Psyllid ID: psy7786
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 252 | ||||||
| 157130314 | 619 | DEAD box ATP-dependent RNA helicase [Aed | 0.603 | 0.245 | 0.692 | 2e-59 | |
| 270014204 | 619 | hypothetical protein TcasGA2_TC016289 [T | 0.583 | 0.237 | 0.701 | 1e-58 | |
| 158298027 | 613 | AGAP004711-PA [Anopheles gambiae str. PE | 0.583 | 0.239 | 0.712 | 2e-58 | |
| 193683780 | 615 | PREDICTED: ATP-dependent RNA helicase ab | 0.603 | 0.247 | 0.679 | 3e-57 | |
| 170059153 | 619 | ATP-dependent RNA helicase abstrakt [Cul | 0.583 | 0.237 | 0.673 | 7e-57 | |
| 357623365 | 613 | putative ATP-dependent RNA helicase abst | 0.611 | 0.251 | 0.664 | 7e-57 | |
| 383858565 | 625 | PREDICTED: ATP-dependent RNA helicase ab | 0.591 | 0.238 | 0.686 | 2e-56 | |
| 47222980 | 509 | unnamed protein product [Tetraodon nigro | 0.607 | 0.300 | 0.662 | 2e-56 | |
| 340725455 | 625 | PREDICTED: ATP-dependent RNA helicase ab | 0.591 | 0.238 | 0.692 | 3e-56 | |
| 350415294 | 625 | PREDICTED: ATP-dependent RNA helicase ab | 0.591 | 0.238 | 0.692 | 3e-56 |
| >gi|157130314|ref|XP_001661885.1| DEAD box ATP-dependent RNA helicase [Aedes aegypti] gi|108871945|gb|EAT36170.1| AAEL011744-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 235 bits (599), Expect = 2e-59, Method: Compositional matrix adjust.
Identities = 108/156 (69%), Positives = 129/156 (82%)
Query: 95 IKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPES 154
+ KGIQY DPIKTSW+ PR ILS D H+ +R +RILV+G++VPP CSFR MK P++
Sbjct: 131 LAKGIQYEDPIKTSWKPPRYILSRTDASHERVREKMRILVDGENVPPPICSFREMKFPKA 190
Query: 155 LVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLP 214
++ ALE + I+KP+PIQVQGIPA LSGRD+IGIAFTGSGKTLVFVLPI+MF LEQE +LP
Sbjct: 191 ILAALEKRNIRKPSPIQVQGIPAVLSGRDLIGIAFTGSGKTLVFVLPIVMFSLEQELRLP 250
Query: 215 FLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIG 250
F+ EGPYGLIICPSRELA+QTHDIIQYYC L +
Sbjct: 251 FISKEGPYGLIICPSRELAKQTHDIIQYYCQHLQMS 286
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270014204|gb|EFA10652.1| hypothetical protein TcasGA2_TC016289 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|158298027|ref|XP_318117.4| AGAP004711-PA [Anopheles gambiae str. PEST] gi|157014611|gb|EAA13218.5| AGAP004711-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|193683780|ref|XP_001952119.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|170059153|ref|XP_001865238.1| ATP-dependent RNA helicase abstrakt [Culex quinquefasciatus] gi|167878066|gb|EDS41449.1| ATP-dependent RNA helicase abstrakt [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|357623365|gb|EHJ74551.1| putative ATP-dependent RNA helicase abstrakt [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|383858565|ref|XP_003704771.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|47222980|emb|CAF99136.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|340725455|ref|XP_003401085.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350415294|ref|XP_003490595.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 252 | ||||||
| UNIPROTKB|F1NAH6 | 607 | LOC100859810 "Uncharacterized | 0.623 | 0.258 | 0.649 | 2.4e-53 | |
| RGD|1311758 | 622 | Ddx41 "DEAD (Asp-Glu-Ala-Asp) | 0.623 | 0.252 | 0.643 | 6.3e-53 | |
| RGD|1559513 | 621 | RGD1559513 "similar to DEAD (A | 0.623 | 0.252 | 0.643 | 6.3e-53 | |
| UNIPROTKB|A3KN07 | 622 | DDX41 "Uncharacterized protein | 0.623 | 0.252 | 0.636 | 1.3e-52 | |
| UNIPROTKB|E2R052 | 622 | DDX41 "Uncharacterized protein | 0.623 | 0.252 | 0.636 | 1.3e-52 | |
| UNIPROTKB|J9NZF6 | 649 | DDX41 "Uncharacterized protein | 0.623 | 0.241 | 0.636 | 1.3e-52 | |
| UNIPROTKB|J3KNN5 | 640 | DDX41 "Probable ATP-dependent | 0.623 | 0.245 | 0.636 | 1.3e-52 | |
| UNIPROTKB|Q9UJV9 | 622 | DDX41 "Probable ATP-dependent | 0.623 | 0.252 | 0.636 | 1.3e-52 | |
| MGI|MGI:1920185 | 622 | Ddx41 "DEAD (Asp-Glu-Ala-Asp) | 0.623 | 0.252 | 0.636 | 1.7e-52 | |
| FB|FBgn0015331 | 619 | abs "abstrakt" [Drosophila mel | 0.591 | 0.240 | 0.637 | 1.1e-48 |
| UNIPROTKB|F1NAH6 LOC100859810 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 552 (199.4 bits), Expect = 2.4e-53, P = 2.4e-53
Identities = 102/157 (64%), Positives = 126/157 (80%)
Query: 91 SLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMK 150
S+ + KGI Y+DPIKTSWRAPR IL++ + H+ +R+ ILVEG+ +PP SF+ MK
Sbjct: 124 SVKEMAKGITYDDPIKTSWRAPRYILAMSEARHNRVRKKYHILVEGEGIPPPIKSFKEMK 183
Query: 151 LPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQE 210
P +++R L+ KGI++PTPIQ+QGIP LSGRD+IGIAFTGSGKTLVF LP++MFCLEQE
Sbjct: 184 FPAAILRGLKKKGIQQPTPIQIQGIPTILSGRDMIGIAFTGSGKTLVFTLPVIMFCLEQE 243
Query: 211 TKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAAL 247
+LPF EGPYGLIICPSRELARQTH II+YYC L
Sbjct: 244 KRLPFSKREGPYGLIICPSRELARQTHGIIEYYCRLL 280
|
|
| RGD|1311758 Ddx41 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1559513 RGD1559513 "similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A3KN07 DDX41 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R052 DDX41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NZF6 DDX41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KNN5 DDX41 "Probable ATP-dependent RNA helicase DDX41" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UJV9 DDX41 "Probable ATP-dependent RNA helicase DDX41" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1920185 Ddx41 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0015331 abs "abstrakt" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 252 | |||
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 2e-31 | |
| cd00268 | 203 | cd00268, DEADc, DEAD-box helicases | 1e-30 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 1e-28 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 8e-25 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 1e-20 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 5e-19 | |
| cd00268 | 203 | cd00268, DEADc, DEAD-box helicases | 2e-18 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 4e-18 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 6e-18 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 2e-16 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 4e-16 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 9e-15 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 7e-14 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 4e-13 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 5e-13 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 9e-12 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 1e-11 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 3e-10 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 3e-10 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 8e-10 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 1e-09 | |
| COG1201 | 814 | COG1201, Lhr, Lhr-like helicases [General function | 4e-09 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 2e-08 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-07 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 2e-07 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 3e-07 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 8e-07 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 1e-05 | |
| TIGR03817 | 742 | TIGR03817, DECH_helic, helicase/secretion neighbor | 3e-05 | |
| COG1202 | 830 | COG1202, COG1202, Superfamily II helicase, archaea | 4e-05 | |
| TIGR04121 | 803 | TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA | 2e-04 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 3e-04 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 5e-04 | |
| COG1204 | 766 | COG1204, COG1204, Superfamily II helicase [General | 6e-04 | |
| COG0514 | 590 | COG0514, RecQ, Superfamily II DNA helicase [DNA re | 0.001 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 0.002 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 0.004 |
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
Score = 121 bits (304), Expect = 2e-31
Identities = 54/114 (47%), Positives = 74/114 (64%), Gaps = 6/114 (5%)
Query: 124 DIIRRNLRI-LVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGR 182
D IR+ I ++ G++VP SF P+ ++++L+ G +PTPIQVQG P ALSGR
Sbjct: 109 DEIRKEKEITIIAGENVPKPVVSFEYTSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGR 168
Query: 183 DIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFL-PGEGPYGLIICPSRELARQ 235
D+IGIA TGSGKTL F+LP ++ Q P L G+GP L++ P+RELA Q
Sbjct: 169 DMIGIAETGSGKTLAFLLPAIVHINAQ----PLLRYGDGPIVLVLAPTRELAEQ 218
|
Length = 545 |
| >gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases | Back alignment and domain information |
|---|
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| KOG0331|consensus | 519 | 100.0 | ||
| KOG0330|consensus | 476 | 100.0 | ||
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 100.0 | |
| KOG0342|consensus | 543 | 99.97 | ||
| KOG0335|consensus | 482 | 99.97 | ||
| KOG0348|consensus | 708 | 99.97 | ||
| KOG0338|consensus | 691 | 99.97 | ||
| KOG0345|consensus | 567 | 99.97 | ||
| KOG0328|consensus | 400 | 99.97 | ||
| KOG0343|consensus | 758 | 99.96 | ||
| KOG0341|consensus | 610 | 99.96 | ||
| KOG0346|consensus | 569 | 99.96 | ||
| KOG0333|consensus | 673 | 99.96 | ||
| KOG0340|consensus | 442 | 99.96 | ||
| KOG0326|consensus | 459 | 99.96 | ||
| PTZ00110 | 545 | helicase; Provisional | 99.95 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.95 | |
| KOG0339|consensus | 731 | 99.95 | ||
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.95 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.95 | |
| KOG0336|consensus | 629 | 99.94 | ||
| KOG0334|consensus | 997 | 99.94 | ||
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.94 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.94 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.94 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.94 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.94 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.94 | |
| KOG0337|consensus | 529 | 99.93 | ||
| KOG0347|consensus | 731 | 99.93 | ||
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.92 | |
| KOG0350|consensus | 620 | 99.92 | ||
| KOG0341|consensus | 610 | 99.9 | ||
| KOG0327|consensus | 397 | 99.9 | ||
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.89 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.88 | |
| KOG0332|consensus | 477 | 99.88 | ||
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.87 | |
| KOG4284|consensus | 980 | 99.87 | ||
| KOG0329|consensus | 387 | 99.86 | ||
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.86 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.85 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.82 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.8 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.8 | |
| KOG0344|consensus | 593 | 99.8 | ||
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.8 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.79 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.78 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.76 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.76 | |
| PTZ00110 | 545 | helicase; Provisional | 99.76 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.74 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.74 | |
| KOG0330|consensus | 476 | 99.73 | ||
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.73 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.72 | |
| KOG0333|consensus | 673 | 99.72 | ||
| KOG0349|consensus | 725 | 99.71 | ||
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.71 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.7 | |
| KOG0346|consensus | 569 | 99.7 | ||
| KOG0331|consensus | 519 | 99.7 | ||
| KOG0339|consensus | 731 | 99.69 | ||
| KOG0334|consensus | 997 | 99.69 | ||
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.68 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.68 | |
| KOG0340|consensus | 442 | 99.68 | ||
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.67 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.67 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.66 | |
| KOG0338|consensus | 691 | 99.66 | ||
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.65 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.65 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.63 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.61 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.61 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.59 | |
| KOG0348|consensus | 708 | 99.59 | ||
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.59 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.57 | |
| KOG0335|consensus | 482 | 99.57 | ||
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.57 | |
| KOG0952|consensus | 1230 | 99.56 | ||
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.56 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.55 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.55 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.54 | |
| KOG0347|consensus | 731 | 99.53 | ||
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.53 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.52 | |
| KOG0345|consensus | 567 | 99.52 | ||
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.51 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.51 | |
| KOG0328|consensus | 400 | 99.51 | ||
| KOG0342|consensus | 543 | 99.49 | ||
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.49 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.47 | |
| KOG0343|consensus | 758 | 99.44 | ||
| KOG0344|consensus | 593 | 99.44 | ||
| KOG0326|consensus | 459 | 99.42 | ||
| PTZ00424 | 401 | helicase 45; Provisional | 99.42 | |
| KOG0337|consensus | 529 | 99.41 | ||
| KOG0336|consensus | 629 | 99.36 | ||
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 99.35 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.34 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.33 | |
| KOG0329|consensus | 387 | 99.29 | ||
| KOG0332|consensus | 477 | 99.28 | ||
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.28 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.27 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.26 | |
| KOG0327|consensus | 397 | 99.25 | ||
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.19 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.19 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 99.17 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.17 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.13 | |
| KOG0951|consensus | 1674 | 99.09 | ||
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.09 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.06 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 99.04 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.04 | |
| KOG0352|consensus | 641 | 99.02 | ||
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 99.01 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.01 | |
| KOG0350|consensus | 620 | 99.0 | ||
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.99 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 98.96 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 98.94 | |
| KOG4284|consensus | 980 | 98.93 | ||
| PRK09694 | 878 | helicase Cas3; Provisional | 98.93 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 98.92 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 98.9 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 98.89 | |
| KOG0354|consensus | 746 | 98.87 | ||
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 98.86 | |
| KOG0351|consensus | 941 | 98.85 | ||
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 98.84 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 98.82 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 98.8 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 98.77 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 98.76 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 98.76 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 98.73 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 98.69 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 98.69 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 98.66 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 98.65 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 98.65 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 98.65 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 98.62 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 98.56 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 98.46 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 98.44 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 98.43 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 98.4 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 98.39 | |
| KOG0353|consensus | 695 | 98.36 | ||
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 98.31 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 98.3 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.3 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 98.28 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 98.27 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 98.25 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 98.23 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 98.2 | |
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 98.18 | |
| KOG0948|consensus | 1041 | 98.18 | ||
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 98.15 | |
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 98.15 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 98.14 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 98.1 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 98.09 | |
| KOG0950|consensus | 1008 | 98.02 | ||
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 98.01 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 98.01 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 98.0 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 97.96 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.89 | |
| KOG0951|consensus | 1674 | 97.86 | ||
| PF13245 | 76 | AAA_19: Part of AAA domain | 97.85 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 97.85 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 97.84 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 97.82 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 97.81 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 97.8 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 97.79 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 97.78 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 97.75 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 97.73 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 97.69 | |
| KOG0952|consensus | 1230 | 97.67 | ||
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 97.66 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 97.6 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 97.57 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 97.53 | |
| KOG0349|consensus | 725 | 97.52 | ||
| KOG0947|consensus | 1248 | 97.37 | ||
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 97.31 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 97.3 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 97.3 | |
| KOG0353|consensus | 695 | 97.27 | ||
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 97.23 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 97.23 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 97.22 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 97.16 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 97.16 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 97.15 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 97.08 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 97.04 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 96.97 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 96.95 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 96.9 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 96.83 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 96.72 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 96.61 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.61 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 96.59 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 96.52 | |
| KOG0354|consensus | 746 | 96.51 | ||
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 96.42 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 96.35 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 96.24 | |
| KOG0949|consensus | 1330 | 96.07 | ||
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.04 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 95.95 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 95.95 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 95.87 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 95.85 | |
| KOG0352|consensus | 641 | 95.82 | ||
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 95.79 | |
| KOG4150|consensus | 1034 | 95.79 | ||
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.78 | |
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 95.71 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 95.67 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 95.65 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 95.59 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 95.55 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 95.54 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 95.42 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 95.39 | |
| KOG1803|consensus | 649 | 95.24 | ||
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 95.15 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 95.1 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 95.08 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 95.08 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 95.06 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 95.02 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 95.0 | |
| cd01126 | 384 | TraG_VirD4 The TraG/TraD/VirD4 family are bacteria | 94.95 | |
| COG0610 | 962 | Type I site-specific restriction-modification syst | 94.9 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.81 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.8 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 94.76 | |
| PRK13897 | 606 | type IV secretion system component VirD4; Provisio | 94.64 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 94.58 | |
| KOG0922|consensus | 674 | 94.43 | ||
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 94.43 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 94.39 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 94.37 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 94.29 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 94.28 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 94.22 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 94.1 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 94.07 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 94.06 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 93.96 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 93.93 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 93.9 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 93.81 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 93.71 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 93.69 | |
| PRK08181 | 269 | transposase; Validated | 93.66 | |
| PRK13850 | 670 | type IV secretion system protein VirD4; Provisiona | 93.61 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 93.59 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 93.57 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 93.52 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 93.35 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 93.35 | |
| KOG0953|consensus | 700 | 93.31 | ||
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 93.29 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 93.22 | |
| PRK13876 | 663 | conjugal transfer coupling protein TraG; Provision | 93.15 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 93.11 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 93.09 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 93.06 | |
| TIGR02767 | 623 | TraG-Ti Ti-type conjugative transfer system protie | 93.04 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 92.98 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 92.91 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 92.9 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 92.87 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 92.81 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 92.75 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 92.68 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 92.67 | |
| PRK13880 | 636 | conjugal transfer coupling protein TraG; Provision | 92.5 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 92.49 | |
| PRK13764 | 602 | ATPase; Provisional | 92.47 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 92.39 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 92.26 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 92.22 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 92.2 | |
| PRK13822 | 641 | conjugal transfer coupling protein TraG; Provision | 92.15 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 92.12 | |
| TIGR03743 | 634 | SXT_TraD conjugative coupling factor TraD, SXT/TOL | 92.11 | |
| KOG0351|consensus | 941 | 92.07 | ||
| PRK12377 | 248 | putative replication protein; Provisional | 91.98 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 91.97 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 91.81 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 91.78 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 91.76 | |
| PRK06526 | 254 | transposase; Provisional | 91.73 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 91.72 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 91.7 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 91.68 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 91.65 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 91.65 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 91.4 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 91.35 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 91.33 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 91.32 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 91.27 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 91.23 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 91.21 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 91.16 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 91.15 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 91.09 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 91.07 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 91.04 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 91.03 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 91.03 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 91.0 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 90.87 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 90.84 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 90.76 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 90.75 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 90.72 | |
| TIGR03754 | 643 | conj_TOL_TraD conjugative coupling factor TraD, TO | 90.44 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 90.38 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 90.27 | |
| PRK08116 | 268 | hypothetical protein; Validated | 89.96 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 89.95 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 89.91 | |
| PRK08727 | 233 | hypothetical protein; Validated | 89.88 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 89.86 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 89.67 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 89.49 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 89.47 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 89.33 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 89.3 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 89.23 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 89.2 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 89.11 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 89.06 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 89.01 | |
| KOG1802|consensus | 935 | 89.01 | ||
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 88.99 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 88.91 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 88.7 | |
| TIGR01547 | 396 | phage_term_2 phage terminase, large subunit, PBSX | 88.66 | |
| TIGR02759 | 566 | TraD_Ftype type IV conjugative transfer system cou | 88.56 | |
| KOG1133|consensus | 821 | 88.34 | ||
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 88.3 | |
| KOG1942|consensus | 456 | 88.24 | ||
| PTZ00301 | 210 | uridine kinase; Provisional | 88.24 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 88.24 | |
| PF02500 | 284 | DNA_pack_N: Probable DNA packing protein, N-termin | 88.19 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 88.14 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 87.87 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 87.83 | |
| COG0324 | 308 | MiaA tRNA delta(2)-isopentenylpyrophosphate transf | 87.56 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 87.51 | |
| PF07088 | 484 | GvpD: GvpD gas vesicle protein; InterPro: IPR00978 | 87.45 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 87.38 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 87.33 | |
| KOG0745|consensus | 564 | 87.15 | ||
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 87.06 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 86.97 | |
| KOG2340|consensus | 698 | 86.9 | ||
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 86.84 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 86.81 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 86.8 | |
| KOG1132|consensus | 945 | 86.75 | ||
| PRK10436 | 462 | hypothetical protein; Provisional | 86.61 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 86.55 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 86.53 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 86.47 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 86.32 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 86.23 | |
| KOG0060|consensus | 659 | 86.16 | ||
| PF14617 | 252 | CMS1: U3-containing 90S pre-ribosomal complex subu | 86.14 | |
| TIGR03744 | 893 | traC_PFL_4706 conjugative transfer ATPase, PFL_470 | 86.12 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 86.07 | |
| KOG0389|consensus | 941 | 85.81 | ||
| KOG1533|consensus | 290 | 85.75 | ||
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 85.58 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 85.36 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 85.36 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 85.32 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 85.28 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 85.18 | |
| PRK13700 | 732 | conjugal transfer protein TraD; Provisional | 85.18 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 85.17 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 85.13 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 85.11 | |
| KOG0385|consensus | 971 | 84.99 | ||
| PRK07004 | 460 | replicative DNA helicase; Provisional | 84.9 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 84.87 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 84.85 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 84.73 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 84.55 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 84.55 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 84.53 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 84.45 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 84.44 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 84.29 | |
| PF05729 | 166 | NACHT: NACHT domain | 84.14 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 84.12 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 84.09 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 84.06 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 84.01 | |
| KOG1802|consensus | 935 | 83.99 | ||
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 83.95 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 83.95 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 83.92 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 83.75 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 83.69 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 83.66 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 83.63 | |
| KOG0924|consensus | 1042 | 83.46 | ||
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 83.44 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 83.44 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 83.41 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 83.34 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 83.19 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 83.08 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 83.03 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 83.01 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 82.8 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 82.74 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 82.72 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 82.44 | |
| PHA02244 | 383 | ATPase-like protein | 82.43 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 82.41 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 82.4 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 82.38 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 82.1 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 81.99 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 81.93 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 81.79 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 81.76 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 81.7 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 81.68 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 81.68 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 81.5 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 81.46 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 81.44 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 81.42 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 81.42 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 81.41 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 81.34 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 81.32 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 81.28 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 81.28 | |
| KOG1002|consensus | 791 | 81.19 | ||
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 81.11 | |
| COG3451 | 796 | VirB4 Type IV secretory pathway, VirB4 components | 81.03 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 80.99 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 80.88 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 80.87 | |
| PRK08006 | 471 | replicative DNA helicase; Provisional | 80.87 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 80.78 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 80.69 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 80.62 | |
| KOG1131|consensus | 755 | 80.62 | ||
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 80.39 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 80.21 | |
| KOG1803|consensus | 649 | 80.17 | ||
| PRK07261 | 171 | topology modulation protein; Provisional | 80.07 | |
| PF02456 | 369 | Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR | 80.06 | |
| PF00735 | 281 | Septin: Septin; InterPro: IPR000038 Septins consti | 80.02 |
| >KOG0331|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.1e-37 Score=264.07 Aligned_cols=221 Identities=23% Similarity=0.287 Sum_probs=168.6
Q ss_pred CCcccCCCcEEEEcCCCchHHHHhHHHHHHHHHHhhcCCCCCCCCCcEEEEEcCcHHHHHHHHHHHHHHHHhCCCCccee
Q psy7786 1 MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTC 80 (252)
Q Consensus 1 i~~~~~g~d~~~~a~tgsGKT~a~~lp~~~~~~~~~~~~~~~~~~~~~~lil~ptreLa~q~~~~~~~l~~~~~~~~~~~ 80 (252)
||.+++|||++.+|.||||||+||+||+++++.... ......++|++||++||||||+||.+++.++++.++ +++.
T Consensus 122 wp~~l~GrD~v~iA~TGSGKTLay~lP~i~~l~~~~--~~~~~~~~P~vLVL~PTRELA~QV~~~~~~~~~~~~--~~~~ 197 (519)
T KOG0331|consen 122 WPIALSGRDLVGIARTGSGKTLAYLLPAIVHLNNEQ--GKLSRGDGPIVLVLAPTRELAVQVQAEAREFGKSLR--LRST 197 (519)
T ss_pred cceeccCCceEEEeccCCcchhhhhhHHHHHHHhcc--ccccCCCCCeEEEEcCcHHHHHHHHHHHHHHcCCCC--ccEE
Confidence 799999999999999999999999999999998731 122344689999999999999999999999999887 8999
Q ss_pred eeeCCcccCcchhhhhhcccccCCccccccCCccccCCChhHHHHHhhhhceeeccCCCCCcccccccCCCCHHHHHHHH
Q psy7786 81 LAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALE 160 (252)
Q Consensus 81 ~~~g~~~~~~~~~~l~~~~~i~~~i~t~~~~p~~l~~~~~~~~~~l~~~~~~~V~de~~~~~~~~~~~~~l~~~l~~~l~ 160 (252)
+++||.++..|...+++++||+ |+| |||+.++.++....+++ +.++|+||+ |+|.+|||.+++.+++.
T Consensus 198 cvyGG~~~~~Q~~~l~~gvdiv--iaT----PGRl~d~le~g~~~l~~-v~ylVLDEA-----DrMldmGFe~qI~~Il~ 265 (519)
T KOG0331|consen 198 CVYGGAPKGPQLRDLERGVDVV--IAT----PGRLIDLLEEGSLNLSR-VTYLVLDEA-----DRMLDMGFEPQIRKILS 265 (519)
T ss_pred EEeCCCCccHHHHHHhcCCcEE--EeC----ChHHHHHHHcCCccccc-eeEEEeccH-----HhhhccccHHHHHHHHH
Confidence 9999999999999999999984 555 99999999999999998 999999998 99999999999999998
Q ss_pred HCCCCCChHHHHhhhhhhhcC-----------C--cEEEEccC----------------CCchhHHhHHHHHHHHHhhhc
Q psy7786 161 AKGIKKPTPIQVQGIPAALSG-----------R--DIIGIAFT----------------GSGKTLVFVLPILMFCLEQET 211 (252)
Q Consensus 161 ~~~~~~p~~iQ~~~~p~~~~~-----------~--~~~~~~~~----------------g~gKt~~~~~~~l~~i~~~~~ 211 (252)
+..-. ..|..+++++.++ . .+.+.... ...| ..-+.++|..++
T Consensus 266 ~i~~~---~rQtlm~saTwp~~v~~lA~~fl~~~~~i~ig~~~~~~a~~~i~qive~~~~~~K-~~~l~~lL~~~~---- 337 (519)
T KOG0331|consen 266 QIPRP---DRQTLMFSATWPKEVRQLAEDFLNNPIQINVGNKKELKANHNIRQIVEVCDETAK-LRKLGKLLEDIS---- 337 (519)
T ss_pred hcCCC---cccEEEEeeeccHHHHHHHHHHhcCceEEEecchhhhhhhcchhhhhhhcCHHHH-HHHHHHHHHHHh----
Confidence 86311 1133333333221 1 11111100 1111 111122222222
Q ss_pred cCCCCCCCCcEEEEEcCcHHHHHHHHHHHHHHH-hhCCCC
Q psy7786 212 KLPFLPGEGPYGLIICPSRELARQTHDIIQYYC-AALPIG 250 (252)
Q Consensus 212 ~~~~~~~~~~~~LIf~~tr~~a~~i~~~l~~l~-~~~~i~ 250 (252)
.+...++||||+|+..|++++..+++.+ +...+|
T Consensus 338 -----~~~~~KvIIFc~tkr~~~~l~~~l~~~~~~a~~iH 372 (519)
T KOG0331|consen 338 -----SDSEGKVIIFCETKRTCDELARNLRRKGWPAVAIH 372 (519)
T ss_pred -----ccCCCcEEEEecchhhHHHHHHHHHhcCcceeeec
Confidence 2346789999999999999999998853 444443
|
|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG4150|consensus | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13897 type IV secretion system component VirD4; Provisional | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK13850 type IV secretion system protein VirD4; Provisional | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK13876 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13880 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK13822 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >KOG1802|consensus | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family | Back alignment and domain information |
|---|
| >TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD | Back alignment and domain information |
|---|
| >KOG1133|consensus | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >KOG1942|consensus | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PF02500 DNA_pack_N: Probable DNA packing protein, N-terminus ; InterPro: IPR003499 This family includes proteins that are probably involved in DNA packing in Herpesviridae | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG2340|consensus | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >KOG0060|consensus | Back alignment and domain information |
|---|
| >PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit | Back alignment and domain information |
|---|
| >TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13700 conjugal transfer protein TraD; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >KOG1802|consensus | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >COG3451 VirB4 Type IV secretory pathway, VirB4 components [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG1131|consensus | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] | Back alignment and domain information |
|---|
| >PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 252 | ||||
| 4a4d_A | 253 | Crystal Structure Of The N-Terminal Domain Of The H | 6e-19 | ||
| 3fe2_A | 242 | Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D | 6e-19 | ||
| 3dkp_A | 245 | Human Dead-Box Rna-Helicase Ddx52, Conserved Domain | 1e-15 | ||
| 3ber_A | 249 | Human Dead-Box Rna-Helicase Ddx47, Conserved Domain | 1e-13 | ||
| 2gxq_A | 207 | Hera N-Terminal Domain In Complex With Amp, Crystal | 3e-12 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 3e-12 | ||
| 3mwj_A | 207 | Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap | 7e-12 | ||
| 2pl3_A | 236 | Human Dead-Box Rna Helicase Ddx10, Dead Domain In C | 5e-11 | ||
| 3ly5_A | 262 | Ddx18 Dead-Domain Length = 262 | 7e-11 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 2e-10 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 3e-10 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 4e-10 | ||
| 3bor_A | 237 | Crystal Structure Of The Deadc Domain Of Human Tran | 4e-10 | ||
| 1wrb_A | 253 | Crystal Structure Of The N-Terminal Reca-Like Domai | 8e-10 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 9e-10 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 1e-09 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 1e-09 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 1e-09 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 2e-09 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 3e-09 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 3e-09 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 6e-09 | ||
| 2g9n_A | 221 | Structure Of The Dead Domain Of Human Eukaryotic In | 1e-08 | ||
| 3iuy_A | 228 | Crystal Structure Of Ddx53 Dead-Box Domain Length = | 1e-08 | ||
| 1vec_A | 206 | Crystal Structure Of The N-Terminal Domain Of RckP5 | 3e-08 | ||
| 2z0m_A | 337 | Crystal Structure Of Hypothetical Atp-Dependent Rna | 4e-07 | ||
| 1t6n_A | 220 | Crystal Structure Of The N-Terminal Domain Of Human | 9e-07 | ||
| 2kbe_A | 226 | Solution Structure Of Amino-Terminal Domain Of Dbp5 | 1e-06 | ||
| 2oxc_A | 230 | Human Dead-Box Rna Helicase Ddx20, Dead Domain In C | 1e-06 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 2e-06 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 2e-06 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 2e-06 | ||
| 1xtk_A | 390 | Structure Of Decd To Dead Mutation Of Human Uap56 L | 2e-06 | ||
| 1qde_A | 224 | Crystal Structure Of The Atpase Domain Of Translati | 3e-06 | ||
| 1qva_A | 223 | Yeast Initiation Factor 4a N-Terminal Domain Length | 4e-06 | ||
| 1xtj_A | 386 | Structure Of Human Uap56 In Complex With Adp Length | 4e-06 | ||
| 1xti_A | 391 | Structure Of Wildtype Human Uap56 Length = 391 | 5e-06 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 2e-05 | ||
| 1q0u_A | 219 | Crystal Structure Of The Bstdead N-Terminal Domain | 4e-05 | ||
| 3fhc_B | 235 | Crystal Structure Of Human Dbp5 In Complex With Nup | 3e-04 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 3e-04 | ||
| 3fmo_B | 300 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 3e-04 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 3e-04 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 3e-04 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 3e-04 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 4e-04 | ||
| 3i5x_A | 563 | Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len | 4e-04 | ||
| 3sqx_A | 512 | Structure Of Mss116p (Nte And C-Tail Double Deletio | 4e-04 | ||
| 3fho_B | 508 | Structure Of S. Pombe Dbp5 Length = 508 | 6e-04 | ||
| 2va8_A | 715 | Dna Repair Helicase Hel308 Length = 715 | 7e-04 |
| >pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 | Back alignment and structure |
|
| >pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 | Back alignment and structure |
| >pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 | Back alignment and structure |
| >pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 | Back alignment and structure |
| >pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 | Back alignment and structure |
| >pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 | Back alignment and structure |
| >pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 | Back alignment and structure |
| >pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 | Back alignment and structure |
| >pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 | Back alignment and structure |
| >pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 | Back alignment and structure |
| >pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 | Back alignment and structure |
| >pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 | Back alignment and structure |
| >pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 | Back alignment and structure |
| >pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 | Back alignment and structure |
| >pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 | Back alignment and structure |
| >pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 | Back alignment and structure |
| >pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 | Back alignment and structure |
| >pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 | Back alignment and structure |
| >pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 | Back alignment and structure |
| >pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 | Back alignment and structure |
| >pdb|2VA8|A Chain A, Dna Repair Helicase Hel308 Length = 715 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 252 | |||
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 2e-47 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 8e-26 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 1e-44 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 2e-26 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 3e-43 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 1e-25 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 2e-39 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 6e-20 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 2e-36 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 9e-22 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 4e-35 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 8e-21 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 2e-31 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 3e-20 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 7e-31 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 1e-20 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 3e-30 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 3e-18 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 2e-26 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 4e-15 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 5e-26 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 6e-17 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 6e-26 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 7e-17 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 1e-25 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 1e-12 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 1e-25 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 3e-10 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 2e-25 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 1e-12 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 2e-25 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 4e-13 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 4e-25 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 1e-10 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 5e-25 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 2e-10 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 8e-25 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 3e-10 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 8e-25 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 6e-11 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 8e-25 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 9e-11 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 4e-24 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 3e-14 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 5e-24 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 3e-11 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 1e-23 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 2e-13 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 1e-23 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 2e-10 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 3e-23 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 4e-11 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 6e-23 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 2e-12 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 1e-22 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 4e-12 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 1e-22 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 1e-11 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 2e-22 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 4e-12 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 4e-16 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 5e-13 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 7e-07 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 5e-06 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 7e-06 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 3e-05 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 4e-05 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 6e-05 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 8e-05 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 5e-04 |
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
Score = 156 bits (397), Expect = 2e-47
Identities = 46/133 (34%), Positives = 70/133 (52%), Gaps = 3/133 (2%)
Query: 117 SLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIP 176
Q + RR+ I V G + P +F P +++ + + +PT IQ QG P
Sbjct: 2 MRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWP 61
Query: 177 AALSGRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQT 236
ALSG D++G+A TGSGKTL ++LP ++ Q G+GP L++ P+RELA+Q
Sbjct: 62 VALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQP---FLERGDGPICLVLAPTRELAQQV 118
Query: 237 HDIIQYYCAALPI 249
+ YC A +
Sbjct: 119 QQVAAEYCRACRL 131
|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.94 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.9 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.88 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.88 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.88 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.87 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.87 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.86 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.86 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.85 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.85 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.85 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.84 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.84 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.83 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.83 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.83 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.83 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.83 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.82 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.82 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.82 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.82 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.82 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.81 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.81 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.8 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.8 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.8 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.8 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.79 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.78 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.77 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.77 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.76 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.76 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.76 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.75 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.75 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.74 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.73 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.73 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.73 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.73 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.73 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.73 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.73 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.72 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.72 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.71 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.71 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.7 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.67 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.67 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.67 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.67 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.66 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.65 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 99.65 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.65 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.64 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.64 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.63 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.63 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.61 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.56 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.55 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.55 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.54 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.53 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.53 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.53 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.52 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.52 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.52 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.51 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.5 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.49 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.48 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.47 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.46 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.45 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.42 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.42 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.41 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.38 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.37 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.37 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.36 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.35 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.34 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.34 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.32 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 99.3 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.29 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.25 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.24 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.22 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.21 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.2 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.15 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.15 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.13 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.02 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.02 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 99.0 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 98.99 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 98.96 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 98.95 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 98.94 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 98.94 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 98.93 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 98.83 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 98.81 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 98.8 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 98.79 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 98.77 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.76 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 98.76 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 98.74 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.69 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 98.68 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 98.65 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 98.61 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 98.6 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.52 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 98.51 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 98.49 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 98.47 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 98.39 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 98.33 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 98.31 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 98.28 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 98.28 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 98.28 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 98.26 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 98.18 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 98.14 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 98.14 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 98.13 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 98.12 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 98.11 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 98.1 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 98.08 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 98.07 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 98.0 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 97.97 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 97.97 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 97.94 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 97.87 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 97.7 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 97.47 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 97.33 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 97.32 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 97.21 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 97.16 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 97.11 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 97.02 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 96.28 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 96.18 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 95.55 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 95.31 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 95.22 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 95.16 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 95.12 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 94.98 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 94.72 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 94.6 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 94.49 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 94.22 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 94.04 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 93.69 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 93.34 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 93.34 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 93.31 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 91.97 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 91.61 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 91.59 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 91.21 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 91.09 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 90.7 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 90.49 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 90.3 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 90.15 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 89.97 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 89.96 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 89.64 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 89.53 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 89.5 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 89.25 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 88.75 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 88.74 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 88.55 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 88.16 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 88.08 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 88.05 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 88.0 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 87.93 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 87.82 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 87.47 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 87.31 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 87.26 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 87.13 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 87.06 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 86.84 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 86.83 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 86.82 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 86.5 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 86.15 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 86.15 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 85.95 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 85.92 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 85.92 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 85.86 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 85.8 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 85.75 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 85.54 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 85.26 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 85.2 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 85.16 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 85.12 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 85.08 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 84.81 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 84.76 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 84.74 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 84.63 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 84.57 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 84.45 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 84.34 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 84.26 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 84.2 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 84.09 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 84.02 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 83.84 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 83.83 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 83.81 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 83.72 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 83.55 | |
| 3hjh_A | 483 | Transcription-repair-coupling factor; MFD, mutatio | 83.47 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 83.37 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 83.33 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 83.33 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 83.18 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 83.12 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 82.99 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 82.97 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 82.88 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 82.87 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 82.69 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 82.58 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 82.55 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 82.49 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 82.47 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 82.47 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 82.35 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 82.31 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 82.23 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 82.23 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 82.07 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 82.04 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 82.01 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 81.99 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 81.96 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 81.93 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 81.88 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 81.84 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 81.84 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 81.8 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 81.79 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 81.79 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 81.73 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 81.7 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 81.7 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 81.61 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 81.55 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 81.48 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 81.45 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 81.28 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 81.25 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 81.23 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 81.01 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 80.82 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 80.81 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 80.75 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 80.59 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 80.55 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 80.45 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 80.37 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 80.24 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 80.24 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 80.2 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 80.18 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 80.15 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 80.1 |
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=99.94 E-value=2.3e-27 Score=206.12 Aligned_cols=145 Identities=27% Similarity=0.381 Sum_probs=118.4
Q ss_pred CCcccCCCcEEEEcCCCchHHHHhHHHHHHHHHHhhcCCCCCCCCCcEEEEEcCcHHHHHHHHHHHHHHHHhCCCCccee
Q psy7786 1 MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTC 80 (252)
Q Consensus 1 i~~~~~g~d~~~~a~tgsGKT~a~~lp~~~~~~~~~~~~~~~~~~~~~~lil~ptreLa~q~~~~~~~l~~~~~~~~~~~ 80 (252)
||.+++|+|++++||||||||++|++|++++++..... ....++++||++||||||.|+++.+++++...+ +++.
T Consensus 87 i~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~~~---~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~--~~~~ 161 (434)
T 2db3_A 87 IPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHE---LELGRPQVVIVSPTRELAIQIFNEARKFAFESY--LKIG 161 (434)
T ss_dssp HHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSCCC---CCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSS--CCCC
T ss_pred HHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcccc---cccCCccEEEEecCHHHHHHHHHHHHHHhccCC--cEEE
Confidence 46788999999999999999999999999999875421 223478999999999999999999999988776 7888
Q ss_pred eeeCCcccCcchhhhhhcccccCCccccccCCccccCCChhHHHHHhhhhceeeccCCCCCcccccccCCCCHHHHHHHH
Q psy7786 81 LAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALE 160 (252)
Q Consensus 81 ~~~g~~~~~~~~~~l~~~~~i~~~i~t~~~~p~~l~~~~~~~~~~l~~~~~~~V~de~~~~~~~~~~~~~l~~~l~~~l~ 160 (252)
.++||.+...+.+.+.++++|. |. ||+++.++..+....+.+ ++++|.||+ +.+.+++|.+++.+.+.
T Consensus 162 ~~~gg~~~~~~~~~l~~~~~Iv--v~----Tp~~l~~~l~~~~~~l~~-~~~lVlDEa-----h~~~~~gf~~~~~~i~~ 229 (434)
T 2db3_A 162 IVYGGTSFRHQNECITRGCHVV--IA----TPGRLLDFVDRTFITFED-TRFVVLDEA-----DRMLDMGFSEDMRRIMT 229 (434)
T ss_dssp EECTTSCHHHHHHHHTTCCSEE--EE----CHHHHHHHHHTTSCCCTT-CCEEEEETH-----HHHTSTTTHHHHHHHHH
T ss_pred EEECCCCHHHHHHHhhcCCCEE--EE----ChHHHHHHHHhCCccccc-CCeEEEccH-----hhhhccCcHHHHHHHHH
Confidence 9999998888888888888773 33 488887665544433444 889999997 88899999999877776
Q ss_pred HC
Q psy7786 161 AK 162 (252)
Q Consensus 161 ~~ 162 (252)
..
T Consensus 230 ~~ 231 (434)
T 2db3_A 230 HV 231 (434)
T ss_dssp CT
T ss_pred hc
Confidence 54
|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 252 | ||||
| d1wrba1 | 238 | c.37.1.19 (A:164-401) putative ATP-dependent RNA h | 2e-19 | |
| d2g9na1 | 218 | c.37.1.19 (A:21-238) Initiation factor 4a {Human ( | 2e-16 | |
| d1veca_ | 206 | c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma | 3e-16 | |
| d2p6ra3 | 202 | c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus | 4e-16 | |
| d2j0sa1 | 222 | c.37.1.19 (A:22-243) Probable ATP-dependent RNA he | 5e-16 | |
| d1t6na_ | 207 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 7e-16 | |
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 8e-15 | |
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 3e-05 | |
| d1qdea_ | 212 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 3e-14 | |
| d1s2ma1 | 206 | c.37.1.19 (A:46-251) Putative ATP-dependent RNA he | 6e-14 | |
| d1q0ua_ | 209 | c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR | 1e-12 | |
| d1oywa2 | 206 | c.37.1.19 (A:1-206) RecQ helicase domain {Escheric | 3e-11 | |
| d1hv8a1 | 208 | c.37.1.19 (A:3-210) Putative DEAD box RNA helicase | 5e-11 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 4e-09 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 7e-09 | |
| d1wp9a1 | 200 | c.37.1.19 (A:1-200) putative ATP-dependent RNA hel | 3e-05 |
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: putative ATP-dependent RNA helicase VlgB species: Flatworm (Dugesia japonica) [TaxId: 6161]
Score = 82.3 bits (202), Expect = 2e-19
Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 3/124 (2%)
Query: 129 NLRILVEGDDV--PPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSGRDIIG 186
++ + V G D +F +KL ++ + ++PTPIQ IPA L RDI+
Sbjct: 4 SIPVSVTGPDYSATNVIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDIMA 63
Query: 187 IAFTGSGKTLVFVLPILMFCLEQETKL-PFLPGEGPYGLIICPSRELARQTHDIIQYYCA 245
A TGSGKT F++PI+ + Q+ + P LI+ P+RELA Q Q +
Sbjct: 64 CAQTGSGKTAAFLIPIINHLVCQDLNQQRYSKTAYPKCLILAPTRELAIQILSESQKFSL 123
Query: 246 ALPI 249
P+
Sbjct: 124 NTPL 127
|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 252 | |||
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.96 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.95 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.94 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.93 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.93 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.91 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.88 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.87 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.82 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.79 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.78 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.77 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.76 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.75 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.74 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.71 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.64 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.59 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.54 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.54 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.53 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.5 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.48 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.3 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 99.13 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.09 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.06 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.02 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 98.87 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 98.73 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.61 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 98.39 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.33 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 98.23 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 97.93 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 97.64 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 97.6 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 97.5 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 97.4 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 97.15 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 97.08 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.06 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 96.3 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 95.94 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 95.7 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.51 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.49 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 95.27 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 94.59 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 94.57 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 94.5 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 94.25 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 94.18 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 93.99 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 93.96 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 93.93 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.64 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 93.64 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 93.35 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 93.22 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 92.87 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 92.56 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 92.09 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 91.75 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 91.12 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 91.08 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 90.95 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 90.74 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 90.66 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 90.4 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 90.3 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 90.25 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 90.02 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 89.52 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 89.4 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 89.2 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 89.16 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 89.13 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 89.07 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 88.85 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 88.7 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 88.55 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 88.46 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 88.27 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 88.19 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 88.06 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 87.72 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 86.87 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 86.68 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 86.65 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 86.57 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 86.43 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 86.14 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 85.94 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 85.87 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 85.81 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 85.8 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 85.7 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 85.55 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 85.35 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 85.33 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 85.16 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 84.9 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 84.8 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 84.6 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 84.38 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 83.8 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 83.58 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 83.43 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 83.37 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 83.21 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 82.7 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 82.65 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 82.53 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 82.48 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 82.24 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 81.73 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 81.65 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 81.65 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 81.25 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 81.23 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 80.92 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 80.72 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 80.53 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 80.17 |
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Probable ATP-dependent RNA helicase DDX48 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=1.7e-31 Score=209.20 Aligned_cols=139 Identities=19% Similarity=0.264 Sum_probs=120.7
Q ss_pred CCcccCCCcEEEEcCCCchHHHHhHHHHHHHHHHhhcCCCCCCCCCcEEEEEcCcHHHHHHHHHHHHHHHHhCCCCccee
Q psy7786 1 MVTYRNSRDIIGIAFTGSGKTLVFVLPILMFCLEQETKLPFLPGEGPYGLIICPSRELARQTHDIIQYYCAALPIPLRTC 80 (252)
Q Consensus 1 i~~~~~g~d~~~~a~tgsGKT~a~~lp~~~~~~~~~~~~~~~~~~~~~~lil~ptreLa~q~~~~~~~l~~~~~~~~~~~ 80 (252)
||.+++|+|++++||||||||+||++|+++++.... ..++++|++||||||.|+++.+++++++.+ +++.
T Consensus 48 Ip~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~--------~~~~~lil~PtreLa~Qi~~~~~~l~~~~~--i~~~ 117 (222)
T d2j0sa1 48 IKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV--------RETQALILAPTRELAVQIQKGLLALGDYMN--VQCH 117 (222)
T ss_dssp HHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTS--------CSCCEEEECSSHHHHHHHHHHHHHHTTTTT--CCEE
T ss_pred HHHHHCCCCeEEEcCcchhhhhhhcccccccccccc--------cCceeEEecchHHHHHHHHHHHHHHhCccc--eeEE
Confidence 588999999999999999999999999999886543 478999999999999999999999999877 8999
Q ss_pred eeeCCcccCcchhhhhhcccccCCccccccCCccccCCChhHHHHHhhhhceeeccCCCCCcccccccCCCCHHHHHHHH
Q psy7786 81 LAIGGVPMNQSLDVIKKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALE 160 (252)
Q Consensus 81 ~~~g~~~~~~~~~~l~~~~~i~~~i~t~~~~p~~l~~~~~~~~~~l~~~~~~~V~de~~~~~~~~~~~~~l~~~l~~~l~ 160 (252)
.++||.+..++.+.++.+++|. |. +||++.++..+....+++ ++++|.||+ +.+.+.+|.+++...+.
T Consensus 118 ~~~g~~~~~~~~~~l~~~~~Il--v~----TPgrl~~~~~~~~~~~~~-l~~lVlDEa-----D~ll~~~f~~~i~~I~~ 185 (222)
T d2j0sa1 118 ACIGGTNVGEDIRKLDYGQHVV--AG----TPGRVFDMIRRRSLRTRA-IKMLVLDEA-----DEMLNKGFKEQIYDVYR 185 (222)
T ss_dssp EECTTSCHHHHHHHHHHCCSEE--EE----CHHHHHHHHHTTSSCCTT-CCEEEEETH-----HHHTSTTTHHHHHHHHT
T ss_pred EEeecccchhhHHHhccCCeEE--eC----CCCcHHhccccccccccc-ceeeeecch-----hHhhhcCcHHHHHHHHH
Confidence 9999999999999999988873 34 488888776666555555 999999998 89999999999877765
Q ss_pred H
Q psy7786 161 A 161 (252)
Q Consensus 161 ~ 161 (252)
.
T Consensus 186 ~ 186 (222)
T d2j0sa1 186 Y 186 (222)
T ss_dssp T
T ss_pred h
Confidence 4
|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|