Psyllid ID: psy8265

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630
MHKIKEENQYRSRGELGRYLLRYHFVLTPLNSVINLITHAIYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPYITLPLCSDLPQSHKLPSKSLNSKSLDGLSSNDSSPVPSNHLVTPKVEDIKSESFNYSEVPRQTVLMWGSNPSRSPPASPILPNGHINYPSQEIKKYNGDPLKSLAEMNTIGENKWKESPPVVSPKSYYQSYNENGPSERLDIRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYKNSKPDFVISTHRPLMEEEGRDLLGKRTMDFKVSYLDAGLNNSYFSDSDQLTPSHQTLAPSPGSAQSGSSSTTPQRVNRRYKTQLRDFLSTCRTKRKMSAQHAAPPPPTPAPPIEYLTPPDAVAAAYSNMYTTGYSATTPEYMSQSLYDNRLPYENLFHQYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPFESDIVHQSVYELVHSEDREELQRQLMWNSFLPPESAGISLQECFLQENSYLLERSFT
ccccccccccccccccccEEEEccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccEEEccccccccEEEEEEEEEEEcccccccccccEEEEEEEEEccccccccccccccEEEEEEccccEEEEEccccccccccccccccccccccEEccccHHHHHHHHHHHHHccccEEEEEEEEEccccEEEEEEEEEEEEEcccccEEEEEcccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccHHHHHHHHHccccccccccccccccccccccccccccccccc
cccccHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccHcHHHHHHHcccccccEEEEEEcccHHHccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccHHccHHHHcEEEEEEEccccccccccccccEEEcccccEEEEEEEEEEEEEcccccccccccEEEEEEEcccccccEEEEcccccEEEEccccccEEEEEccccEEEEcccHHHHHHccccEEEcHHHHHHHHHHHHHHHHccccHHEEEEEEEccccEEEEEEEEEEEEEcccccEEEEEEEEcccHccHHHHccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHcccccccccccccccccccccEEEccccccHHHHccccccccEEcEEEEEEccccHHHHHHHHHHcccccccccccccccccccccccHHHcccc
mhkikeenqyrsrgELGRYLLRYHFVLTPLNSVINLITHaiyrpyypeyqpytvsngfslptyevnksndcdklychqtltadqnskgysspyitlplcsdlpqshklpskslnsksldglssndsspvpsnhlvtpkvediksesfnysevprqtvlmwgsnpsrsppaspilpnghinypsqeikkyngdplksLAEMNTigenkwkesppvvspksyyqsynengpserldiRGRIKIlhgqnrkleepplalfaictpfgppslleiphkevmfkskhkldLSLVSMDQRGKmllgysdtelanmggydlvhydDLAYVASAHQELLKTGASGMIAYRfqtndggwqwlqtssrlvyknskpdfvisthrplmeeEGRDLLGKRTMDFKVSYldaglnnsyfsdsdqltpshqtlapspgsaqsgsssttpqrvNRRYKTQLRDFLSTCRTkrkmsaqhaapppptpappieyltppdAVAAAYSNMyttgysattpeymsqslydnrlpyenlfhqyrpyypeyqpytvsngfslptyevnksndcdklychqtltadqnskgysspfesdivHQSVYELVHSEDREELQRQLMWnsflppesagisLQECFLQENSYLLERSFT
mhkikeenqyrsrgELGRYLLRYHFVLTPLNSVINLITHAIYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPYITLPLCSDLPQSHKLPSKSLNSKSLDGlssndsspvpsnhlvtpkvediksESFNYSEVPRQTVLMWGSNPSRSPPASPILPNGHINYPSQEIKKYNGDPLKSLAEMNTIgenkwkesppvvsPKSYYQSYNengpserldiRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYKNSkpdfvisthrplmeeegrdllGKRTMDFKVSYLDAGLNNSYFSDSDQLTPSHQTLApspgsaqsgsssttpqrvnrryKTQLRDFLSTCRTKRkmsaqhaapppptpaPPIEYLTPPDAVAAAYSNMYTTGYSATTPEYMSQSLYDNRLPYENLFHQYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPFESDIVHQSVYELVHSEDREELQRQLMWNSFLPPESAGISLQECFLQENSYLLERSFT
MHKIKEENQYRSRGELGRYLLRYHFVLTPLNSVINLITHAIYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPYITLPLCSDLPQshklpskslnskslDGLSSNDSSPVPSNHLVTPKVEDIKSESFNYSEVPRQTVLMWGSNPSRSPPASPILPNGHINYPSQEIKKYNGDPLKSLAEMNTIGENKWKESPPVVSPKSYYQSYNENGPSERLDIRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYKNSKPDFVISTHRPLMEEEGRDLLGKRTMDFKVSYLDAGLNNSYFSDSDQLTPSHQTLapspgsaqsgsssttpqRVNRRYKTQLRDFLSTCRTKRKMSAQHaapppptpappIEYLTPPDAVAAAYSNMYTTGYSATTPEYMSQSLYDNRLPYENLFHqyrpyypeyqpyTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPFESDIVHQSVYELVHSEDREELQRQLMWNSFLPPESAGISLQECFLQENSYLLERSFT
**************ELGRYLLRYHFVLTPLNSVINLITHAIYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPYITLPLC***************************************************************************************************************************************IRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYKNSKPDFVISTHR********DLLGKRTMDFKVSYLDAGLNNSY************************************************************************L**PDAVAAAYSNMYTTGYSATTPEYMSQSLYDNRLPYENLFHQYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTA*************DIVHQSVYELVH******LQRQLMWNSFLPPESAGISLQECFLQENSYL******
****************GRYLLRYHFVLTPLNSVINLITHAIYRPYYPEYQPYTVSNGFSLPTYEVNKSNDC**************************LC******************************PSNHLVTPKVED****************L***********************************************NKWKESPPVVSPKSYYQSYNENGPSERLDIRGRI***H******EEPPLALFAICTPFGPP*********VMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYKNSKPDFVISTHRPLME**************************************************************************************************************************************************YYPEYQPYTVSNGFSLPTYEVNKSNDC***********************************************************************YLLERSFT
MHKIKEENQYRSRGELGRYLLRYHFVLTPLNSVINLITHAIYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPYITLPLCSDLPQSHKLPSKSLNS***************SNHLVTPKVEDIKSESFNYSEVPRQTVLMWGSNPSRSPPASPILPNGHINYPSQEIKKYNGDPLKSLAEMNTIGENKW*****************ENGPSERLDIRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYKNSKPDFVISTHRPLMEEEGRDLLGKRTMDFKVSYLDAGLNNSYFSDS****************************VNRRYKTQLRDFLSTCR***************TPAPPIEYLTPPDAVAAAYSNMYTTGYSATTPEYMSQSLYDNRLPYENLFHQYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPFESDIVHQSVYELVHSEDREELQRQLMWNSFLPPESAGISLQECFLQENSYLLERSFT
**********RSRGELGRYLLRYHFVLTPLNSVINLITHAIYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQT*****************PLCSDLPQSHKLPSKSLNSKSLDGLSSNDSSPVPSNHLVTPKVEDIKSESFNYSEVPRQTVLMWGSNPSRS*******************KKYNGDPLKSLAEMNTIGENKWKESPPVVSPKSYYQSYNENGPSERLDIRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYKNSKPDFVISTHRPLMEEEGRDLLGKRTMDFKVSYLDAGLNNSYFS************************************TQ*******C*******AQHAAPPPPTPAPPIEYLTPPDAVAAAYSNMYTTGYSATTPEYMSQSLYDNRLPYENLFHQYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPFESDIVHQSVYELVHSEDREELQRQLMWNSFLPPESAGISLQECF***N*********
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKIKEENQYRSRGELGRYLLRYHFVLTPLNSVINLITHAIYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPYITLPLCSDLPQSHKLPSKSLNSKSLDGLSSNDSSPVPSNHLVTPKVEDIKSESFNYSEVPRQTVLMWGSNPSRSPPASPILPNGHINYPSQEIKKYNGDPLKSLAEMNTIGENKWKESPPVVSPKSYYQSYNENGPSERLDIRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYKNSKPDFVISTHRPLMEEEGRDLLGKRTMDFKVSYLDAGLNNSYFSDSDQLTPSHQTLAPSPGSAQSGSSSTTPQRVNRRYKTQLRDFLSTCRTKRKMSAQHAAPPPPTPAPPIEYLTPPDAVAAAYSNMYTTGYSATTPEYMSQSLYDNRLPYENLFHQYRPYYPEYQPYTVSNGFSLPTYEVNKSNDCDKLYCHQTLTADQNSKGYSSPFESDIVHQSVYELVHSEDREELQRQLMWNSFLPPESAGISLQECFLQENSYLLERSFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query630 2.2.26 [Sep-21-2011]
P41738 853 Aryl hydrocarbon receptor yes N/A 0.250 0.185 0.463 2e-42
O02747 847 Aryl hydrocarbon receptor yes N/A 0.317 0.236 0.408 6e-42
Q8R4S4 854 Aryl hydrocarbon receptor N/A N/A 0.250 0.185 0.457 1e-41
Q8R4S2 854 Aryl hydrocarbon receptor N/A N/A 0.250 0.185 0.457 1e-41
Q95LD9 845 Aryl hydrocarbon receptor N/A N/A 0.250 0.186 0.469 1e-41
Q8R4S7 854 Aryl hydrocarbon receptor N/A N/A 0.250 0.185 0.457 5e-41
Q8R4S5 883 Aryl hydrocarbon receptor N/A N/A 0.249 0.177 0.453 5e-41
P30561 848 Aryl hydrocarbon receptor yes N/A 0.249 0.185 0.453 8e-41
Q8R4S6 848 Aryl hydrocarbon receptor N/A N/A 0.249 0.185 0.453 1e-40
P35869 848 Aryl hydrocarbon receptor yes N/A 0.247 0.183 0.456 2e-40
>sp|P41738|AHR_RAT Aryl hydrocarbon receptor OS=Rattus norvegicus GN=Ahr PE=1 SV=2 Back     alignment and function desciption
 Score =  174 bits (440), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 114/164 (69%), Gaps = 6/164 (3%)

Query: 233 LDIRGRIKILHGQNRK-----LEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLS 287
           ++ +GR+K LHGQN+K     L  P LALFAI TP  PPS+LEI  K  +F++KHKLD +
Sbjct: 235 MNFQGRLKYLHGQNKKGKDGALLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFT 294

Query: 288 LVSMDQRGKMLLGYSDTELANMG-GYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTN 346
            +  D +G+++LGY++ EL N G GY  +H  D+ + A +H  ++KTG SGM  +R    
Sbjct: 295 PIGCDAKGQLILGYTEVELCNKGSGYQFIHAADMLHCAESHIRMIKTGESGMTVFRLLAK 354

Query: 347 DGGWQWLQTSSRLVYKNSKPDFVISTHRPLMEEEGRDLLGKRTM 390
              W+W+Q+++RL+Y+N +PD++I+T RPL +EEGR+ L KR+M
Sbjct: 355 HSRWRWVQSNARLIYRNGRPDYIIATQRPLTDEEGREHLQKRSM 398
Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues.
Rattus norvegicus (taxid: 10116)
>sp|O02747|AHR_RABIT Aryl hydrocarbon receptor OS=Oryctolagus cuniculus GN=AHR PE=2 SV=1 Back     alignment and function description
>sp|Q8R4S4|AHR_MUSSI Aryl hydrocarbon receptor OS=Mus spicilegus GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|Q8R4S2|AHR_MUSSP Aryl hydrocarbon receptor OS=Mus spretus GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|Q95LD9|AHR_DELLE Aryl hydrocarbon receptor OS=Delphinapterus leucas GN=AHR PE=2 SV=1 Back     alignment and function description
>sp|Q8R4S7|AHR_MUSCR Aryl hydrocarbon receptor OS=Mus caroli GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|Q8R4S5|AHR_MUSMM Aryl hydrocarbon receptor OS=Mus musculus molossinus GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|P30561|AHR_MOUSE Aryl hydrocarbon receptor OS=Mus musculus GN=Ahr PE=1 SV=3 Back     alignment and function description
>sp|Q8R4S6|AHR_MUSMC Aryl hydrocarbon receptor OS=Mus musculus castaneus GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|P35869|AHR_HUMAN Aryl hydrocarbon receptor OS=Homo sapiens GN=AHR PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query630
307200794704 Aryl hydrocarbon receptor [Harpegnathos 0.515 0.461 0.659 1e-122
332018425 759 Aryl hydrocarbon receptor [Acromyrmex ec 0.498 0.413 0.663 1e-121
328780897 1099 PREDICTED: LOW QUALITY PROTEIN: hypothet 0.504 0.289 0.689 1e-121
242012861 747 aryl hydrocarbon receptor, putative [Ped 0.476 0.401 0.741 1e-120
307183517 750 Aryl hydrocarbon receptor [Camponotus fl 0.498 0.418 0.668 1e-120
91091736624 PREDICTED: similar to spineless CG6993-P 0.466 0.471 0.714 1e-115
197108534582 spineless [Tribolium castaneum] 0.466 0.505 0.714 1e-115
345486455 903 PREDICTED: hypothetical protein LOC10012 0.496 0.346 0.621 1e-114
157130624 753 aryl hydrocarbon receptor [Aedes aegypti 0.476 0.398 0.68 1e-114
157130620690 aryl hydrocarbon receptor [Aedes aegypti 0.476 0.434 0.68 1e-114
>gi|307200794|gb|EFN80847.1| Aryl hydrocarbon receptor [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  446 bits (1147), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 252/382 (65%), Positives = 272/382 (71%), Gaps = 57/382 (14%)

Query: 232 RLDIRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSM 291
           RLDIRGR+K+LHGQNRK EEPPLALFA+CTPFGPPSLLE+P KEVMFKSKHKLDL+LV+M
Sbjct: 74  RLDIRGRVKVLHGQNRKTEEPPLALFALCTPFGPPSLLEVPQKEVMFKSKHKLDLALVTM 133

Query: 292 DQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQ 351
           DQRGKMLLGYSD EL N+GGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQT DGGWQ
Sbjct: 134 DQRGKMLLGYSDAELTNLGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTKDGGWQ 193

Query: 352 WLQTSSRLVYKNSKPDFVISTHRPLMEEEGRDLLGKRTMDFKVSYLDAGLNNSYFSDSDQ 411
           WLQTSSRLVYKNSKPDFV+STHRPLMEEEGRDLLGKRTMDFKVSYLDAGL NSYFSDSD 
Sbjct: 194 WLQTSSRLVYKNSKPDFVLSTHRPLMEEEGRDLLGKRTMDFKVSYLDAGLTNSYFSDSDS 253

Query: 412 LTPSHQ--TLAPSPGSAQSGSSSTTPQRVNRRYKTQLRDFLSTCRTKR-KMSAQHAAPPP 468
           LT S    TL   P           PQRVNRRYKTQLRDFLSTCR+KR K++AQ +  PP
Sbjct: 254 LTGSVMTPTLPAQPA----------PQRVNRRYKTQLRDFLSTCRSKRTKLTAQSSVSPP 303

Query: 469 PTP-APPIEYL----------------------TP--PDAVAAAYSNMYTTGYSATTPEY 503
            TP    ++YL                      TP  P AVAA+     TT Y   T  Y
Sbjct: 304 VTPTVASVDYLAADTSAAAAVAAAYSNLNTMYPTPYAPTAVAASTDPSLTT-YIGHTGNY 362

Query: 504 MSQSLY-----DNR---LPYENLFHQYRP---YYPEYQPYTVSNGF---SLPTYEVNK-- 547
             Q+LY     DNR      ENLF QYRP   YYPEY   T  NGF   SLPTYE ++  
Sbjct: 363 -HQTLYPATALDNRYLTAATENLF-QYRPLSSYYPEYHTGTTYNGFIDVSLPTYETHQLT 420

Query: 548 SNDCDKLYCHQTLTADQNSKGY 569
           S   DKLYC Q  + +    GY
Sbjct: 421 SKTEDKLYCQQLGSGESPKYGY 442

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332018425|gb|EGI59019.1| Aryl hydrocarbon receptor [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328780897|ref|XP_394737.4| PREDICTED: LOW QUALITY PROTEIN: hypothetical protein LOC411264 [Apis mellifera] Back     alignment and taxonomy information
>gi|242012861|ref|XP_002427145.1| aryl hydrocarbon receptor, putative [Pediculus humanus corporis] gi|212511416|gb|EEB14407.1| aryl hydrocarbon receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307183517|gb|EFN70296.1| Aryl hydrocarbon receptor [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91091736|ref|XP_967876.1| PREDICTED: similar to spineless CG6993-PA [Tribolium castaneum] gi|270001263|gb|EEZ97710.1| spineless [Tribolium castaneum] Back     alignment and taxonomy information
>gi|197108534|gb|ACH42695.1| spineless [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345486455|ref|XP_001607569.2| PREDICTED: hypothetical protein LOC100123827 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|157130624|ref|XP_001661947.1| aryl hydrocarbon receptor [Aedes aegypti] gi|108871838|gb|EAT36063.1| AAEL011825-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|157130620|ref|XP_001661945.1| aryl hydrocarbon receptor [Aedes aegypti] gi|108871836|gb|EAT36061.1| AAEL011825-PC [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query630
FB|FBgn0003513 1048 ss "spineless" [Drosophila mel 0.452 0.271 0.675 2e-97
ZFIN|ZDB-GENE-050922-1 940 ahr1b "aryl hydrocarbon recept 0.260 0.174 0.482 3.7e-42
UNIPROTKB|I3LF82 849 AHR "Uncharacterized protein" 0.395 0.293 0.386 1e-40
UNIPROTKB|E1BY63586 LOC100859347 "Uncharacterized 0.376 0.404 0.389 1.6e-40
UNIPROTKB|F1NWS4588 LOC100859347 "Uncharacterized 0.276 0.295 0.461 3.3e-40
UNIPROTKB|F1ML85 844 AHR "Uncharacterized protein" 0.360 0.268 0.408 9.5e-40
UNIPROTKB|F1NLX8 839 AHR "Uncharacterized protein" 0.355 0.266 0.396 1.5e-39
UNIPROTKB|E2QWU8 853 AHR "Uncharacterized protein" 0.250 0.185 0.493 2.7e-39
RGD|2074 853 Ahr "aryl hydrocarbon receptor 0.250 0.185 0.463 7.6e-38
UNIPROTKB|G3V6M2 853 Ahr "RCG61977, isoform CRA_b" 0.250 0.185 0.463 7.6e-38
FB|FBgn0003513 ss "spineless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 968 (345.8 bits), Expect = 2.0e-97, P = 2.0e-97
 Identities = 208/308 (67%), Positives = 222/308 (72%)

Query:   232 RLDIRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSM 291
             RLDIRGRIK+LHGQNRK EEPPLALFA CTPFGPPSLLEIPHKE MFKSKHKLD SLVSM
Sbjct:   225 RLDIRGRIKVLHGQNRKTEEPPLALFAYCTPFGPPSLLEIPHKENMFKSKHKLDFSLVSM 284

Query:   292 DQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQ 351
             DQRGK +LGY+D EL NMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYR+Q  DG WQ
Sbjct:   285 DQRGKHILGYADAELVNMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRYQKKDGEWQ 344

Query:   352 WLQTSSRLVYKNSKPDFVISTHRPLMEEEGRDLLGKRTMDFKVSYLDAGLNNSYFSDSDQ 411
             WLQTSSRLVYKNSKPDFVI THR LM+EEG DLLGKRTMDFKVSYLD GL ++YFS++DQ
Sbjct:   345 WLQTSSRLVYKNSKPDFVICTHRQLMDEEGHDLLGKRTMDFKVSYLDTGLASTYFSEADQ 404

Query:   412 LTPSHQTLXXXXXXXXXXXXXXXXXRVNRRYKTQLRDFLSTCRTKRKMSAQHXXXXXXXX 471
             L     T                  R NRRYKTQLRDFLSTCR+KRK+  Q+        
Sbjct:   405 LVVPPST----SPTAHALPPPVTPTRPNRRYKTQLRDFLSTCRSKRKLQQQNQPQTQQTS 460

Query:   472 -----------XXXIEYLTPPDA-VAAAYSN---MYTTG-Y-SATTPEYMSQSLYDNRL- 513
                           +EYL  P A VAAAYSN   MYTT  Y SA    YM  S+  N   
Sbjct:   461 PLGGQVGSPAPAVAVEYLPDPAAAVAAAYSNLNPMYTTSPYASAADNLYMGSSMPANAFY 520

Query:   514 PY-ENLFH 520
             P  ENLFH
Sbjct:   521 PVSENLFH 528
GO:0005634 "nucleus" evidence=ISS;IDA;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0003677 "DNA binding" evidence=ISS
GO:0006366 "transcription from RNA polymerase II promoter" evidence=NAS
GO:0007469 "antennal development" evidence=IEP
GO:0048800 "antennal morphogenesis" evidence=IMP
GO:0004871 "signal transducer activity" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0010092 "specification of organ identity" evidence=IMP
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0036011 "imaginal disc-derived leg segmentation" evidence=IMP
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0048814 "regulation of dendrite morphogenesis" evidence=IMP
ZFIN|ZDB-GENE-050922-1 ahr1b "aryl hydrocarbon receptor 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LF82 AHR "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BY63 LOC100859347 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWS4 LOC100859347 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1ML85 AHR "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLX8 AHR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWU8 AHR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|2074 Ahr "aryl hydrocarbon receptor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6M2 Ahr "RCG61977, isoform CRA_b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query630
pfam0844790 pfam08447, PAS_3, PAS fold 4e-16
cd00130103 cd00130, PAS, PAS domain; PAS motifs appear in arc 6e-10
TIGR00229124 TIGR00229, sensory_box, PAS domain S-box 2e-05
smart0008643 smart00086, PAC, Motif C-terminal to PAS motifs (l 2e-04
>gnl|CDD|219844 pfam08447, PAS_3, PAS fold Back     alignment and domain information 
 Score = 73.6 bits (181), Expect = 4e-16
 Identities = 30/89 (33%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 289 VSMDQRGKMLLGYSDTELAN--MGGYDLVHYDDLAYVASAHQE-LLKTGASGMIAYRFQT 345
           +    R + +LGY+  EL +   G  DLVH +D   V  A QE  LK G      YR + 
Sbjct: 2   IYWSPRFEEILGYTPEELKSSYEGWLDLVHPEDRERVRRALQEFSLKKGEPYSGEYRIRR 61

Query: 346 NDGGWQWLQTSSRLVY-KNSKPDFVISTH 373
            DG ++W++   R +  +N KP  VI   
Sbjct: 62  KDGEYRWVEARGRPIRDENGKPVRVIGVA 90

The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya. Length = 90
>gnl|CDD|238075 cd00130, PAS, PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>gnl|CDD|232884 TIGR00229, sensory_box, PAS domain S-box Back     alignment and domain information
>gnl|CDD|197509 smart00086, PAC, Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 630
KOG3558|consensus 768 100.0
KOG3560|consensus712 100.0
KOG3559|consensus598 100.0
KOG3560|consensus 712 99.96
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 99.92
KOG3561|consensus803 99.9
KOG3753|consensus 1114 99.72
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 99.46
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 99.31
PRK09776 1092 putative diguanylate cyclase; Provisional 99.2
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 99.15
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 99.15
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 99.13
PRK13560 807 hypothetical protein; Provisional 99.09
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 99.09
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 99.01
PRK13560807 hypothetical protein; Provisional 98.97
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 98.8
PRK13559361 hypothetical protein; Provisional 98.63
PRK09776 1092 putative diguanylate cyclase; Provisional 98.6
PRK13557 540 histidine kinase; Provisional 98.59
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 98.58
PRK13558 665 bacterio-opsin activator; Provisional 98.51
PRK10060 663 RNase II stability modulator; Provisional 98.44
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 98.44
PRK11091 779 aerobic respiration control sensor protein ArcB; P 98.43
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 98.1
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 98.0
PF14598111 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W 97.39
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 97.33
PRK11360607 sensory histidine kinase AtoS; Provisional 97.31
KOG3558|consensus 768 97.26
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 97.22
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 96.92
KOG3561|consensus 803 96.78
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mech 96.37
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 95.94
PF12860115 PAS_7: PAS fold 95.93
smart0008643 PAC Motif C-terminal to PAS motifs (likely to cont 95.58
smart0009167 PAS PAS domain. PAS motifs appear in archaea, euba 94.48
KOG3559|consensus 598 93.96
KOG0501|consensus 971 93.85
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 93.74
COG5002459 VicK Signal transduction histidine kinase [Signal 92.85
PRK11006430 phoR phosphate regulon sensor protein; Provisional 92.19
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 91.73
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 91.42
TIGR02373124 photo_yellow photoactive yellow protein. Members o 90.31
PF07310137 PAS_5: PAS domain; InterPro: IPR009922 This family 89.38
PRK11086542 sensory histidine kinase DcuS; Provisional 89.22
PF08446110 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold 87.25
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 87.16
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 84.97
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 82.81
COG3829560 RocR Transcriptional regulator containing PAS, AAA 82.78
PF08670148 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEK 82.02
>KOG3558|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-46  Score=414.56  Aligned_cols=266  Identities=25%  Similarity=0.337  Sum_probs=221.0

Q ss_pred             CCCccCccccCcccccCccCCCCCC--cCCCCCCCcceeccccc-CCCCCCccceeeeeccCCCCCCCCCCccCCCCcEE
Q psy8265         104 QSHKLPSKSLNSKSLDGLSSNDSSP--VPSNHLVTPKVEDIKSE-SFNYSEVPRQTVLMWGSNPSRSPPASPILPNGHIN  180 (630)
Q Consensus       104 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~g~~s~~i~d~~~~-~f~~~d~l~Q~~L~~gfll~~~~~~~Vls~dGkIl  180 (630)
                      |..++.+.-|++-||-++..++.++  .+..|.-. .+++--+. --|.++-..|.+  |||.+       |++.||+|+
T Consensus        73 Plp~aisshLDkaSimRLtISyLRlrk~a~~g~~p-~~e~~~~~~e~~l~~~iLqsL--DGFVm-------~l~~dG~~l  142 (768)
T KOG3558|consen   73 PLPAAISSHLDKASIMRLTISYLRLRKFAGAGDPP-RAEGEPENLEQHLGDHILQSL--DGFVM-------ALTQDGDFL  142 (768)
T ss_pred             CCcchhhhhhhhHHHHHHHHHHHHHHHHhhcCCcc-cccCCCcchhhhhhhhHHhhc--cceEE-------EEccCCCEE
Confidence            3555666789999999998777766  33333321 22222211 001134455666  89999       999999999


Q ss_pred             eccccchhhcCCChhhhhhhccccCccccCCCCCCCCC--------Cc--c-----ccCCCCCCeEEeee----eee---
Q psy8265         181 YPSQEIKKYNGDPLKSLAEMNTIGENKWKESPPVVSPK--------SY--Y-----QSYNENGPSERLDI----RGR---  238 (630)
Q Consensus       181 YVSEnVs~~LGysqeEL~q~~liGqSi~D~vHP~ls~k--------~~--~-----c~ld~rSfF~RMk~----rGR---  238 (630)
                      ||||||++|||++|+|     ++|.|||||+||+++.+        .-  +     ....+|+||+||||    |||   
T Consensus       143 YiSEtVS~yLGLSQvE-----LTG~SvFDfiHP~DheE~~eqL~l~~~~p~~~es~~~~teRsFflRMKsTLT~RGRtln  217 (768)
T KOG3558|consen  143 YISETVSIYLGLSQVE-----LTGSSVFDFIHPCDHEEIAEQLGLRLTTPEVKESTDTSTERSFFLRMKSTLTKRGRTLN  217 (768)
T ss_pred             EEechhHhhhCcccee-----eecchhhhccCccCHHHHHHHhccccCCCcccccccCccceeEEEEeeeeeccCCceee
Confidence            9999999999999999     49999999999997653        00  0     01126899999997    786   


Q ss_pred             -----EEEeeccccc----C----------CCCCeEEEEEEeeCCCCCCccccccceeeEEeeccCceeeeecccccccc
Q psy8265         239 -----IKILHGQNRK----L----------EEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLDLSLVSMDQRGKMLL  299 (630)
Q Consensus       239 -----lKvLhg~~rk----s----------e~p~lcLVAIarPL~~ps~~Ei~l~s~~FiTRhslDGkftyVDprv~~LL  299 (630)
                           ||++||+++.    .          ..|-+|||++|.+|++|+..|+++.+.+|++||++|++|+||++|+..++
T Consensus       218 lKSa~yKvlh~tgh~rv~~~~sh~s~~~g~~~Pl~~lV~~a~alp~ps~~EipL~~~~FvtRhs~DmkityCedRisdlm  297 (768)
T KOG3558|consen  218 LKSAGYKVLHCTGHLRVYNNPSHNSPLCGYKEPLLGLVALAEALPPPSYTEIPLDCHMFVTRHSLDMKITYCEDRISDLM  297 (768)
T ss_pred             eeccceeEEEEeeeeeeccCCCCCCcccCccccchheeeeeccCCCCcccccccCCceeEEeeecceeEEEEchhHHHHh
Confidence                 8999987652    1          13456999999999999999999999999999999999999999999999


Q ss_pred             CCChhhhccCcccceeccccHHHHHHHHHHHHhcCCceeeEEEEEecCCcEEEEEEEEEEEEe--CCCceEEEEEEEecC
Q psy8265         300 GYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYK--NSKPDFVISTHRPLM  377 (630)
Q Consensus       300 GYspEELlG~S~ydlIHPDDl~~V~eah~~lLkkGqs~s~eYRfrtKdGswVWVeTsa~li~~--nGkpe~IVgt~rdIS  377 (630)
                      ||+|+||+|+++|+|||+.|.+++++.|.+++.|||+++..|||+.|+|+|+|+|++++++++  |+.+++|||+|++|+
T Consensus       298 ~y~PeeLvGrS~Ye~~Ha~Ds~~v~KSh~dL~~KGQv~TgyYR~lak~GGyvWlQTqATVi~~tkn~q~q~IicVnYVlS  377 (768)
T KOG3558|consen  298 DYEPEELVGRSCYEFVHALDSDRVRKSHHDLLTKGQVVTGYYRLLAKNGGYVWLQTQATVIYNTKNPQEQNIICVNYVLS  377 (768)
T ss_pred             cCCHHHhhchhHHHhhhHhhhhHHHHHHHHHHhcCccchhHHHHHHhcCCeEEEEeeeEEEecCCCCCcceEEEEEeeec
Confidence            999999999999999999999999999999999999999999999999999999999999985  788899999999999


Q ss_pred             chhhHHH
Q psy8265         378 EEEGRDL  384 (630)
Q Consensus       378 ErE~~E~  384 (630)
                      +.|.+++
T Consensus       378 ~~e~~~~  384 (768)
T KOG3558|consen  378 NIEEEDL  384 (768)
T ss_pred             cccccCc
Confidence            9876654

>KOG3560|consensus Back     alignment and domain information
>KOG3559|consensus Back     alignment and domain information
>KOG3560|consensus Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>KOG3753|consensus Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PF14598 PAS_11: PAS domain; PDB: 1P97_A 3F1O_A 2A24_A 3H7W_A 3F1P_A 3H82_A 3F1N_A 4F3L_B 4DJ3_A 2KDK_A Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>KOG3558|consensus Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>KOG3559|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02373 photo_yellow photoactive yellow protein Back     alignment and domain information
>PF07310 PAS_5: PAS domain; InterPro: IPR009922 This family contains a number of hypothetical bacterial proteins of unknown function approximately 200 residues long Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PF08446 PAS_2: PAS fold; InterPro: IPR013654 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF08670 MEKHLA: MEKHLA domain; InterPro: IPR013978 The MEKHLA domain shares similarity with the PAS domain and is found in the 3' end of plant HD-ZIP III homeobox genes, and bacterial proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query630
4f3l_A361 Crystal Structure Of The Heterodimeric Clock:bmal1 2e-14
2a24_A107 Haddock Structure Of Hif-2aARNT PAS-B Heterodimer L 9e-08
1p97_A114 Nmr Structure Of The C-Terminal Pas Domain Of Hif2a 1e-07
3f1n_A117 Crystal Structure Of A High Affinity Heterodimer Of 2e-07
4h6j_A113 Identification Of Cys 255 In Hif-1 As A Novel Site 2e-07
4f3l_B387 Crystal Structure Of The Heterodimeric Clock:bmal1 3e-07
4h6j_B116 Identification Of Cys 255 In Hif-1 As A Novel Site 5e-04
>pdb|4F3L|A Chain A, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 361 Back     alignment and structure 
Iteration: 1

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (52%), Gaps = 4/116 (3%)
Query: 269 LEIPHKEVMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQ 328
           +E P++E  F S+H L+   + +D R   ++GY   E+    GYD  H DDL  +A  H+
Sbjct: 246 VEEPNEE--FTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHE 303
Query: 329 ELLKTGASGMIAYRFQTNDGGWQWLQTSSRLVYK--NSKPDFVISTHRPLMEEEGR 382
            L++ G      YRF T    W WLQT   + Y   NS+P+F++ TH  +   E R
Sbjct: 304 HLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVR 359
>pdb|2A24|A Chain A, Haddock Structure Of Hif-2aARNT PAS-B Heterodimer Length = 107 Back     alignment and structure
>pdb|1P97|A Chain A, Nmr Structure Of The C-Terminal Pas Domain Of Hif2a Length = 114 Back     alignment and structure
>pdb|3F1N|A Chain A, Crystal Structure Of A High Affinity Heterodimer Of Hif2 Alpha And Arnt C-Terminal Pas Domains, With Internally Bound Ethylene Glycol. Length = 117 Back     alignment and structure
>pdb|4H6J|A Chain A, Identification Of Cys 255 In Hif-1 As A Novel Site For Development Of Covalent Inhibitors Of Hif-1 ARNT PASB DOMAIN PROTEIN-Protein Interaction Length = 113 Back     alignment and structure
>pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 387 Back     alignment and structure
>pdb|4H6J|B Chain B, Identification Of Cys 255 In Hif-1 As A Novel Site For Development Of Covalent Inhibitors Of Hif-1 ARNT PASB DOMAIN PROTEIN-Protein Interaction Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query630
4f3l_A361 Mclock, circadian locomoter output cycles protein 3e-44
4f3l_A 361 Mclock, circadian locomoter output cycles protein 4e-04
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 3e-35
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 6e-33
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 2e-05
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 5e-04
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 1e-32
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 1e-32
4dj2_A 320 Period circadian protein homolog 1; PAS domains, c 2e-05
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 5e-32
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 6e-32
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 2e-28
3rty_A339 Period circadian protein; PAS domain, signalling, 8e-28
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 5e-19
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 4e-10
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 5e-10
3icy_A118 Sensor protein; sensory box histidine kinase/respo 2e-07
3mr0_A142 Sensory box histidine kinase/response regulator; P 6e-07
3eeh_A125 Putative light and redox sensing histidine kinase; 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3nja_A125 Probable ggdef family protein; structural genomics 2e-05
2r78_A117 Sensor protein; sensory box sensor histidine kinas 4e-05
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
 Score =  160 bits (407), Expect = 3e-44
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 2/172 (1%)

Query: 214 VVSPKSYYQSYNENGPSERLDIRGRIKILHGQNRKLEEPPLALFAICTPFGPPSLLEIPH 273
            V     ++S      S      G I+  H  + +     +A   + TP     +  +  
Sbjct: 189 YVRFIGNFKSLTSVSTSTHNGFEGTIQRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEE 248

Query: 274 KEVMFKSKHKLDLSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKT 333
               F S+H L+   + +D R   ++GY   E+    GYD  H DDL  +A  H+ L++ 
Sbjct: 249 PNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQY 308

Query: 334 GASGMIAYRFQTNDGGWQWLQTSSRLVY--KNSKPDFVISTHRPLMEEEGRD 383
           G      YRF T    W WLQT   + Y   NS+P+F++ TH  +   E R 
Sbjct: 309 GKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRA 360
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A Length = 117 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Length = 309 Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Length = 320 Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Length = 320 Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Length = 317 Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 2b02_A* 2k7s_A 2a24_B Length = 121 Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Length = 339 Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Length = 132 Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Length = 115 Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Length = 111 Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Length = 118 Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Length = 142 Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Length = 125 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Length = 125 Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query630
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 100.0
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 100.0
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 100.0
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 100.0
4f3l_A361 Mclock, circadian locomoter output cycles protein 100.0
3rty_A339 Period circadian protein; PAS domain, signalling, 100.0
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 99.84
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 99.79
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 99.77
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 99.68
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 99.58
3mr0_A142 Sensory box histidine kinase/response regulator; P 99.57
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 99.56
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 99.48
3nja_A125 Probable ggdef family protein; structural genomics 99.41
3icy_A118 Sensor protein; sensory box histidine kinase/respo 99.4
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 99.37
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 99.37
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 99.37
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 99.3
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 99.3
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 99.26
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 99.25
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 99.23
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 99.21
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 99.21
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.19
3eeh_A125 Putative light and redox sensing histidine kinase; 99.19
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 99.18
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 99.15
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 99.15
1byw_A110 Protein (human ERG potassium channel); PAS domain, 99.1
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 99.1
3mjq_A126 Uncharacterized protein; NESG, structural genomics 99.1
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 99.09
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 99.07
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 99.05
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 99.01
2r78_A117 Sensor protein; sensory box sensor histidine kinas 98.98
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 98.93
3olo_A118 Two-component sensor histidine kinase; structural 98.87
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 98.86
4dj3_A 317 Period circadian protein homolog 3; PAS domain, ci 98.86
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 98.79
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 98.76
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 98.71
3gdi_A 309 Period circadian protein homolog 2; tandem PAS dom 98.71
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 98.69
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 98.67
4dj2_A 320 Period circadian protein homolog 1; PAS domains, c 98.67
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 98.62
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 98.57
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 98.51
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 98.51
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 98.47
3b33_A115 Sensor protein; structural genomics, PAS domain, n 98.45
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 98.4
4f3l_A361 Mclock, circadian locomoter output cycles protein 98.34
2qkp_A151 Uncharacterized protein; structural genomics, unkn 98.16
3rty_A339 Period circadian protein; PAS domain, signalling, 98.14
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 98.06
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 97.81
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 97.77
3vol_A233 Aerotaxis transducer AER2; heme, oxygen sensor pro 97.75
3cax_A369 Uncharacterized protein PF0695; structural genomic 97.53
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 97.5
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 97.46
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 97.08
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 97.01
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 96.69
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 96.65
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 96.56
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 95.72
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 94.27
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 94.77
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 94.63
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 94.48
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 93.92
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 93.75
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 93.5
1nwz_A125 PYP, photoactive yellow protein; PAS, LOV, GAF, do 93.43
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 93.36
3olo_A118 Two-component sensor histidine kinase; structural 93.31
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 93.27
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 93.15
1mzu_A129 PPR; photoactive yellow protein, PAS, PYP, signali 92.97
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 92.86
2r78_A117 Sensor protein; sensory box sensor histidine kinas 92.85
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 92.63
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 92.26
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 92.21
3mjq_A126 Uncharacterized protein; NESG, structural genomics 91.04
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 90.9
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 90.41
1oj5_A132 Steroid receptor coactivator 1A; transcriptional c 89.44
3b33_A115 Sensor protein; structural genomics, PAS domain, n 89.35
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 89.17
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 88.42
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 88.06
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 87.73
2ool_A337 Sensor protein; bacteriophytochrome, photoconversi 87.67
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 87.51
2ool_A337 Sensor protein; bacteriophytochrome, photoconversi 86.96
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 86.77
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 86.59
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 86.45
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 85.7
3icy_A118 Sensor protein; sensory box histidine kinase/respo 85.41
1byw_A110 Protein (human ERG potassium channel); PAS domain, 84.07
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 84.04
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 83.87
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 82.55
3eeh_A125 Putative light and redox sensing histidine kinase; 82.33
3nja_A125 Probable ggdef family protein; structural genomics 82.12
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 80.17
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=2.1e-38  Score=331.58  Aligned_cols=215  Identities=17%  Similarity=0.128  Sum_probs=176.4

Q ss_pred             ccCCCCCCCCCCccCC-CCcEEeccccchhhcCCChhhhhhhccccCccccCCCCCCCCC-------------C------
Q psy8265         160 WGSNPSRSPPASPILP-NGHINYPSQEIKKYNGDPLKSLAEMNTIGENKWKESPPVVSPK-------------S------  219 (630)
Q Consensus       160 ~gfll~~~~~~~Vls~-dGkIlYVSEnVs~~LGysqeEL~q~~liGqSi~D~vHP~ls~k-------------~------  219 (630)
                      +||++       |++. +|+|+||||+|+++|||+|+|     |+|+|++||+||.+..+             .      
T Consensus        36 dgF~~-------vvs~~~G~i~yvS~~~~~~Lg~~~~e-----l~g~s~~d~ihp~D~~~f~~ql~~~~lP~~~~~~~~~  103 (317)
T 4dj3_A           36 DTFAA-------VFSFLSGRLVHISEQAALILNSKRGF-----LKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNNWTQRA  103 (317)
T ss_dssp             TEEEE-------EEETTTCBEEEECTTHHHHTTCCHHH-----HHTSBGGGGBCGGGHHHHHHHTCTTTCCCCC------
T ss_pred             CCEEE-------EEEcCCcEEEEECCHHHHHcCCCHHH-----HcCCchhhhcChhhHHHHHHhhcccCCCCcCCCcccc
Confidence            89988       7766 599999999999999999999     48999999999974321             0      


Q ss_pred             -ccccCCCCCCeEEeeee-----eeEEEeeccccc--------CCCCCeEEEEEEeeCCCCCCccccccceeeEEeeccC
Q psy8265         220 -YYQSYNENGPSERLDIR-----GRIKILHGQNRK--------LEEPPLALFAICTPFGPPSLLEIPHKEVMFKSKHKLD  285 (630)
Q Consensus       220 -~~c~ld~rSfF~RMk~r-----GRlKvLhg~~rk--------se~p~lcLVAIarPL~~ps~~Ei~l~s~~FiTRhslD  285 (630)
                       ..+...+++|||||+|.     .+|+++|++++-        .++...||||+++..++....++++...+|++||++|
T Consensus       104 ~~~~~~~~rsF~CRmr~g~~~~~~~y~~~~~~g~l~~~~~~~~~~~~~~clv~v~~~~~~~~~~~~~~~~~~Fitrh~~d  183 (317)
T 4dj3_A          104 SQYECAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPG  183 (317)
T ss_dssp             ----CCCCCCEEEEECCCCCSSSCCCEEEEEEEEEEECCCCSSSCSCEEEEEEEEECCCTTSSSCCCGGGCEEEEEECTT
T ss_pred             cccCCCCCceEEEEEeCCCCCCCCceEEEEEEeEEEeccCCCCCCCCceEEEEEEecCCCcCCCCcccCCCceEEEecCC
Confidence             01234578999999872     257788876531        1334568998866554433444556667999999999


Q ss_pred             ceeeeeccccccccCCChhhhccCcccceeccccHHHHHHHHHHHHhcCCc---eeeEEEEEecCCcEEEEEEEEEEEEe
Q psy8265         286 LSLVSMDQRGKMLLGYSDTELANMGGYDLVHYDDLAYVASAHQELLKTGAS---GMIAYRFQTNDGGWQWLQTSSRLVYK  362 (630)
Q Consensus       286 GkftyVDprv~~LLGYspEELlG~S~ydlIHPDDl~~V~eah~~lLkkGqs---~s~eYRfrtKdGswVWVeTsa~li~~  362 (630)
                      |+|+|||+++..+|||.++||+|+++++++||||++.+.+.|+++++.|..   .+.+|||++|||+|+|++++++++++
T Consensus       184 G~~~yvs~~~~~lLGY~peELig~s~~~~vHPdD~~~~~~~~~~~l~~~~~~~f~s~~yR~~~kdG~~vwvet~~~~~~n  263 (317)
T 4dj3_A          184 CVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVN  263 (317)
T ss_dssp             SBEEEECTTHHHHHSCCHHHHTTSBGGGGBCTTTTTHHHHHHHHHHHTTTSCCEECCCEEEECTTSCEEEEEEEEEEEEC
T ss_pred             CeEEEEChHHhhhcCcChHHHcCCCHHHeECHHHHHHHHHHHHHHHHcCCCccccceEEEEEccCCCEEEEEEEEEEEEC
Confidence            999999999999999999999999999999999999999999999987554   57899999999999999999999886


Q ss_pred             --CCCceEEEEEEEecCchhhHHHHh
Q psy8265         363 --NSKPDFVISTHRPLMEEEGRDLLG  386 (630)
Q Consensus       363 --nGkpe~IVgt~rdISErE~~E~L~  386 (630)
                        ++++++|||+|+++++.+..+.++
T Consensus       264 p~s~~~e~II~~h~v~~~p~~~dvf~  289 (317)
T 4dj3_A          264 PWSRKVSFIIGRHKVRTSPLNEDVFA  289 (317)
T ss_dssp             SSSCCEEEEEEEEEECCCCSSSCTTC
T ss_pred             CCCCcccEEEEEEEeccCCCCCCccc
Confidence              789999999999999887655444
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>1nwz_A PYP, photoactive yellow protein; PAS, LOV, GAF, domains fold, signaling protein; HET: HC4; 0.82A {Halorhodospira halophila} SCOP: d.110.3.1 PDB: 1kou_A* 1ot9_A* 1otb_A* 1s4r_A* 1s4s_A* 1ts0_A* 1ts6_A* 1ts7_A* 1ts8_A* 1uwn_X* 1uwp_X* 2d01_A* 2phy_A* 2pyp_A* 2pyr_A* 2qj5_A* 2qj7_A* 2qws_A* 2zoh_A* 2zoi_A* ... Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>1mzu_A PPR; photoactive yellow protein, PAS, PYP, signaling protein; HET: HC4; 2.00A {Rhodospirillum centenum} SCOP: d.110.3.1 Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>1oj5_A Steroid receptor coactivator 1A; transcriptional coactivator, complex, LXXLL motif, transcriptional regulation; 2.2A {Mus musculus} SCOP: d.110.3.8 Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2ool_A Sensor protein; bacteriophytochrome, photoconversion, photoreceptor, biliver signaling protein; HET: LBV; 2.20A {Rhodopseudomonas palustris} SCOP: d.110.2.1 d.110.3.9 Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>2ool_A Sensor protein; bacteriophytochrome, photoconversion, photoreceptor, biliver signaling protein; HET: LBV; 2.20A {Rhodopseudomonas palustris} SCOP: d.110.2.1 d.110.3.9 Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 630
d1oj5a_109 d.110.3.8 (A:) PAS domain of steroid receptor coac 4e-17
d1p97a_114 d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-t 1e-06
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: PAS domain of steroid receptor coactivator 1A, NCo-A1
domain: PAS domain of steroid receptor coactivator 1A, NCo-A1
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 75.1 bits (184), Expect = 4e-17
 Identities = 23/102 (22%), Positives = 36/102 (35%), Gaps = 5/102 (4%)

Query: 278 FKSKHKLDLSLVSMDQRGKMLLGYSDTE-LANMGGYDLVHYDD--LAYVASAHQELLKTG 334
           F +K      ++S+D       G +  E L     Y          +Y     QE++  G
Sbjct: 4   FMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRG 63

Query: 335 ASGMIAYRFQTNDGGWQWLQTSSRLVY--KNSKPDFVISTHR 374
            +   +YRF  NDG      T  +L Y        F++  H 
Sbjct: 64  TASSPSYRFILNDGTMLSAHTRCKLCYPQSPDMQPFIMGIHI 105
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query630
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 99.89
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 99.84
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 99.52
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 99.43
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 99.4
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 99.26
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 99.04
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 98.93
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 98.7
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 98.54
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 98.52
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 97.66
d2oola2114 Sensor protein PhyB2 {Rhodopseudomonas palustris [ 97.58
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 97.24
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 97.19
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 96.48
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 96.29
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 96.15
d1mzua_110 PYP domain of sensor histidine kinase Ppr {Rhodosp 96.12
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 95.5
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 95.37
d1nwza_125 Photoactive yellow protein, PYP {Ectothiorhodospir 94.85
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 94.69
d2o9ca2127 Bacteriophytochrome BphP {Deinococcus radiodurans 92.99
d2veaa3127 Phytochrome-like protein Cph1 {Synechocystis sp. p 92.78
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 89.36
d3c2wa3113 Bacteriophytochrome BphP {Pseudomonas aeruginosa [ 88.73
d2o9ca2127 Bacteriophytochrome BphP {Deinococcus radiodurans 85.68
d2veaa3127 Phytochrome-like protein Cph1 {Synechocystis sp. p 82.4
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: PAS domain of steroid receptor coactivator 1A, NCo-A1
domain: PAS domain of steroid receptor coactivator 1A, NCo-A1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.89  E-value=3.6e-24  Score=188.15  Aligned_cols=103  Identities=22%  Similarity=0.314  Sum_probs=93.5

Q ss_pred             eeeEEeeccCceeeeeccccccccCCCh-hhhccCcccceeccccHH--HHHHHHHHHHhcCCceeeEEEEEecCCcEEE
Q psy8265         276 VMFKSKHKLDLSLVSMDQRGKMLLGYSD-TELANMGGYDLVHYDDLA--YVASAHQELLKTGASGMIAYRFQTNDGGWQW  352 (630)
Q Consensus       276 ~~FiTRhslDGkftyVDprv~~LLGYsp-EELlG~S~ydlIHPDDl~--~V~eah~~lLkkGqs~s~eYRfrtKdGswVW  352 (630)
                      ++|++||++||+|++||+++..++||.+ |||+|+++++|+||||++  ..+..++.++.+|+..+.+||+++|||+|+|
T Consensus         2 e~F~trh~~~g~~~~vd~~~~~~~gy~~~eelig~s~~~f~HPeD~~~~~~~~~~~~~~~~g~~~~~~yR~~~kdG~~vW   81 (109)
T d1oj5a_           2 ESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLS   81 (109)
T ss_dssp             CEEEEEECTTCCEEEEECHHHHTTCCSCHHHHHHHHHHHHTSCBTTBCCHHHHHHHHHHHHSEEECCCEEEECTTSCEEE
T ss_pred             ceEEEEECCCceEEEECHHHhhHhhcCCHHHHcCCcHHHeECcccchHHHhhHHHHHHHhhcccchhhhhhhhccCcEEE
Confidence            5799999999999999999999999996 999999999999999975  5566778888999999999999999999999


Q ss_pred             EEEEEEEEEe--CCCceEEEEEEEecCc
Q psy8265         353 LQTSSRLVYK--NSKPDFVISTHRPLME  378 (630)
Q Consensus       353 VeTsa~li~~--nGkpe~IVgt~rdISE  378 (630)
                      |+++++++++  ++++++|||+|+++.|
T Consensus        82 v~t~~~~~~~~~~~~~~~Ii~~h~i~~~  109 (109)
T d1oj5a_          82 AHTRCKLCYPQSPDMQPFIMGIHIIDRE  109 (109)
T ss_dssp             EEEEEEEECC----CCCEEEEEEEEECC
T ss_pred             EEEEEEEEECCCCCcccEEEEEEEEecC
Confidence            9999999985  7889999999999875
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2oola2 d.110.3.9 (A:26-139) Sensor protein PhyB2 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1mzua_ d.110.3.1 (A:) PYP domain of sensor histidine kinase Ppr {Rhodospirillum centenum [TaxId: 34018]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1nwza_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c2wa3 d.110.3.9 (A:5-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2o9ca2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure