.4 bits), Expect = 2.4e-53, P = 2.4e-53
 Identities = 102/157 (64%), Positives = 126/157 (80%)

Query:    91 SLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMK 150
             S+  + KGI Y+DPIKTSWRAPR IL++ +  H+ +R+   ILVEG+ +PP   SF+ MK
Sbjct:   124 SVKEMAKGITYDDPIKTSWRAPRYILAMSEARHNRVRKKYHILVEGEGIPPPIKSFKEMK 183

Query:   151 LPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQE 210
              P +++R L+ KGI++PTPIQ+QGIP  LSGRD+IGIAFTGSGKTLVF LP++MFCLEQE
Sbjct:   184 FPAAILRGLKKKGIQQPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQE 243

Query:   211 TKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAAL 247
              +LPF   EGPYGLIICPSRELARQTH II+YYC  L
Sbjct:   244 KRLPFSKREGPYGLIICPSRELARQTHGIIEYYCRLL 280


GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0035458 "cellular response to interferon-beta" evidence=IEA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IEA
GO:0051607 "defense response to virus" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IEA
RGD|1311758 Ddx41 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1559513 RGD1559513 "similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A3KN07 DDX41 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R052 DDX41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZF6 DDX41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNN5 DDX41 "Probable ATP-dependent RNA helicase DDX41" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJV9 DDX41 "Probable ATP-dependent RNA helicase DDX41" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1920185 Ddx41 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0015331 abs "abstrakt" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LU46RH35_ARATH3, ., 6, ., 4, ., 1, 30.51590.60710.2588yesN/A
Q5Z6G5RH35B_ORYSJ3, ., 6, ., 4, ., 1, 30.51530.72220.2940yesN/A
Q91VN6DDX41_MOUSE3, ., 6, ., 4, ., 1, 30.63690.60710.2459yesN/A
Q9V3C0DDX41_DROME3, ., 6, ., 4, ., 1, 30.62740.59120.2407yesN/A
Q54KG1DDX41_DICDI3, ., 6, ., 4, ., 1, 30.56950.57930.2175yesN/A
Q9UJV9DDX41_HUMAN3, ., 6, ., 4, ., 1, 30.63690.60710.2459yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 2e-31
cd00268 203 cd00268, DEADc, DEAD-box helicases 1e-30
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-28
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 8e-25
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-20
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 5e-19
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-18
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 4e-18
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 6e-18
smart00487 201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-16
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 4e-16
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 9e-15
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 7e-14
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 4e-13
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 5e-13
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 9e-12
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-11
PTZ00424 401 PTZ00424, PTZ00424, helicase 45; Provisional 3e-10
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 3e-10
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 8e-10
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-09
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 4e-09
COG1205 851 COG1205, COG1205, Distinct helicase family with a 2e-08
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-07
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-07
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 3e-07
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 8e-07
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 1e-05
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 3e-05
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 4e-05
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 2e-04
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 3e-04
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 5e-04
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 6e-04
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 0.001
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.002
COG1205 851 COG1205, COG1205, Distinct helicase family with a 0.004
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
 Score =  121 bits (304), Expect = 2e-31
 Identities = 54/114 (47%), Positives = 74/114 (64%), Gaps = 6/114 (5%)

Query: 124 DIIRRNLRI-LVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGR 182
           D IR+   I ++ G++VP    SF     P+ ++++L+  G  +PTPIQVQG P ALSGR
Sbjct: 109 DEIRKEKEITIIAGENVPKPVVSFEYTSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGR 168

Query: 183 DIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFL-PGEGPYGLIICPSRELARQ 235
           D+IGIA TGSGKTL F+LP ++    Q    P L  G+GP  L++ P+RELA Q
Sbjct: 169 DMIGIAETGSGKTLAFLLPAIVHINAQ----PLLRYGDGPIVLVLAPTRELAEQ 218


Length = 545

>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 252
KOG0331|consensus 519 100.0
KOG0330|consensus 476 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0342|consensus 543 99.97
KOG0335|consensus 482 99.97
KOG0348|consensus 708 99.97
KOG0338|consensus 691 99.97
KOG0345|consensus 567 99.97
KOG0328|consensus 400 99.97
KOG0343|consensus 758 99.96
KOG0341|consensus 610 99.96
KOG0346|consensus 569 99.96
KOG0333|consensus 673 99.96
KOG0340|consensus 442 99.96
KOG0326|consensus 459 99.96
PTZ00110 545 helicase; Provisional 99.95
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.95
KOG0339|consensus 731 99.95
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.95
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.95
KOG0336|consensus 629 99.94
KOG0334|consensus 997 99.94
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.94
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.94
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.94
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.94
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.94
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.94
KOG0337|consensus 529 99.93
KOG0347|consensus 731 99.93
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.92
KOG0350|consensus 620 99.92
KOG0341|consensus 610 99.9
KOG0327|consensus 397 99.9
PRK13767 876 ATP-dependent helicase; Provisional 99.89
PTZ00424 401 helicase 45; Provisional 99.88
KOG0332|consensus 477 99.88
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.87
KOG4284|consensus 980 99.87
KOG0329|consensus387 99.86
COG1205 851 Distinct helicase family with a unique C-terminal 99.86
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.85
PRK09401 1176 reverse gyrase; Reviewed 99.82
PRK02362 737 ski2-like helicase; Provisional 99.8
PRK14701 1638 reverse gyrase; Provisional 99.8
KOG0344|consensus 593 99.8
PRK00254 720 ski2-like helicase; Provisional 99.8
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.79
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.78
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.76
PRK01172 674 ski2-like helicase; Provisional 99.76
PTZ00110 545 helicase; Provisional 99.76
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.74
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.74
KOG0330|consensus 476 99.73
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.73
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.72
KOG0333|consensus 673 99.72
KOG0349|consensus 725 99.71
COG1204 766 Superfamily II helicase [General function predicti 99.71
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.7
KOG0346|consensus 569 99.7
KOG0331|consensus 519 99.7
KOG0339|consensus 731 99.69
KOG0334|consensus 997 99.69
PRK10689 1147 transcription-repair coupling factor; Provisional 99.68
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.68
KOG0340|consensus 442 99.68
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.67
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.67
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.66
KOG0338|consensus 691 99.66
PHA02653 675 RNA helicase NPH-II; Provisional 99.65
COG1202 830 Superfamily II helicase, archaea-specific [General 99.65
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.63
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.61
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.61
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 99.59
KOG0348|consensus 708 99.59
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.59
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.57
KOG0335|consensus 482 99.57
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.57
KOG0952|consensus 1230 99.56
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.56
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.55
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.55
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.54
KOG0347|consensus 731 99.53
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.53
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.52
KOG0345|consensus 567 99.52
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.51
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.51
KOG0328|consensus 400 99.51
KOG0342|consensus 543 99.49
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 99.49
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.47
KOG0343|consensus 758 99.44
KOG0344|consensus 593 99.44
KOG0326|consensus 459 99.42
PTZ00424 401 helicase 45; Provisional 99.42
KOG0337|consensus 529 99.41
KOG0336|consensus 629 99.36
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.35
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.34
cd00268 203 DEADc DEAD-box helicases. A diverse family of prot 99.33
KOG0329|consensus 387 99.29
KOG0332|consensus 477 99.28
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.28
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.27
PRK05580 679 primosome assembly protein PriA; Validated 99.26
KOG0327|consensus 397 99.25
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.19
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.19
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.17
PHA02558 501 uvsW UvsW helicase; Provisional 99.17
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.13
KOG0951|consensus 1674 99.09
PRK02362 737 ski2-like helicase; Provisional 99.09
PRK13766 773 Hef nuclease; Provisional 99.06
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.04
PRK00254 720 ski2-like helicase; Provisional 99.04
KOG0352|consensus 641 99.02
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.01
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.01
KOG0350|consensus 620 99.0
smart00487201 DEXDc DEAD-like helicases superfamily. 98.99
PRK13767 876 ATP-dependent helicase; Provisional 98.96
TIGR00595 505 priA primosomal protein N'. All proteins in this f 98.94
KOG4284|consensus 980 98.93
PRK09694 878 helicase Cas3; Provisional 98.93
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.92
PRK01172 674 ski2-like helicase; Provisional 98.9
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.89
KOG0354|consensus 746 98.87
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.86
KOG0351|consensus 941 98.85
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.84
PRK09401 1176 reverse gyrase; Reviewed 98.82
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.8
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 98.77
PRK14701 1638 reverse gyrase; Provisional 98.76
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.76
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 98.73
COG1205 851 Distinct helicase family with a unique C-terminal 98.69
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.69
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.66
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.65
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.65
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.65
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 98.62
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.56
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 98.46
PRK10689 1147 transcription-repair coupling factor; Provisional 98.44
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.43
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.4
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 98.39
KOG0353|consensus 695 98.36
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.31
PRK09200 790 preprotein translocase subunit SecA; Reviewed 98.3
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.3
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 98.28
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 98.27
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 98.25
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.23
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.2
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.18
KOG0948|consensus 1041 98.18
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.15
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.15
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 98.14
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.1
COG1198 730 PriA Primosomal protein N' (replication factor Y) 98.09
KOG0950|consensus 1008 98.02
PHA02558 501 uvsW UvsW helicase; Provisional 98.01
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.01
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 98.0
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 97.96
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.89
KOG0951|consensus 1674 97.86
PF1324576 AAA_19: Part of AAA domain 97.85
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.85
smart00487 201 DEXDc DEAD-like helicases superfamily. 97.84
PHA02653 675 RNA helicase NPH-II; Provisional 97.82
COG1204 766 Superfamily II helicase [General function predicti 97.81
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 97.8
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.79
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.78
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 97.75
PRK05580 679 primosome assembly protein PriA; Validated 97.73
COG1202 830 Superfamily II helicase, archaea-specific [General 97.69
KOG0952|consensus 1230 97.67
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.66
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 97.6
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 97.57
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 97.53
KOG0349|consensus 725 97.52
KOG0947|consensus 1248 97.37
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 97.31
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.3
PRK13766 773 Hef nuclease; Provisional 97.3
KOG0353|consensus 695 97.27
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 97.23
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 97.23
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 97.22
PRK12904 830 preprotein translocase subunit SecA; Reviewed 97.16
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 97.16
PRK13107 908 preprotein translocase subunit SecA; Reviewed 97.15
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.08
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.04
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 96.97
PRK14873 665 primosome assembly protein PriA; Provisional 96.95
PF04851 184 ResIII: Type III restriction enzyme, res subunit; 96.9
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 96.83
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 96.72
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.61
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 96.61
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.59
PRK09694 878 helicase Cas3; Provisional 96.52
KOG0354|consensus 746 96.51
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 96.42
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 96.35
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 96.24
KOG0949|consensus 1330 96.07
PRK13833323 conjugal transfer protein TrbB; Provisional 96.04
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.95
PF1324576 AAA_19: Part of AAA domain 95.95
PRK13851344 type IV secretion system protein VirB11; Provision 95.87
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 95.85
KOG0352|consensus 641 95.82
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 95.79
KOG4150|consensus 1034 95.79
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.78
PRK15483 986 type III restriction-modification system StyLTI en 95.71
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.67
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.65
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 95.59
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 95.55
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 95.54
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 95.42
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 95.39
KOG1803|consensus 649 95.24
PRK12326 764 preprotein translocase subunit SecA; Reviewed 95.15
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 95.1
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 95.08
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.08
TIGR00376 637 DNA helicase, putative. The gene product may repre 95.06
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 95.02
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 95.0
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 94.95
COG0610 962 Type I site-specific restriction-modification syst 94.9
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 94.81
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.8
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 94.76
PRK13897 606 type IV secretion system component VirD4; Provisio 94.64
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 94.58
KOG0922|consensus 674 94.43
CHL00122 870 secA preprotein translocase subunit SecA; Validate 94.43
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.39
PF07517 266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 94.37
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 94.29
COG4096 875 HsdR Type I site-specific restriction-modification 94.28
PRK11054 684 helD DNA helicase IV; Provisional 94.22
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 94.1
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 94.07
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 94.06
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 93.96
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 93.93
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.9
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 93.81
PF12846304 AAA_10: AAA-like domain 93.71
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 93.69
PRK08181269 transposase; Validated 93.66
PRK13850 670 type IV secretion system protein VirD4; Provisiona 93.61
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP bindi 93.59
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 93.57
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 93.52
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 93.35
PF10412 386 TrwB_AAD_bind: Type IV secretion-system coupling p 93.35
KOG0953|consensus 700 93.31
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 93.29
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 93.22
PRK13876 663 conjugal transfer coupling protein TraG; Provision 93.15
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 93.11
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 93.09
COG3973 747 Superfamily I DNA and RNA helicases [General funct 93.06
TIGR02767 623 TraG-Ti Ti-type conjugative transfer system protie 93.04
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 92.98
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.91
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.9
COG1198 730 PriA Primosomal protein N' (replication factor Y) 92.87
PRK04914 956 ATP-dependent helicase HepA; Validated 92.81
smart00382148 AAA ATPases associated with a variety of cellular 92.75
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 92.68
PRK06921266 hypothetical protein; Provisional 92.67
PRK13880 636 conjugal transfer coupling protein TraG; Provision 92.5
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 92.49
PRK13764 602 ATPase; Provisional 92.47
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 92.39
PRK10536262 hypothetical protein; Provisional 92.26
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.22
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 92.2
PRK13822 641 conjugal transfer coupling protein TraG; Provision 92.15
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 92.12
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 92.11
KOG0351|consensus 941 92.07
PRK12377248 putative replication protein; Provisional 91.98
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 91.97
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 91.81
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 91.78
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 91.76
PRK06526254 transposase; Provisional 91.73
PRK05973237 replicative DNA helicase; Provisional 91.72
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 91.7
COG3587 985 Restriction endonuclease [Defense mechanisms] 91.68
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 91.65
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 91.65
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 91.4
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 91.35
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 91.33
PF1355562 AAA_29: P-loop containing region of AAA domain 91.32
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 91.27
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 91.23
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.21
PRK06835329 DNA replication protein DnaC; Validated 91.16
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 91.15
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 91.09
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 91.07
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 91.04
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 91.03
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 91.03
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 91.0
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 90.87
PRK09183259 transposase/IS protein; Provisional 90.84
PRK04328249 hypothetical protein; Provisional 90.76
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 90.75
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 90.72
TIGR03754 643 conj_TOL_TraD conjugative coupling factor TraD, TO 90.44
PRK10875 615 recD exonuclease V subunit alpha; Provisional 90.38
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 90.27
PRK08116268 hypothetical protein; Validated 89.96
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 89.95
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 89.91
PRK08727233 hypothetical protein; Validated 89.88
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 89.86
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 89.67
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 89.49
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 89.47
TIGR02784 1141 addA_alphas double-strand break repair helicase Ad 89.33
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 89.3
PF09439181 SRPRB: Signal recognition particle receptor beta s 89.23
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 89.2
TIGR00376 637 DNA helicase, putative. The gene product may repre 89.11
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 89.06
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 89.01
KOG1802|consensus 935 89.01
PRK05298 652 excinuclease ABC subunit B; Provisional 88.99
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 88.91
COG3973 747 Superfamily I DNA and RNA helicases [General funct 88.7
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 88.66
TIGR02759 566 TraD_Ftype type IV conjugative transfer system cou 88.56
KOG1133|consensus 821 88.34
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 88.3
KOG1942|consensus 456 88.24
PTZ00301210 uridine kinase; Provisional 88.24
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 88.24
PF02500284 DNA_pack_N: Probable DNA packing protein, N-termin 88.19
PRK07952244 DNA replication protein DnaC; Validated 88.14
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 87.87
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 87.83
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 87.56
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 87.51
PF07088 484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 87.45
TIGR00665434 DnaB replicative DNA helicase. This model describe 87.38
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 87.33
KOG0745|consensus564 87.15
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 87.06
PF00004132 AAA: ATPase family associated with various cellula 86.97
KOG2340|consensus 698 86.9
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 86.84
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 86.81
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 86.8
KOG1132|consensus 945 86.75
PRK10436462 hypothetical protein; Provisional 86.61
cd01394218 radB RadB. The archaeal protein radB shares simila 86.55
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 86.53
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 86.47
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 86.32
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 86.23
KOG0060|consensus659 86.16
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 86.14
TIGR03744 893 traC_PFL_4706 conjugative transfer ATPase, PFL_470 86.12
TIGR02688449 conserved hypothetical protein TIGR02688. Members 86.07
KOG0389|consensus 941 85.81
KOG1533|consensus290 85.75
COG1136226 SalX ABC-type antimicrobial peptide transport syst 85.58
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 85.36
COG1126240 GlnQ ABC-type polar amino acid transport system, A 85.36
TIGR02237209 recomb_radB DNA repair and recombination protein R 85.32
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 85.28
PRK04296190 thymidine kinase; Provisional 85.18
PRK13700 732 conjugal transfer protein TraD; Provisional 85.18
PRK05595444 replicative DNA helicase; Provisional 85.17
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 85.13
PHA00729226 NTP-binding motif containing protein 85.11
KOG0385|consensus 971 84.99
PRK07004460 replicative DNA helicase; Provisional 84.9
PRK05748448 replicative DNA helicase; Provisional 84.87
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 84.85
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 84.73
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 84.55
PRK08939306 primosomal protein DnaI; Reviewed 84.55
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 84.53
PRK11823 446 DNA repair protein RadA; Provisional 84.45
PRK08506472 replicative DNA helicase; Provisional 84.44
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 84.29
PF05729166 NACHT: NACHT domain 84.14
COG4889 1518 Predicted helicase [General function prediction on 84.12
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 84.09
PLN02165334 adenylate isopentenyltransferase 84.06
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 84.01
KOG1802|consensus 935 83.99
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 83.95
COG0606490 Predicted ATPase with chaperone activity [Posttran 83.95
PRK09361225 radB DNA repair and recombination protein RadB; Pr 83.92
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 83.75
PRK11054 684 helD DNA helicase IV; Provisional 83.69
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 83.66
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 83.63
KOG0924|consensus 1042 83.46
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 83.44
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 83.44
PRK06067234 flagellar accessory protein FlaH; Validated 83.41
TIGR02012321 tigrfam_recA protein RecA. This model describes or 83.34
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 83.19
PRK05642234 DNA replication initiation factor; Validated 83.08
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 83.03
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 83.01
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 82.8
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 82.74
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 82.72
CHL00181287 cbbX CbbX; Provisional 82.44
PHA02244383 ATPase-like protein 82.43
TIGR02533486 type_II_gspE general secretory pathway protein E. 82.41
PHA02542473 41 41 helicase; Provisional 82.4
PRK06904472 replicative DNA helicase; Validated 82.38
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 82.1
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 81.99
PRK14530215 adenylate kinase; Provisional 81.93
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 81.79
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 81.76
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 81.7
PRK08840464 replicative DNA helicase; Provisional 81.68
PRK09302 509 circadian clock protein KaiC; Reviewed 81.68
PRK13531 498 regulatory ATPase RavA; Provisional 81.5
PRK00771437 signal recognition particle protein Srp54; Provisi 81.46
PRK00149450 dnaA chromosomal replication initiation protein; R 81.44
PRK11331459 5-methylcytosine-specific restriction enzyme subun 81.42
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 81.42
PRK14087450 dnaA chromosomal replication initiation protein; P 81.41
PF00005137 ABC_tran: ABC transporter This structure is on hol 81.34
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 81.32
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 81.28
PRK08903227 DnaA regulatory inactivator Hda; Validated 81.28
KOG1002|consensus 791 81.19
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 81.11
COG3451 796 VirB4 Type IV secretory pathway, VirB4 components 81.03
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 80.99
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 80.88
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 80.87
PRK08006471 replicative DNA helicase; Provisional 80.87
PRK00300205 gmk guanylate kinase; Provisional 80.78
TIGR00362405 DnaA chromosomal replication initiator protein Dna 80.69
PRK00131175 aroK shikimate kinase; Reviewed 80.62
KOG1131|consensus 755 80.62
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 80.39
PRK08084235 DNA replication initiation factor; Provisional 80.21
KOG1803|consensus 649 80.17
PRK07261171 topology modulation protein; Provisional 80.07
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 80.06
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 80.02
>KOG0331|consensus Back     alignment and domain information
Probab=100.00  E-value=3.1e-37  Score=264.07  Aligned_cols=221  Identities=23%  Similarity=0.287  Sum_probs=168.6

Q ss_pred             CCcccCCCcEEEEcCCCchHHHHhHHHHHHHHHHhhcCCCCCCCCCcEEEEEcCcHHHHHHHHHHHHHHHHhCCCCccee
Q psy7786           1 MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTC   80 (252)
Q Consensus         1 i~~~~~g~d~~~~a~tgsGKT~a~~lp~~~~~~~~~~~~~~~~~~~~~~lil~ptreLa~q~~~~~~~l~~~~~~~~~~~   80 (252)
                      ||.+++|||++.+|.||||||+||+||+++++....  ......++|++||++||||||+||.+++.++++.++  +++.
T Consensus       122 wp~~l~GrD~v~iA~TGSGKTLay~lP~i~~l~~~~--~~~~~~~~P~vLVL~PTRELA~QV~~~~~~~~~~~~--~~~~  197 (519)
T KOG0331|consen  122 WPIALSGRDLVGIARTGSGKTLAYLLPAIVHLNNEQ--GKLSRGDGPIVLVLAPTRELAVQVQAEAREFGKSLR--LRST  197 (519)
T ss_pred             cceeccCCceEEEeccCCcchhhhhhHHHHHHHhcc--ccccCCCCCeEEEEcCcHHHHHHHHHHHHHHcCCCC--ccEE
Confidence            799999999999999999999999999999998731  122344689999999999999999999999999887  8999


Q ss_pred             eeeCCcccCcchhhhhhcccccCCccccccCCccccCCChhHHHHHhhhhceeeccCCCCCcccccccCCCCHHHHHHHH
Q psy7786          81 LAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALE  160 (252)
Q Consensus        81 ~~~g~~~~~~~~~~l~~~~~i~~~i~t~~~~p~~l~~~~~~~~~~l~~~~~~~V~de~~~~~~~~~~~~~l~~~l~~~l~  160 (252)
                      +++||.++..|...+++++||+  |+|    |||+.++.++....+++ +.++|+||+     |+|.+|||.+++.+++.
T Consensus       198 cvyGG~~~~~Q~~~l~~gvdiv--iaT----PGRl~d~le~g~~~l~~-v~ylVLDEA-----DrMldmGFe~qI~~Il~  265 (519)
T KOG0331|consen  198 CVYGGAPKGPQLRDLERGVDVV--IAT----PGRLIDLLEEGSLNLSR-VTYLVLDEA-----DRMLDMGFEPQIRKILS  265 (519)
T ss_pred             EEeCCCCccHHHHHHhcCCcEE--EeC----ChHHHHHHHcCCccccc-eeEEEeccH-----HhhhccccHHHHHHHHH
Confidence            9999999999999999999984  555    99999999999999998 999999998     99999999999999998


Q ss_pred             HCCCCCChHHHHhhhhhhhcC-----------C--cEEEEccC----------------CCchhHHhHHHHHHHHHhhhc
Q psy7786         161 AKGIKKPTPIQVQGIPAALSG-----------R--DIIGIAFT----------------GSGKTLVFVLPILMFCLEQET  211 (252)
Q Consensus       161 ~~~~~~p~~iQ~~~~p~~~~~-----------~--~~~~~~~~----------------g~gKt~~~~~~~l~~i~~~~~  211 (252)
                      +..-.   ..|..+++++.++           .  .+.+....                ...| ..-+.++|..++    
T Consensus       266 ~i~~~---~rQtlm~saTwp~~v~~lA~~fl~~~~~i~ig~~~~~~a~~~i~qive~~~~~~K-~~~l~~lL~~~~----  337 (519)
T KOG0331|consen  266 QIPRP---DRQTLMFSATWPKEVRQLAEDFLNNPIQINVGNKKELKANHNIRQIVEVCDETAK-LRKLGKLLEDIS----  337 (519)
T ss_pred             hcCCC---cccEEEEeeeccHHHHHHHHHHhcCceEEEecchhhhhhhcchhhhhhhcCHHHH-HHHHHHHHHHHh----
Confidence            86311   1133333333221           1  11111100                1111 111122222222    


Q ss_pred             cCCCCCCCCcEEEEEcCcHHHHHHHHHHHHHHH-hhCCCC
Q psy7786         212 KLPFLPGEGPYGLIICPSRELARQTHDIIQYYC-AALPIG  250 (252)
Q Consensus       212 ~~~~~~~~~~~~LIf~~tr~~a~~i~~~l~~l~-~~~~i~  250 (252)
                           .+...++||||+|+..|++++..+++.+ +...+|
T Consensus       338 -----~~~~~KvIIFc~tkr~~~~l~~~l~~~~~~a~~iH  372 (519)
T KOG0331|consen  338 -----SDSEGKVIIFCETKRTCDELARNLRRKGWPAVAIH  372 (519)
T ss_pred             -----ccCCCcEEEEecchhhHHHHHHHHHhcCcceeeec
Confidence                 2346789999999999999999998853 444443



>KOG0330|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PF02500 DNA_pack_N: Probable DNA packing protein, N-terminus ; InterPro: IPR003499 This family includes proteins that are probably involved in DNA packing in Herpesviridae Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
4a4d_A 253 Crystal Structure Of The N-Terminal Domain Of The H 6e-19
3fe2_A 242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 6e-19
3dkp_A 245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 1e-15
3ber_A 249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 1e-13
2gxq_A 207 Hera N-Terminal Domain In Complex With Amp, Crystal 3e-12
2db3_A 434 Structural Basis For Rna Unwinding By The Dead-Box 3e-12
3mwj_A 207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 7e-12
2pl3_A 236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 5e-11
3ly5_A 262 Ddx18 Dead-Domain Length = 262 7e-11
1s2m_A 400 Crystal Structure Of The Dead Box Protein Dhh1p Len 2e-10
2zu6_A 388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 3e-10
3eiq_A 414 Crystal Structure Of Pdcd4-eif4a Length = 414 4e-10
3bor_A 237 Crystal Structure Of The Deadc Domain Of Human Tran 4e-10
1wrb_A 253 Crystal Structure Of The N-Terminal Reca-Like Domai 8e-10
2i4i_A 417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 9e-10
2xb2_A 411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-09
2hyi_C 413 Structure Of The Human Exon Junction Complex With A 1e-09
2j0q_A 410 The Crystal Structure Of The Exon Junction Complex 1e-09
2hxy_A 391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 2e-09
2j0u_A 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-09
2j0u_B 374 The Crystal Structure Of Eif4aiii-Barentsz Complex 3e-09
1hv8_A 367 Crystal Structure Of A Dead Box Protein From The Hy 6e-09
2g9n_A 221 Structure Of The Dead Domain Of Human Eukaryotic In 1e-08
3iuy_A 228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 1e-08
1vec_A 206 Crystal Structure Of The N-Terminal Domain Of RckP5 3e-08
2z0m_A 337 Crystal Structure Of Hypothetical Atp-Dependent Rna 4e-07
1t6n_A 220 Crystal Structure Of The N-Terminal Domain Of Human 9e-07
2kbe_A 226 Solution Structure Of Amino-Terminal Domain Of Dbp5 1e-06
2oxc_A 230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 1e-06
3pey_A 395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-06
3pew_A 395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 2e-06
2vso_A 395 Crystal Structure Of A Translation Initiation Compl 2e-06
1xtk_A 390 Structure Of Decd To Dead Mutation Of Human Uap56 L 2e-06
1qde_A 224 Crystal Structure Of The Atpase Domain Of Translati 3e-06
1qva_A 223 Yeast Initiation Factor 4a N-Terminal Domain Length 4e-06
1xtj_A 386 Structure Of Human Uap56 In Complex With Adp Length 4e-06
1xti_A 391 Structure Of Wildtype Human Uap56 Length = 391 5e-06
1fuu_A 394 Yeast Initiation Factor 4a Length = 394 2e-05
1q0u_A 219 Crystal Structure Of The Bstdead N-Terminal Domain 4e-05
3fhc_B 235 Crystal Structure Of Human Dbp5 In Complex With Nup 3e-04
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 3e-04
3fmo_B 300 Crystal Structure Of The Nucleoporin Nup214 In Comp 3e-04
3fht_A 412 Crystal Structure Of Human Dbp5 In Complex With Amp 3e-04
3ews_A 445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 3e-04
3g0h_A 424 Human Dead-box Rna Helicase Ddx19, In Complex With 3e-04
3fmp_B 479 Crystal Structure Of The Nucleoporin Nup214 In Comp 4e-04
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 4e-04
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 4e-04
3fho_B 508 Structure Of S. Pombe Dbp5 Length = 508 6e-04
2va8_A 715 Dna Repair Helicase Hel308 Length = 715 7e-04
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure

Iteration: 1

Score = 90.9 bits (224), Expect = 6e-19, Method: Compositional matrix adjust. Identities = 49/129 (37%), Positives = 73/129 (56%), Gaps = 5/129 (3%) Query: 124 DIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRD 183 + RR+ I V G + P +F P +++ + + +PT IQ QG P ALSG D Sbjct: 23 ETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLD 82 Query: 184 IIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLP-GEGPYGLIICPSRELARQTHDIIQY 242 ++G+A TGSGKTL ++LP ++ Q PFL G+GP L++ P+RELA+Q + Sbjct: 83 MVGVAQTGSGKTLSYLLPAIVHINHQ----PFLERGDGPICLVLAPTRELAQQVQQVAAE 138 Query: 243 YCAALPIGS 251 YC A + S Sbjct: 139 YCRACRLKS 147
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|2VA8|A Chain A, Dna Repair Helicase Hel308 Length = 715 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
3fe2_A 242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-47
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 8e-26
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-44
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 2e-26
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 3e-43
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-25
3dkp_A 245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 2e-39
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 6e-20
3iuy_A 228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 2e-36
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 9e-22
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 4e-35
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 8e-21
2pl3_A 236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 2e-31
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 3e-20
3ly5_A 262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 7e-31
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 1e-20
3ber_A 249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 3e-30
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 3e-18
2gxq_A 207 Heat resistant RNA dependent ATPase; RNA helicase, 2e-26
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 4e-15
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 5e-26
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 6e-17
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 6e-26
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 7e-17
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-25
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-12
2oxc_A 230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 1e-25
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 3e-10
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-25
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-12
1q0u_A 219 Bstdead; DEAD protein, RNA binding protein; 1.85A 2e-25
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 4e-13
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 4e-25
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-10
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 5e-25
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 2e-10
1qde_A 224 EIF4A, translation initiation factor 4A; DEAD box 8e-25
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 3e-10
3bor_A 237 Human initiation factor 4A-II; translation initiat 8e-25
3bor_A237 Human initiation factor 4A-II; translation initiat 6e-11
1vec_A 206 ATP-dependent RNA helicase P54; DEAD-box protein, 8e-25
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 9e-11
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 4e-24
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 3e-14
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 5e-24
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 3e-11
1t6n_A 220 Probable ATP-dependent RNA helicase; RECA-like fol 1e-23
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 2e-13
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 1e-23
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 2e-10
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 3e-23
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 4e-11
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 6e-23
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-12
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-22
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 4e-12
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-22
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-11
3fmo_B 300 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-22
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 4e-12
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 4e-16
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 5e-13
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 7e-07
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 5e-06
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 7e-06
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 3e-05
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-05
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 6e-05
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 8e-05
3b6e_A 216 Interferon-induced helicase C domain-containing P; 5e-04
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
 Score =  156 bits (397), Expect = 2e-47
 Identities = 46/133 (34%), Positives = 70/133 (52%), Gaps = 3/133 (2%)

Query: 117 SLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIP 176
               Q  +  RR+  I V G + P    +F     P +++  +  +   +PT IQ QG P
Sbjct: 2   MRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWP 61

Query: 177 AALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQT 236
            ALSG D++G+A TGSGKTL ++LP ++    Q        G+GP  L++ P+RELA+Q 
Sbjct: 62  VALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQP---FLERGDGPICLVLAPTRELAQQV 118

Query: 237 HDIIQYYCAALPI 249
             +   YC A  +
Sbjct: 119 QQVAAEYCRACRL 131


>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.94
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.9
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.88
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.88
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.88
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.87
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.87
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.86
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.86
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.85
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.85
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.85
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.84
3bor_A237 Human initiation factor 4A-II; translation initiat 99.84
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.83
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.83
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.83
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.83
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.83
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.82
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.82
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.82
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.82
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.82
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.81
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.81
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.8
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.8
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.8
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.8
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.79
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.78
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.77
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.77
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.76
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.76
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.76
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.75
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.75
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.74
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.73
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.73
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.73
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.73
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.73
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.73
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.73
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.72
3fe2_A 242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.72
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.71
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.71
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.7
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.67
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.67
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.67
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.67
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.66
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.65
3dkp_A 245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.65
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.65
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.64
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.64
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.63
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.63
3fmo_B 300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.61
1wrb_A 253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.56
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.55
3bor_A 237 Human initiation factor 4A-II; translation initiat 99.55
3ber_A 249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.54
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.53
2oxc_A 230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.53
2pl3_A 236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.53
1q0u_A 219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.52
1qde_A 224 EIF4A, translation initiation factor 4A; DEAD box 99.52
3iuy_A 228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.52
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.51
1vec_A 206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.5
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.49
1t6n_A 220 Probable ATP-dependent RNA helicase; RECA-like fol 99.48
2gxq_A 207 Heat resistant RNA dependent ATPase; RNA helicase, 99.47
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.46
3ly5_A 262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.45
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.42
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.42
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.41
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.38
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.37
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.37
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.36
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.35
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.34
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.34
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.32
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.3
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.29
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.25
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.24
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.22
3h1t_A 590 Type I site-specific restriction-modification syst 99.21
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.2
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.15
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.15
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.13
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.02
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.02
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.0
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 98.99
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.96
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 98.95
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 98.94
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 98.94
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.93
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 98.83
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.81
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 98.8
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 98.79
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.77
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 98.76
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.76
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.74
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 98.69
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.68
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 98.65
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.61
3b6e_A 216 Interferon-induced helicase C domain-containing P; 98.6
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 98.52
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.51
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.49
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.47
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.39
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.33
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.31
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.28
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.28
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.28
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 98.26
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.18
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.14
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.14
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.13
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 98.12
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.11
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.1
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.08
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.07
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.97
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.97
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 97.94
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.87
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 97.7
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 97.47
3jux_A 822 Protein translocase subunit SECA; protein transloc 97.33
3h1t_A 590 Type I site-specific restriction-modification syst 97.32
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 97.21
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 97.16
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 97.11
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.02
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 96.28
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.18
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 95.55
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 95.31
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 95.22
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.16
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 95.12
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 94.98
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 94.72
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 94.6
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 94.49
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 94.22
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.04
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 93.69
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 93.34
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 93.34
2p6n_A 191 ATP-dependent RNA helicase DDX41; DEAD, structural 93.31
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 91.97
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 91.61
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 91.59
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.21
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 91.09
3co5_A143 Putative two-component system transcriptional RES 90.7
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 90.49
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 90.3
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 90.15
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 89.97
1t5i_A 172 C_terminal domain of A probable ATP-dependent RNA 89.96
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 89.64
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 89.53
2o0j_A 385 Terminase, DNA packaging protein GP17; nucleotide- 89.5
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 89.25
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 88.75
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 88.74
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 88.55
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 88.16
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 88.08
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 88.05
1fuk_A 165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 88.0
2rb4_A 175 ATP-dependent RNA helicase DDX25; rossmann fold, s 87.93
2oap_1511 GSPE-2, type II secretion system protein; hexameri 87.82
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 87.47
2jgn_A 185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 87.31
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 87.26
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 87.13
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 87.06
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 86.84
2eyu_A261 Twitching motility protein PILT; pilus retraction 86.83
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 86.82
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 86.5
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 86.15
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 86.15
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 85.95
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 85.92
3bos_A242 Putative DNA replication factor; P-loop containing 85.92
2r6a_A454 DNAB helicase, replicative helicase; replication, 85.86
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 85.8
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 85.75
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 85.54
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 85.26
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 85.2
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 85.16
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 85.12
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 85.08
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 84.81
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 84.76
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 84.74
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 84.63
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 84.57
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 84.45
3vaa_A199 Shikimate kinase, SK; structural genomics, center 84.34
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 84.26
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 84.2
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 84.09
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 84.02
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 83.84
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 83.83
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 83.81
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 83.72
1w36_B 1180 RECB, exodeoxyribonuclease V beta chain; recombina 83.55
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 83.47
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 83.37
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 83.33
1xp8_A366 RECA protein, recombinase A; recombination, radior 83.33
1tue_A212 Replication protein E1; helicase, replication, E1E 83.18
2ewv_A372 Twitching motility protein PILT; pilus retraction 83.12
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 82.99
2qgz_A308 Helicase loader, putative primosome component; str 82.97
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 82.88
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 82.87
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 82.69
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 82.58
1u94_A356 RECA protein, recombinase A; homologous recombinat 82.55
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 82.49
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 82.47
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 82.47
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 82.35
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 82.31
2r44_A331 Uncharacterized protein; putative ATPase, structur 82.23
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 82.23
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 82.07
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 82.04
2chg_A226 Replication factor C small subunit; DNA-binding pr 82.01
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 81.99
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 81.96
2kjq_A149 DNAA-related protein; solution structure, NESG, st 81.93
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 81.88
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 81.84
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 81.84
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 81.8
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 81.79
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 81.79
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 81.73
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 81.7
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 81.7
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 81.61
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 81.55
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 81.48
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 81.45
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 81.28
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 81.25
1ojl_A304 Transcriptional regulatory protein ZRAR; response 81.23
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 81.01
3u06_A412 Protein claret segregational; motor domain, stalk 80.82
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 80.81
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 80.75
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 80.59
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 80.55
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 80.45
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 80.37
2z43_A324 DNA repair and recombination protein RADA; archaea 80.24
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 80.24
1kag_A173 SKI, shikimate kinase I; transferase, structural g 80.2
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 80.18
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 80.15
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 80.1
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=99.94  E-value=2.3e-27  Score=206.12  Aligned_cols=145  Identities=27%  Similarity=0.381  Sum_probs=118.4

Q ss_pred             CCcccCCCcEEEEcCCCchHHHHhHHHHHHHHHHhhcCCCCCCCCCcEEEEEcCcHHHHHHHHHHHHHHHHhCCCCccee
Q psy7786           1 MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTC   80 (252)
Q Consensus         1 i~~~~~g~d~~~~a~tgsGKT~a~~lp~~~~~~~~~~~~~~~~~~~~~~lil~ptreLa~q~~~~~~~l~~~~~~~~~~~   80 (252)
                      ||.+++|+|++++||||||||++|++|++++++.....   ....++++||++||||||.|+++.+++++...+  +++.
T Consensus        87 i~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~~~---~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~--~~~~  161 (434)
T 2db3_A           87 IPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHE---LELGRPQVVIVSPTRELAIQIFNEARKFAFESY--LKIG  161 (434)
T ss_dssp             HHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSCCC---CCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSS--CCCC
T ss_pred             HHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcccc---cccCCccEEEEecCHHHHHHHHHHHHHHhccCC--cEEE
Confidence            46788999999999999999999999999999875421   223478999999999999999999999988776  7888


Q ss_pred             eeeCCcccCcchhhhhhcccccCCccccccCCccccCCChhHHHHHhhhhceeeccCCCCCcccccccCCCCHHHHHHHH
Q psy7786          81 LAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALE  160 (252)
Q Consensus        81 ~~~g~~~~~~~~~~l~~~~~i~~~i~t~~~~p~~l~~~~~~~~~~l~~~~~~~V~de~~~~~~~~~~~~~l~~~l~~~l~  160 (252)
                      .++||.+...+.+.+.++++|.  |.    ||+++.++..+....+.+ ++++|.||+     +.+.+++|.+++.+.+.
T Consensus       162 ~~~gg~~~~~~~~~l~~~~~Iv--v~----Tp~~l~~~l~~~~~~l~~-~~~lVlDEa-----h~~~~~gf~~~~~~i~~  229 (434)
T 2db3_A          162 IVYGGTSFRHQNECITRGCHVV--IA----TPGRLLDFVDRTFITFED-TRFVVLDEA-----DRMLDMGFSEDMRRIMT  229 (434)
T ss_dssp             EECTTSCHHHHHHHHTTCCSEE--EE----CHHHHHHHHHTTSCCCTT-CCEEEEETH-----HHHTSTTTHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHhhcCCCEE--EE----ChHHHHHHHHhCCccccc-CCeEEEccH-----hhhhccCcHHHHHHHHH
Confidence            9999998888888888888773  33    488887665544433444 889999997     88899999999877776


Q ss_pred             HC
Q psy7786         161 AK  162 (252)
Q Consensus       161 ~~  162 (252)
                      ..
T Consensus       230 ~~  231 (434)
T 2db3_A          230 HV  231 (434)
T ss_dssp             CT
T ss_pred             hc
Confidence            54



>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 252
d1wrba1 238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 2e-19
d2g9na1 218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-16
d1veca_ 206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 3e-16
d2p6ra3 202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 4e-16
d2j0sa1 222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 5e-16
d1t6na_ 207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 7e-16
d1gkub1 237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 8e-15
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 3e-05
d1qdea_ 212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-14
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 6e-14
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 1e-12
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 3e-11
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 5e-11
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-09
d2bmfa2 305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 7e-09
d1wp9a1 200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 3e-05
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase VlgB
species: Flatworm (Dugesia japonica) [TaxId: 6161]
 Score = 82.3 bits (202), Expect = 2e-19
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 3/124 (2%)

Query: 129 NLRILVEGDDV--PPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIG 186
           ++ + V G D        +F  +KL  ++   +     ++PTPIQ   IPA L  RDI+ 
Sbjct: 4   SIPVSVTGPDYSATNVIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMA 63

Query: 187 IAFTGSGKTLVFVLPILMFCLEQETKL-PFLPGEGPYGLIICPSRELARQTHDIIQYYCA 245
            A TGSGKT  F++PI+   + Q+     +     P  LI+ P+RELA Q     Q +  
Sbjct: 64  CAQTGSGKTAAFLIPIINHLVCQDLNQQRYSKTAYPKCLILAPTRELAIQILSESQKFSL 123

Query: 246 ALPI 249
             P+
Sbjct: 124 NTPL 127


>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.96
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.95
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.94
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.93
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.93
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.91
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.88
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.87
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.82
d2g9na1 218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.79
d2j0sa1 222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.78
d1wrba1 238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.77
d1t6na_ 207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.76
d1qdea_ 212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.75
d1veca_ 206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.74
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.71
d1hv8a1 208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.64
d1s2ma1 206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.59
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.54
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.54
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.53
d1q0ua_ 209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.5
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.48
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 99.3
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.13
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.09
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.06
d1oywa2 206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.02
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.87
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 98.73
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.61
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.39
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.33
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.23
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.93
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.64
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.6
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 97.5
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.4
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.15
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.08
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.06
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.3
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 95.94
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 95.7
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.51
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.49
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.27
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.59
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.57
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 94.5
d1s2ma2 171 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.25
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.18
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 93.99
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 93.96
d1fuka_ 162 Initiation factor 4a {Baker's yeast (Saccharomyces 93.93
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 93.64
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 93.64
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 93.35
d2qy9a2211 GTPase domain of the signal recognition particle r 93.22
d2j0sa2 168 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.87
d1t5ia_ 168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 92.56
d1c4oa2 174 Nucleotide excision repair enzyme UvrB {Thermus th 92.09
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 91.75
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 91.12
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 91.08
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 90.95
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 90.74
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.66
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 90.4
d2p6ra4 201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 90.3
d1ls1a2207 GTPase domain of the signal sequence recognition p 90.25
d2rb4a1 168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 90.02
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 89.52
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 89.4
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 89.2
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 89.16
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 89.13
d1tf5a3 273 Translocation ATPase SecA, nucleotide-binding doma 89.07
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 88.85
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 88.7
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 88.55
d1vmaa2213 GTPase domain of the signal recognition particle r 88.46
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 88.27
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 88.19
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.06
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 87.72
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 86.87
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 86.68
d1okkd2207 GTPase domain of the signal recognition particle r 86.65
d1nkta3 288 Translocation ATPase SecA, nucleotide-binding doma 86.57
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.43
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 86.14
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 85.94
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 85.87
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 85.81
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 85.8
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 85.7
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 85.55
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 85.35
d1t5la2 181 Nucleotide excision repair enzyme UvrB {Bacillus c 85.33
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 85.16
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 84.9
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 84.8
d1j8yf2211 GTPase domain of the signal sequence recognition p 84.6
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 84.38
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 83.8
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 83.58
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 83.43
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 83.37
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 83.21
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 82.7
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 82.65
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 82.53
d1z3ix2 298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 82.48
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 82.24
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 81.73
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 81.65
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 81.65
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 81.25
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 81.23
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 80.92
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 80.72
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 80.53
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 80.17
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=1.7e-31  Score=209.20  Aligned_cols=139  Identities=19%  Similarity=0.264  Sum_probs=120.7

Q ss_pred             CCcccCCCcEEEEcCCCchHHHHhHHHHHHHHHHhhcCCCCCCCCCcEEEEEcCcHHHHHHHHHHHHHHHHhCCCCccee
Q psy7786           1 MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTC   80 (252)
Q Consensus         1 i~~~~~g~d~~~~a~tgsGKT~a~~lp~~~~~~~~~~~~~~~~~~~~~~lil~ptreLa~q~~~~~~~l~~~~~~~~~~~   80 (252)
                      ||.+++|+|++++||||||||+||++|+++++....        ..++++|++||||||.|+++.+++++++.+  +++.
T Consensus        48 Ip~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~--------~~~~~lil~PtreLa~Qi~~~~~~l~~~~~--i~~~  117 (222)
T d2j0sa1          48 IKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV--------RETQALILAPTRELAVQIQKGLLALGDYMN--VQCH  117 (222)
T ss_dssp             HHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTS--------CSCCEEEECSSHHHHHHHHHHHHHHTTTTT--CCEE
T ss_pred             HHHHHCCCCeEEEcCcchhhhhhhcccccccccccc--------cCceeEEecchHHHHHHHHHHHHHHhCccc--eeEE
Confidence            588999999999999999999999999999886543        478999999999999999999999999877  8999


Q ss_pred             eeeCCcccCcchhhhhhcccccCCccccccCCccccCCChhHHHHHhhhhceeeccCCCCCcccccccCCCCHHHHHHHH
Q psy7786          81 LAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALE  160 (252)
Q Consensus        81 ~~~g~~~~~~~~~~l~~~~~i~~~i~t~~~~p~~l~~~~~~~~~~l~~~~~~~V~de~~~~~~~~~~~~~l~~~l~~~l~  160 (252)
                      .++||.+..++.+.++.+++|.  |.    +||++.++..+....+++ ++++|.||+     +.+.+.+|.+++...+.
T Consensus       118 ~~~g~~~~~~~~~~l~~~~~Il--v~----TPgrl~~~~~~~~~~~~~-l~~lVlDEa-----D~ll~~~f~~~i~~I~~  185 (222)
T d2j0sa1         118 ACIGGTNVGEDIRKLDYGQHVV--AG----TPGRVFDMIRRRSLRTRA-IKMLVLDEA-----DEMLNKGFKEQIYDVYR  185 (222)
T ss_dssp             EECTTSCHHHHHHHHHHCCSEE--EE----CHHHHHHHHHTTSSCCTT-CCEEEEETH-----HHHTSTTTHHHHHHHHT
T ss_pred             EEeecccchhhHHHhccCCeEE--eC----CCCcHHhccccccccccc-ceeeeecch-----hHhhhcCcHHHHHHHHH
Confidence            9999999999999999988873  34    488888776666555555 999999998     89999999999877765


Q ss_pred             H
Q psy7786         161 A  161 (252)
Q Consensus       161 ~  161 (252)
                      .
T Consensus       186 ~  186 (222)
T d2j0sa1         186 Y  186 (222)
T ss_dssp             T
T ss_pred             h
Confidence            4



>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure