Psyllid ID: psy944

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------69
MAEKAVQAVKTGELKIIPDHHTKTWYQWLENNRDWCISRQLWWGHRIPAYYVSFNDPAKKPKNVTEYELWVSGRSKEEAEQKAISKFNVTQADISLRQDEDVLDTWFSSGLFPFSVFGWPDKQRLSANGIHSEVFLHPIVRDAHGRKMSKSLGNVIDPLDVVKGISLAGLQGRLLQDSNLEAAERQRAADGQKRDYPQGIPECGTDALRFALAAYMSQGERTGRRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVGKLLVHPFCERKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGEFTGMKRFDARTRVTELISLSISSQGLIKVDKEIERLNKKEEYLKQVIAKLKDQAAAEDYATKVPENVRTQNSEKLSEAEGELSRLPAALAALKLIQ
cHHHHHHHHHcccEEEEcccHHHHHHHHHHcccccHHHcccccccccccEEEEcccccccccccccccEEEEEccHHHHHHHHHHHcccccccccEEEccccHHccccccccccccccccccccEEccccccEEEEEcEEccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccHHHHHHHHHcHHHHHcccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccccEEccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccEEcccccccccccccccccccEEEEEEEEcccccccEEEEcccccccccccEEEEcccccccccccccEEccccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEccccccccHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHcccccEEEEcccccccccccccccccHHHHHHHHHHHHHHcHHccccccccccccccccccccEEEEcccccHHHHcccccccccccccccccEEEcccHHcccccHHHHHHHHHHc
cHHHHHHHHHHccccEcccHHHHHHHHHHHcccccEEEcccccccccEEEEEcccccccccHHHHHHHHHHHHHccccccccccHcHccccccccEEEcccEEEEEEcccccHHHHHHHHccHHHcccccHHHHEcEccEEccccccccccccccccHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHcccccccHHHHHHHHHHHHHHHHHHHccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEcccHHHHHHHHHHHHHHHHcccEEcccccEEEccccHHHHEEEEEEccccccccEEEEEEEcccccccHHccccccccccccEEEEEEcccccccccEEEEEcccccEEEEEEccccccccEEEEccccHHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHcccccEEEEEccccccccccEcccccccEccccccccccccccccccEccccccHHHHccccccccccccccccccccccccccccccccHHHHccHHHccHccccccEEEcccEEccccccccccccEEEEEcccEEEEEccccccHHHHHHHHHHHHHHHcccccccccHHHHHHcc
MAEKAVQAVKTgelkiipdhhTKTWYQWLENNRDWCISRqlwwghripayyvsfndpakkpknvteYELWVSGRSKEEAEQKAISKFNvtqadislrqdedvldtwfssglfpfsvfgwpdkqrlsangihsevflhpivrdahgrkmskslgnvidpldvVKGISLAGlqgrllqdSNLEAAERQRAadgqkrdypqgipecGTDALRFALAAYMSqgertgrrksigeknpkgkfvmvipppnvtgtlhLGHALTNAVEDSITRWNrmkgkttlwnpgcdhagiATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGssldwdracftmdpklsrAVTEAFVILHEAGDIYRSERLVHWSCSLKSAIsdievdkveltgrtplrvpgyanpvdFGVLASFAyklddgsgeIVVATTRLETLFADVavavhpederykHLVDKveltgrtplrvpgyanpvdFGVLASFAYkledgsgeIVVATTRLETLFADVavavhpederyKHLVGKLlvhpfcerkipiladsfvekdfgtgavkispghdhndyevAQRLnlplitvfneegviigdygeftgmkrfdaRTRVTELISLSISSQGLIKVDKEIERLNKKEEYLKQVIAKLKDQAAAEDYatkvpenvrtqnseklsEAEGELSRLPAALAALKLIQ
MAEKAVqavktgelkiipdhhTKTWYQWLENNRDWCISRQLWWGHRIPAYYVsfndpakkpkNVTEYELWVSGRSKEEAEQKAISKfnvtqadislRQDEDVLDTWFSSGLFPFSVFGWPDKQRLSANGIHSEVFLHPIVRDAHGRKMSKSLGNVIDPLDVVKGISLAGLQGRLLQDSNLEAAERQraadgqkrdypqgIPECGTDALRFALAAYMsqgertgrrksigeknpkgkfvMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTlwnpgcdhagiaTQVVVEKKLWreekktrheigrekfiekVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTgrtplrvpgyanPVDFGVLASFAYKLDDGSGEIVVATTRLETLFADVAvavhpederykhlvdkveltgrtplrvpgyanPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVGKLLVHPFCERKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGEFTGMKRFDARTRVTELIslsissqglikvdkEIERLNKKEEYLKQVIAKLKDQAAAEDyatkvpenvrtqnseklseaegelsrLPAALAALKLIQ
MAEKAVQAVKTGELKIIPDHHTKTWYQWLENNRDWCISRQLWWGHRIPAYYVSFNDPAKKPKNVTEYELWVSGRSKEEAEQKAISKFNVTQADISLRQDEDVLDTWFSSGLFPFSVFGWPDKQRLSANGIHSEVFLHPIVRDAHGRKMSKSLGNVIDPLDVVKGISLAGLQGRLLQDSNLEAAERQRAADGQKRDYPQGIPECGTDALRFALAAYMSQGERTGRRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVGKLLVHPFCERKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGEFTGMKRFDARTRVTElislsissQGLIKVDKEIERLNKKEEYLKQVIAKLKDQAAAEDYATKVPENVRTQNSEKLSEAEGELSRLPAALAALKLIQ
*********KTGELKIIPDHHTKTWYQWLENNRDWCISRQLWWGHRIPAYYVSFNDPAKKPKNVTEYELWV**************KFNVTQADISLRQDEDVLDTWFSSGLFPFSVFGWPDKQRLSANGIHSEVFLHPIVRDAHGRKMSKSLGNVIDPLDVVKGISLAGLQGRLL**************************ECGTDALRFALAAYM*******************KFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVGKLLVHPFCERKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGEFTGMKRFDARTRVTELISLSISSQGLIKVDKEIERLNKKEEYLKQVIAKL**********************************************
*AEKAVQAVKTGELKIIPDHHTKTWYQWLENNRDWCISRQLWWGHRIPAYYVSFNDPAKKPKNVTEYELWVSGRSKEEAEQKAISKFNVTQADISLRQDEDVLDTWFSSGLFPFSVFGWPDKQRLSANGIHSEVFLHPIVRDAHGRKMSKSLGNVIDPLDVVKGISLAGLQGRLL************************IPECGTDALRFALAAYMSQGERTGRRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWR*****RHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVGKLLVHPFCERKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGEFTGMKRFDARTRVTELISLSISSQGLIKVDKEIERLNKKEEYLKQVIAKLKDQAAAEDYATKVPENVRTQNSEKLSEAEGELSRLPAALAALKLI*
*********KTGELKIIPDHHTKTWYQWLENNRDWCISRQLWWGHRIPAYYVSFNDPAKKPKNVTEYELWVSG**********ISKFNVTQADISLRQDEDVLDTWFSSGLFPFSVFGWPDKQRLSANGIHSEVFLHPIVRDAHGRKMSKSLGNVIDPLDVVKGISLAGLQGRLLQDSNLE*************DYPQGIPECGTDALRFALAAYMS********KSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVGKLLVHPFCERKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGEFTGMKRFDARTRVTELISLSISSQGLIKVDKEIERLNKKEEYLKQVIAKLKDQAAAEDYATKVPENVRT************LSRLPAALAALKLIQ
MAEKAVQAVKTGELKIIPDHHTKTWYQWLENNRDWCISRQLWWGHRIPAYYVSFNDPAKKPKNVTEYELWVSGRSKEEAEQKAISKFNVTQADISLRQDEDVLDTWFSSGLFPFSVFGWPDKQRLSANGIHSEVFLHPIVRDAHGRKMSKSLGNVIDPLDVVKGISLAGLQGRLLQDSNLEAAERQRAADGQKRDYPQGIPECGTDALRFALAAYMSQGERTGRRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVGKLLVHPFCERKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGEFTGMKRFDARTRVTELISLSISSQGLIKVDKEIERLNKKEEYLKQVIAKLKDQAAAEDYATKVPENVRTQNSEKLSEAEGELSRLPAALAALKLIQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEKAVQAVKTGELKIIPDHHTKTWYQWLENNRDWCISRQLWWGHRIPAYYVSFNDPAKKPKNVTEYELWVSGRSKEEAEQKAISKFNVTQADISLRQDEDVLDTWFSSGLFPFSVFGWPDKQRLSANGIHSEVFLHPIVRDAHGRKMSKSLGNVIDPLDVVKGISLAGLQGRLLQDSNLEAAERQRAADGQKRDYPQGIPECGTDALRFALAAYMSQGERTGRRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVGKLLVHPFCERKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGEFTGMKRFDARTRVTELISLSISSQGLIKVDKExxxxxxxxxxxxxxxxxxxxxAAAEDYATKVPENVRTQNSEKLSEAEGELSRLPAALAALKLIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query689 2.2.26 [Sep-21-2011]
P49696 1217 Valine--tRNA ligase OS=Ta N/A N/A 0.406 0.230 0.635 1e-104
P26640 1264 Valine--tRNA ligase OS=Ho yes N/A 0.388 0.212 0.651 1e-102
Q9Z1Q9 1263 Valine--tRNA ligase OS=Mu yes N/A 0.390 0.212 0.648 1e-102
Q04462 1264 Valine--tRNA ligase OS=Ra yes N/A 0.388 0.212 0.647 1e-101
Q9U1Q4 1050 Valine--tRNA ligase OS=Ca yes N/A 0.452 0.297 0.482 8e-95
P93736 1108 Valine--tRNA ligase OS=Ar yes N/A 0.471 0.293 0.446 8e-91
Q86KU2 1072 Probable valine--tRNA lig yes N/A 0.357 0.229 0.568 3e-80
Q6MG21 1065 Valine--tRNA ligase, mito no N/A 0.320 0.207 0.626 1e-78
Q3U2A8 1060 Valine--tRNA ligase, mito no N/A 0.320 0.208 0.612 8e-78
Q767M3 1062 Valine--tRNA ligase, mito no N/A 0.384 0.249 0.540 1e-77
>sp|P49696|SYVC_TAKRU Valine--tRNA ligase OS=Takifugu rubripes GN=vars PE=3 SV=1 Back     alignment and function desciption
 Score =  380 bits (977), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/288 (63%), Positives = 226/288 (78%), Gaps = 8/288 (2%)

Query: 191 GQKRDYPQGIPECGTDALRFALAAYMSQGERTGR------RKSIGEKNPKGKFVMVIPPP 244
           G+K+D    +P+  + + ++  AA+    E+ G       RKSIGE+NP+G F+M IPPP
Sbjct: 236 GEKKDVVSPLPD--SYSPQYVEAAWYPWWEKQGFFKPEFGRKSIGEQNPRGIFMMCIPPP 293

Query: 245 NVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKKTR 304
           NVTG+LHLGHALTNA++D++TRW+RM+G+TTLWNPGCDHAGIATQVVVEKKL RE+  +R
Sbjct: 294 NVTGSLHLGHALTNAIQDTLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLMREKGTSR 353

Query: 305 HEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHE 364
           H++GREKFIE+VW+WK EKGDRIY Q+K +GSSLDWDRACFTMDPKLS AV EAF+ +H+
Sbjct: 354 HDLGREKFIEEVWKWKNEKGDRIYHQLKKLGSSLDWDRACFTMDPKLSYAVQEAFIRMHD 413

Query: 365 AGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLDD 424
            G IYRS+RLV+WSCSL SAISDIEVDK EL+GRT L VPGY   V+FGVL SFAYK+D 
Sbjct: 414 EGVIYRSKRLVNWSCSLNSAISDIEVDKNELSGRTLLPVPGYKEKVEFGVLVSFAYKVDG 473

Query: 425 GSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVP 472
              E+VVATTR+ET+  D AVAVHP D RY+HL  K  L      ++P
Sbjct: 474 SDEEVVVATTRIETMLGDTAVAVHPSDSRYQHLKGKTVLHPFCDRKIP 521

Takifugu rubripes (taxid: 31033)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 9
>sp|P26640|SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens GN=VARS PE=1 SV=4 Back     alignment and function description
>sp|Q9Z1Q9|SYVC_MOUSE Valine--tRNA ligase OS=Mus musculus GN=Vars PE=2 SV=1 Back     alignment and function description
>sp|Q04462|SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus GN=Vars PE=2 SV=2 Back     alignment and function description
>sp|Q9U1Q4|SYV_CAEEL Valine--tRNA ligase OS=Caenorhabditis elegans GN=vrs-2 PE=1 SV=1 Back     alignment and function description
>sp|P93736|SYV_ARATH Valine--tRNA ligase OS=Arabidopsis thaliana GN=VALRS PE=1 SV=2 Back     alignment and function description
>sp|Q86KU2|SYVC_DICDI Probable valine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=valS1 PE=3 SV=1 Back     alignment and function description
>sp|Q6MG21|SYVM_RAT Valine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Vars2 PE=3 SV=1 Back     alignment and function description
>sp|Q3U2A8|SYVM_MOUSE Valine--tRNA ligase, mitochondrial OS=Mus musculus GN=Vars2 PE=2 SV=2 Back     alignment and function description
>sp|Q767M3|SYVM_PIG Valine--tRNA ligase, mitochondrial OS=Sus scrofa GN=VARS2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query689
345491468 1042 PREDICTED: valyl-tRNA synthetase-like [N 0.513 0.339 0.529 1e-121
351713155 1144 Valyl-tRNA synthetase, partial [Heteroce 0.528 0.318 0.530 1e-119
157105567 1048 valyl-trna synthetase [Aedes aegypti] gi 0.519 0.341 0.512 1e-114
312385678 1036 hypothetical protein AND_00481 [Anophele 0.509 0.338 0.527 1e-113
195485094 1049 Aats-val [Drosophila yakuba] gi|19417704 0.510 0.335 0.504 1e-113
158289903 1052 AGAP010420-PA [Anopheles gambiae str. PE 0.525 0.344 0.498 1e-113
91094005 1046 PREDICTED: similar to Valyl-tRNA synthet 0.506 0.333 0.522 1e-113
270016168 1047 hypothetical protein TcasGA2_TC006857 [T 0.506 0.333 0.522 1e-113
170049395 1038 valyl-tRNA synthetase [Culex quinquefasc 0.521 0.345 0.504 1e-112
442623560 1055 Valyl-tRNA synthetase, isoform C [Drosop 0.510 0.333 0.5 1e-112
>gi|345491468|ref|XP_001605688.2| PREDICTED: valyl-tRNA synthetase-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  442 bits (1137), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 227/429 (52%), Positives = 279/429 (65%), Gaps = 75/429 (17%)

Query: 188 AADGQKRDYPQGIPECGTDALRFALAAYMSQGERTGRRK-----SIGEKNPKGKFVMVIP 242
            A G+K+D    +P+  +   ++  AA+ S  E++G  K      I E NPKGKFVMVIP
Sbjct: 72  TAPGEKKDVQSPMPDAYSP--QYVEAAWYSWWEKSGFFKPEYNGKISENNPKGKFVMVIP 129

Query: 243 PPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREEKK 302
           PPNVTG LHLGHALTNAVED+ITRWNRMKG+TTLWNPGCDHAGIATQVVVEKKLWREEKK
Sbjct: 130 PPNVTGFLHLGHALTNAVEDAITRWNRMKGRTTLWNPGCDHAGIATQVVVEKKLWREEKK 189

Query: 303 TRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVIL 362
           TRH++GREKF+EK+WEWK EKG RIY+Q+K +GSS DW+RACFTMDPKL RAVTEAFV L
Sbjct: 190 TRHDLGREKFVEKIWEWKNEKGGRIYDQLKKLGSSFDWERACFTMDPKLCRAVTEAFVRL 249

Query: 363 HEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKL 422
           H+ G IYRS RLV+WSC+LKSAISDIEVDKVELTG+T L +PGY   V+FGVL  FAY++
Sbjct: 250 HDEGTIYRSNRLVNWSCTLKSAISDIEVDKVELTGKTLLSIPGYQEKVEFGVLVLFAYEI 309

Query: 423 DDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGV 482
           +D   +IVVATTR+ET+  D A+AVHP D+RY HL+ K         ++P          
Sbjct: 310 EDSDEKIVVATTRIETMLGDTAIAVHPNDKRYAHLIGKHAKHPFCNRKLP---------- 359

Query: 483 LASFAYKLEDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVGKLLVHPFCERKIPIL 542
                          ++A T +E  F   AV + P                         
Sbjct: 360 ---------------IIADTYVEMEFGTGAVKITP------------------------- 379

Query: 543 ADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGEFTGMKRFDA 602
                              HD NDYE+ +R NLP IT+F+++G I+GDYG FTGMKRF A
Sbjct: 380 ------------------AHDPNDYEIGKRHNLPFITIFDDDGNIVGDYGVFTGMKRFHA 421

Query: 603 RTRVTELIS 611
           R  + + ++
Sbjct: 422 RKEIIKELT 430

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|351713155|gb|EHB16074.1| Valyl-tRNA synthetase, partial [Heterocephalus glaber] Back     alignment and taxonomy information
>gi|157105567|ref|XP_001648925.1| valyl-trna synthetase [Aedes aegypti] gi|108880047|gb|EAT44272.1| AAEL004327-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312385678|gb|EFR30111.1| hypothetical protein AND_00481 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195485094|ref|XP_002090947.1| Aats-val [Drosophila yakuba] gi|194177048|gb|EDW90659.1| Aats-val [Drosophila yakuba] Back     alignment and taxonomy information
>gi|158289903|ref|XP_311528.4| AGAP010420-PA [Anopheles gambiae str. PEST] gi|157018382|gb|EAA07254.5| AGAP010420-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|91094005|ref|XP_971250.1| PREDICTED: similar to Valyl-tRNA synthetase CG4062-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270016168|gb|EFA12616.1| hypothetical protein TcasGA2_TC006857 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170049395|ref|XP_001855875.1| valyl-tRNA synthetase [Culex quinquefasciatus] gi|167871251|gb|EDS34634.1| valyl-tRNA synthetase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|442623560|ref|NP_001260946.1| Valyl-tRNA synthetase, isoform C [Drosophila melanogaster] gi|440214359|gb|AGB93478.1| Valyl-tRNA synthetase, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query689
FB|FBgn0027079 1049 Aats-val "Valyl-tRNA synthetas 0.412 0.270 0.619 2.7e-111
ZFIN|ZDB-GENE-010601-1 1264 vars "valyl-tRNA synthetase" [ 0.388 0.212 0.644 3.5e-107
UNIPROTKB|E1BLV6 1001 VARS "Uncharacterized protein" 0.388 0.267 0.651 8.3e-104
UNIPROTKB|B0V043 1264 VARS "Valine--tRNA ligase" [Ho 0.388 0.212 0.651 1.1e-103
UNIPROTKB|H0Y4A6 1183 VARS "Valine--tRNA ligase" [Ho 0.388 0.226 0.651 1.1e-103
UNIPROTKB|P26640 1264 VARS "Valine--tRNA ligase" [Ho 0.388 0.212 0.651 1.1e-103
UNIPROTKB|E2RTJ7 1264 VARS "Uncharacterized protein" 0.384 0.209 0.654 1.4e-103
MGI|MGI:90675 1263 Vars "valyl-tRNA synthetase" [ 0.388 0.212 0.651 1.4e-103
RGD|3950 1264 Vars "valyl-tRNA synthetase" [ 0.388 0.212 0.647 5.8e-103
UNIPROTKB|B4DZ61297 VARS "cDNA FLJ50305, highly si 0.342 0.794 0.722 1.4e-94
FB|FBgn0027079 Aats-val "Valyl-tRNA synthetase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 955 (341.2 bits), Expect = 2.7e-111, Sum P(2) = 2.7e-111
 Identities = 181/292 (61%), Positives = 225/292 (77%)

Query:   187 RAADGQKRDYPQGIPECGTDALRFALAAYMSQGERTG------RRKSIGEKNPKGKFVMV 240
             + A G+K+D    +P+  +   R+  A + S  E+ G       R SI   NP GKFVM+
Sbjct:    77 QTAPGEKKDLSGALPDAYSP--RYVEAQWYSWWEKEGFFTPEYGRASIDAPNPNGKFVMI 134

Query:   241 IPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQVVVEKKLWREE 300
             IPPPNVTG+LHLGHALTNA+ED+ITR++RMKG+TTLW PGCDHAGIATQVVVEK LWR+E
Sbjct:   135 IPPPNVTGSLHLGHALTNAIEDAITRYHRMKGRTTLWVPGCDHAGIATQVVVEKLLWRDE 194

Query:   301 KKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFV 360
             K +RH++GREKFIE++W+W++EKG RIYEQ+K +GSS DW R  FTMDPKL RAVTEAFV
Sbjct:   195 KLSRHDLGREKFIERIWDWRREKGGRIYEQLKSLGSSYDWTRVAFTMDPKLCRAVTEAFV 254

Query:   361 ILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAY 420
              LHE G IYRS RLV+WSC+L+SAISDIEVDKVE+ GRT L +PGY + V+FGVL  FAY
Sbjct:   255 RLHEEGSIYRSSRLVNWSCTLRSAISDIEVDKVEIPGRTFLSIPGYEDKVEFGVLIKFAY 314

Query:   421 KLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVP 472
             K++    EI+VATTR+ET+  D AVAVHP+D+RYKHL  K  +   +  R+P
Sbjct:   315 KVEGSDEEIIVATTRIETMLGDTAVAVHPQDDRYKHLHGKFVVHPFSTRRLP 366
GO:0004832 "valine-tRNA ligase activity" evidence=ISS
GO:0006438 "valyl-tRNA aminoacylation" evidence=ISS
GO:0004818 "glutamate-tRNA ligase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0002161 "aminoacyl-tRNA editing activity" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
ZFIN|ZDB-GENE-010601-1 vars "valyl-tRNA synthetase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLV6 VARS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B0V043 VARS "Valine--tRNA ligase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y4A6 VARS "Valine--tRNA ligase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P26640 VARS "Valine--tRNA ligase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RTJ7 VARS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:90675 Vars "valyl-tRNA synthetase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3950 Vars "valyl-tRNA synthetase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B4DZ61 VARS "cDNA FLJ50305, highly similar to Valyl-tRNA synthetase (EC 6.1.1.9)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.1.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query689
PTZ00419 995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like pro 1e-129
pfam00133 606 pfam00133, tRNA-synt_1, tRNA synthetases class I ( 1e-117
PRK05729 874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 1e-114
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 1e-106
PTZ00419995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like pro 1e-105
COG0525 877 COG0525, ValS, Valyl-tRNA synthetase [Translation, 1e-102
TIGR00422 861 TIGR00422, valS, valyl-tRNA synthetase 5e-91
cd00817382 cd00817, ValRS_core, catalytic core domain of valy 5e-89
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 1e-77
PLN023811066 PLN02381, PLN02381, valyl-tRNA synthetase 5e-76
cd00817382 cd00817, ValRS_core, catalytic core domain of valy 6e-69
PLN02943 958 PLN02943, PLN02943, aminoacyl-tRNA ligase 1e-66
PRK05729874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 1e-62
PRK05729 874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 1e-61
PTZ00419 995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like pro 1e-60
COG0525 877 COG0525, ValS, Valyl-tRNA synthetase [Translation, 7e-58
COG0525877 COG0525, ValS, Valyl-tRNA synthetase [Translation, 2e-55
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 3e-53
TIGR00422861 TIGR00422, valS, valyl-tRNA synthetase 4e-48
TIGR00422 861 TIGR00422, valS, valyl-tRNA synthetase 3e-46
PLN02943958 PLN02943, PLN02943, aminoacyl-tRNA ligase 4e-46
PRK13208 800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 2e-42
pfam00133606 pfam00133, tRNA-synt_1, tRNA synthetases class I ( 4e-41
COG0060 933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translat 4e-40
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 1e-37
PRK149001052 PRK14900, valS, valyl-tRNA synthetase; Provisional 2e-37
TIGR00392 861 TIGR00392, ileS, isoleucyl-tRNA synthetase 2e-37
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core do 2e-34
PLN02943 958 PLN02943, PLN02943, aminoacyl-tRNA ligase 9e-34
PRK13208 800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 2e-33
PRK06039 975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewe 7e-31
PRK05743 912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewe 1e-28
PLN02843 974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 2e-26
COG0495 814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation 2e-21
TIGR00396 842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, euba 6e-21
cd00818338 cd00818, IleRS_core, catalytic core domain of isol 7e-21
COG0060933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translat 1e-18
TIGR00392861 TIGR00392, ileS, isoleucyl-tRNA synthetase 3e-18
PRK13804 961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisi 6e-18
cd00818338 cd00818, IleRS_core, catalytic core domain of isol 9e-18
TIGR00395 938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, arch 1e-17
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core do 8e-17
PLN02563 963 PLN02563, PLN02563, aminoacyl-tRNA ligase 3e-15
cd00812314 cd00812, LeuRS_core, catalytic core domain of leuc 1e-14
pfam13603178 pfam13603, tRNA-synt_1_2, Leucyl-tRNA synthetase, 1e-14
PRK12300 897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 2e-14
PRK06039975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewe 4e-14
PRK13208800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 2e-13
PLN02843974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 4e-12
PRK00390 805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 1e-11
PRK05743912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewe 3e-11
PRK13804961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisi 4e-10
PLN02882 1159 PLN02882, PLN02882, aminoacyl-tRNA ligase 1e-09
PTZ00419995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like pro 2e-09
PLN028821159 PLN02882, PLN02882, aminoacyl-tRNA ligase 4e-08
COG0143 558 COG0143, MetG, Methionyl-tRNA synthetase [Translat 8e-08
PRK05729874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 1e-07
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Rev 1e-06
PTZ00427 1205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putati 1e-06
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I 8e-06
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 9e-06
cd00814319 cd00814, MetRS_core, catalytic core domain of meth 1e-05
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 2e-05
COG0525877 COG0525, ValS, Valyl-tRNA synthetase [Translation, 4e-05
pfam1045866 pfam10458, Val_tRNA-synt_C, Valyl tRNA synthetase 4e-05
PLN02224 616 PLN02224, PLN02224, methionine-tRNA ligase 7e-05
COG0495814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation 9e-05
PTZ004271205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putati 2e-04
PRK12267 648 PRK12267, PRK12267, methionyl-tRNA synthetase; Rev 2e-04
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Rev 3e-04
cd00814319 cd00814, MetRS_core, catalytic core domain of meth 3e-04
PRK12267648 PRK12267, PRK12267, methionyl-tRNA synthetase; Rev 8e-04
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translat 9e-04
PTZ00427 1205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putati 0.001
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I 0.001
PLN023811066 PLN02381, PLN02381, valyl-tRNA synthetase 0.002
PRK00390 805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 0.002
>gnl|CDD|240411 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information 
 Score =  405 bits (1043), Expect = e-129
 Identities = 144/233 (61%), Positives = 176/233 (75%), Gaps = 1/233 (0%)

Query: 229 GEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIAT 288
              N   KFV+V+PPPNVTG LH+GHALT A++DS+ R++RMKG  TLW PG DHAGIAT
Sbjct: 54  KSLNSGKKFVIVLPPPNVTGYLHIGHALTGAIQDSLIRYHRMKGDETLWVPGTDHAGIAT 113

Query: 289 QVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMD 348
           QVVVEKKL +EE KTRH++GRE+F++KVWEWK + G+ I  Q++ +GSSLDW R  FTMD
Sbjct: 114 QVVVEKKLMKEENKTRHDLGREEFLKKVWEWKDKHGNNICNQLRRLGSSLDWSREVFTMD 173

Query: 349 PKLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYAN 408
            + S+AV EAFV L+E G IYR  RLV+W C LK+AISDIEV+  E+   T + +PGY  
Sbjct: 174 EQRSKAVKEAFVRLYEDGLIYRDTRLVNWCCYLKTAISDIEVEFEEIEKPTKITIPGYDK 233

Query: 409 PVDFGVLASFAYKL-DDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDK 460
            V+ GVL  FAY L D G  EIVVATTR+ET+  DVAVAVHP+DERYK L  K
Sbjct: 234 KVEVGVLWHFAYPLEDSGQEEIVVATTRIETMLGDVAVAVHPKDERYKKLHGK 286

Length = 995
>gnl|CDD|215739 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|235582 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|240411 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223599 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232969 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|215509 PLN02943, PLN02943, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|235582 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|235582 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|240411 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223599 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|223599 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|232969 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|232969 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|215509 PLN02943, PLN02943, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|237306 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|215739 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|223138 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|232953 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|215509 PLN02943, PLN02943, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|237306 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|235681 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|235588 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|215452 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|223569 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232956 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|223138 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|232953 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|237514 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|232955 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|222257 pfam13603, tRNA-synt_1_2, Leucyl-tRNA synthetase, Domain 2 Back     alignment and domain information
>gnl|CDD|237049 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|235681 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|237306 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|215452 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|234743 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235588 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|237514 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215477 PLN02882, PLN02882, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|240411 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215477 PLN02882, PLN02882, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|223221 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235582 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|237012 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|220185 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|232957 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|232957 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|223599 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|151031 pfam10458, Val_tRNA-synt_C, Valyl tRNA synthetase tRNA binding arm Back     alignment and domain information
>gnl|CDD|177869 PLN02224, PLN02224, methionine-tRNA ligase Back     alignment and domain information
>gnl|CDD|223569 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|237028 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|237012 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|237028 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|223221 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|220185 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|234743 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 689
COG0060 933 IleS Isoleucyl-tRNA synthetase [Translation, ribos 100.0
PRK06039 975 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PF00133 601 tRNA-synt_1: tRNA synthetases class I (I, L, M and 100.0
PLN02882 1159 aminoacyl-tRNA ligase 100.0
PTZ00427 1205 isoleucine-tRNA ligase, putative; Provisional 100.0
COG0525 877 ValS Valyl-tRNA synthetase [Translation, ribosomal 100.0
PRK13804 961 ileS isoleucyl-tRNA synthetase; Provisional 100.0
PRK05743 912 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PTZ00419 995 valyl-tRNA synthetase-like protein; Provisional 100.0
PLN02843 974 isoleucyl-tRNA synthetase 100.0
PLN02381 1066 valyl-tRNA synthetase 100.0
TIGR00392 861 ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA 100.0
PRK05729 874 valS valyl-tRNA synthetase; Reviewed 100.0
KOG0432|consensus 995 100.0
TIGR00422 861 valS valyl-tRNA synthetase. The valyl-tRNA synthet 100.0
PRK14900 1052 valS valyl-tRNA synthetase; Provisional 100.0
PLN02943 958 aminoacyl-tRNA ligase 100.0
PLN02959 1084 aminoacyl-tRNA ligase 100.0
TIGR00395 938 leuS_arch leucyl-tRNA synthetase, archaeal and cyt 100.0
PRK13208 800 valS valyl-tRNA synthetase; Reviewed 100.0
PRK12300 897 leuS leucyl-tRNA synthetase; Reviewed 100.0
KOG0434|consensus 1070 100.0
TIGR00396 842 leuS_bact leucyl-tRNA synthetase, eubacterial and 100.0
PLN02563 963 aminoacyl-tRNA ligase 100.0
PRK00390 805 leuS leucyl-tRNA synthetase; Validated 100.0
KOG0433|consensus 937 100.0
COG0495 814 LeuS Leucyl-tRNA synthetase [Translation, ribosoma 100.0
KOG0437|consensus 1080 100.0
KOG0435|consensus 876 100.0
KOG0432|consensus995 100.0
COG0525877 ValS Valyl-tRNA synthetase [Translation, ribosomal 100.0
COG0060933 IleS Isoleucyl-tRNA synthetase [Translation, ribos 100.0
cd00817382 ValRS_core catalytic core domain of valyl-tRNA syn 100.0
PLN023811066 valyl-tRNA synthetase 100.0
PTZ00419995 valyl-tRNA synthetase-like protein; Provisional 100.0
PTZ004271205 isoleucine-tRNA ligase, putative; Provisional 100.0
PRK05743912 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PLN028821159 aminoacyl-tRNA ligase 100.0
PRK13804961 ileS isoleucyl-tRNA synthetase; Provisional 100.0
PF00133601 tRNA-synt_1: tRNA synthetases class I (I, L, M and 99.98
PLN02843974 isoleucyl-tRNA synthetase 99.97
PRK149001052 valS valyl-tRNA synthetase; Provisional 99.97
PRK06039975 ileS isoleucyl-tRNA synthetase; Reviewed 99.97
PLN02943958 aminoacyl-tRNA ligase 99.97
PRK05729874 valS valyl-tRNA synthetase; Reviewed 99.97
TIGR00422861 valS valyl-tRNA synthetase. The valyl-tRNA synthet 99.97
KOG0433|consensus937 99.97
TIGR00392861 ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA 99.97
cd00817382 ValRS_core catalytic core domain of valyl-tRNA syn 99.97
PRK13208800 valS valyl-tRNA synthetase; Reviewed 99.96
cd00818338 IleRS_core catalytic core domain of isoleucyl-tRNA 99.96
PLN029591084 aminoacyl-tRNA ligase 99.95
KOG0434|consensus1070 99.95
PLN02563963 aminoacyl-tRNA ligase 99.95
cd00818338 IleRS_core catalytic core domain of isoleucyl-tRNA 99.95
TIGR00396842 leuS_bact leucyl-tRNA synthetase, eubacterial and 99.94
cd00668312 Ile_Leu_Val_MetRS_core catalytic core domain of is 99.94
PLN02224 616 methionine-tRNA ligase 99.93
PLN02610 801 probable methionyl-tRNA synthetase 99.93
PRK12300897 leuS leucyl-tRNA synthetase; Reviewed 99.93
COG0143 558 MetG Methionyl-tRNA synthetase [Translation, ribos 99.92
PRK00390805 leuS leucyl-tRNA synthetase; Validated 99.92
PRK12268 556 methionyl-tRNA synthetase; Reviewed 99.92
COG0143558 MetG Methionyl-tRNA synthetase [Translation, ribos 99.92
cd00812314 LeuRS_core catalytic core domain of leucyl-tRNA sy 99.91
PF09334391 tRNA-synt_1g: tRNA synthetases class I (M); InterP 99.91
cd00814319 MetRS_core catalytic core domain of methioninyl-tR 99.91
PRK00133 673 metG methionyl-tRNA synthetase; Reviewed 99.91
PRK12267648 methionyl-tRNA synthetase; Reviewed 99.9
PRK12267 648 methionyl-tRNA synthetase; Reviewed 99.9
KOG0436|consensus578 99.9
TIGR00395938 leuS_arch leucyl-tRNA synthetase, archaeal and cyt 99.9
TIGR00398530 metG methionyl-tRNA synthetase. The methionyl-tRNA 99.89
PRK12268556 methionyl-tRNA synthetase; Reviewed 99.89
PRK00133673 metG methionyl-tRNA synthetase; Reviewed 99.89
PRK11893511 methionyl-tRNA synthetase; Reviewed 99.89
cd00668312 Ile_Leu_Val_MetRS_core catalytic core domain of is 99.89
KOG0435|consensus876 99.88
PLN02224616 methionine-tRNA ligase 99.88
TIGR00398530 metG methionyl-tRNA synthetase. The methionyl-tRNA 99.88
cd00814319 MetRS_core catalytic core domain of methioninyl-tR 99.88
PF13603185 tRNA-synt_1_2: Leucyl-tRNA synthetase, Domain 2; P 99.87
PLN02610801 probable methionyl-tRNA synthetase 99.87
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosoma 99.86
PF09334391 tRNA-synt_1g: tRNA synthetases class I (M); InterP 99.83
PRK11893511 methionyl-tRNA synthetase; Reviewed 99.82
KOG0436|consensus 578 99.81
cd00812314 LeuRS_core catalytic core domain of leucyl-tRNA sy 99.7
cd00671212 ArgRS_core catalytic core domain of arginyl-tRNA s 99.65
PRK00260463 cysS cysteinyl-tRNA synthetase; Validated 99.62
TIGR00435465 cysS cysteinyl-tRNA synthetase. This model finds t 99.56
PRK01611507 argS arginyl-tRNA synthetase; Reviewed 99.53
KOG0437|consensus1080 99.49
PRK12418384 cysteinyl-tRNA synthetase; Provisional 99.49
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino- 99.49
cd00672213 CysRS_core catalytic core domain of cysteinyl tRNA 99.47
PLN02946557 cysteine-tRNA ligase 99.43
PRK14536490 cysS cysteinyl-tRNA synthetase; Provisional 99.41
PRK14535699 cysS cysteinyl-tRNA synthetase; Provisional 99.36
cd00674353 LysRS_core_class_I catalytic core domain of class 99.35
KOG1247|consensus567 99.34
PTZ00399 651 cysteinyl-tRNA-synthetase; Provisional 99.31
PRK14534481 cysS cysteinyl-tRNA synthetase; Provisional 99.29
KOG1247|consensus 567 99.18
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosom 99.13
TIGR00456566 argS arginyl-tRNA synthetase. This model recognize 99.04
PRK00750510 lysK lysyl-tRNA synthetase; Reviewed 99.02
cd00802143 class_I_aaRS_core catalytic core domain of class I 98.97
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribos 98.97
PF00750354 tRNA-synt_1d: tRNA synthetases class I (R); InterP 98.94
PRK12451562 arginyl-tRNA synthetase; Reviewed 98.89
PF01406300 tRNA-synt_1e: tRNA synthetases class I (C) catalyt 98.79
PLN02286576 arginine-tRNA ligase 98.76
PTZ00399651 cysteinyl-tRNA-synthetase; Provisional 98.75
cd00672213 CysRS_core catalytic core domain of cysteinyl tRNA 98.69
TIGR00467515 lysS_arch lysyl-tRNA synthetase, archaeal and spir 98.65
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribos 98.6
PRK12418384 cysteinyl-tRNA synthetase; Provisional 98.59
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino- 98.55
PRK14536490 cysS cysteinyl-tRNA synthetase; Provisional 98.55
TIGR00435465 cysS cysteinyl-tRNA synthetase. This model finds t 98.55
PRK00260463 cysS cysteinyl-tRNA synthetase; Validated 98.54
PF01406300 tRNA-synt_1e: tRNA synthetases class I (C) catalyt 98.49
PRK14535699 cysS cysteinyl-tRNA synthetase; Provisional 98.42
PRK14534481 cysS cysteinyl-tRNA synthetase; Provisional 98.39
KOG2007|consensus586 98.29
cd00674353 LysRS_core_class_I catalytic core domain of class 98.24
PLN02946557 cysteine-tRNA ligase 98.19
cd09287240 GluRS_non_core catalytic core domain of non-discri 98.15
PRK00750510 lysK lysyl-tRNA synthetase; Reviewed 98.12
PRK04156567 gltX glutamyl-tRNA synthetase; Provisional 97.98
KOG2007|consensus586 97.78
TIGR00463560 gltX_arch glutamyl-tRNA synthetase, archaeal and e 97.75
PRK12558445 glutamyl-tRNA synthetase; Provisional 97.62
TIGR00467515 lysS_arch lysyl-tRNA synthetase, archaeal and spir 97.61
TIGR03838272 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthe 97.59
cd00807238 GlnRS_core catalytic core domain of glutaminyl-tRN 97.5
PTZ00402 601 glutamyl-tRNA synthetase; Provisional 97.49
PF00749314 tRNA-synt_1c: tRNA synthetases class I (E and Q), 97.49
PLN03233523 putative glutamate-tRNA ligase; Provisional 97.48
PRK01611507 argS arginyl-tRNA synthetase; Reviewed 97.48
PTZ00437 574 glutaminyl-tRNA synthetase; Provisional 97.44
TIGR00440 522 glnS glutaminyl-tRNA synthetase. This protein is a 97.37
PLN02907722 glutamate-tRNA ligase 97.36
PRK05347 554 glutaminyl-tRNA synthetase; Provisional 97.29
COG0008472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Tr 97.27
PRK14703 771 glutaminyl-tRNA synthetase/YqeY domain fusion prot 97.25
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 97.24
PRK12410433 glutamylglutaminyl-tRNA synthetase; Provisional 97.19
PLN02859 788 glutamine-tRNA ligase 97.16
cd00418230 GlxRS_core catalytic core domain of glutamyl-tRNA 97.14
PF01921360 tRNA-synt_1f: tRNA synthetases class I (K); InterP 97.02
TIGR00464470 gltX_bact glutamyl-tRNA synthetase, bacterial fami 97.01
TIGR00456566 argS arginyl-tRNA synthetase. This model recognize 96.97
PRK14895513 gltX glutamyl-tRNA synthetase; Provisional 96.9
PRK01406476 gltX glutamyl-tRNA synthetase; Reviewed 96.82
PLN02627535 glutamyl-tRNA synthetase 96.8
cd00808239 GluRS_core catalytic core domain of discriminating 96.79
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, 96.58
KOG1195|consensus567 96.44
KOG1147|consensus712 96.36
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, 96.21
KOG4426|consensus656 96.11
PF01921360 tRNA-synt_1f: tRNA synthetases class I (K); InterP 95.68
PF13603185 tRNA-synt_1_2: Leucyl-tRNA synthetase, Domain 2; P 95.62
KOG1148|consensus 764 94.82
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosom 92.96
PLN02286576 arginine-tRNA ligase 92.6
PF00750354 tRNA-synt_1d: tRNA synthetases class I (R); InterP 91.27
PRK12451562 arginyl-tRNA synthetase; Reviewed 90.44
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 83.56
KOG1149|consensus524 83.43
cd00805269 TyrRS_core catalytic core domain of tyrosinyl-tRNA 82.06
PRK12284431 tryptophanyl-tRNA synthetase; Reviewed 81.78
PRK12556332 tryptophanyl-tRNA synthetase; Provisional 81.42
cd00418230 GlxRS_core catalytic core domain of glutamyl-tRNA 80.48
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=3e-88  Score=774.44  Aligned_cols=411  Identities=28%  Similarity=0.399  Sum_probs=372.0

Q ss_pred             CchHHHHHHhhhccccccccccccc--cCCCCCceeecCCCCCCCccchhHHHHHHHHHHHHHHHHHhcCCeEeeCCCcc
Q psy944          205 TDALRFALAAYMSQGERTGRRKSIG--EKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCD  282 (689)
Q Consensus       205 ~~~~~~iE~~~~~~W~~~~~~~~~~--~~~~~~~f~i~~~pP~~nG~lHiGH~~~~~i~D~laRy~rm~G~~V~~~~G~D  282 (689)
                      +.++...|++++++|++++.++...  .+++++.|+++|||||+||.+|+|||+|++++|++.||++|+||+|.+.+|||
T Consensus        17 r~~l~~~E~~i~~~W~e~~iy~k~~~~~~~g~~~FvfhDGPPyANG~iHiGHalnKilKDiI~Ry~~m~G~~v~~~pGWD   96 (933)
T COG0060          17 RANLPKKEPKILKFWEENDIYEKIREERNKGKPKFVLHDGPPYANGNIHIGHALNKILKDIIVRYKTMQGYDVPYVPGWD   96 (933)
T ss_pred             cCChhhcCHHHHHHHHHhhHHHHHHHHHhCCCCcEEEeCCCCCCCCCcchhhhHHHhhhhhhhhhhcccCCcCCCCCCCc
Confidence            5688999999999999999666554  46888999999999999999999999999999999999999999999999999


Q ss_pred             cccChHHHHHHHHHHHHhcccccccCHHHHHHHHHHHHHHHHHHHHHHHHHhccccccCCccccCChhhHHHHHHHHHHH
Q psy944          283 HAGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVIL  362 (689)
Q Consensus       283 ~~Glpie~~~e~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lGi~~Dw~~~~~T~d~~~~~~v~~~f~~L  362 (689)
                      |||||||.+++++++. .+....+++.++|+++|++++..+++.|+++|+|||++.||+++|.|||+.|++.++|+|++|
T Consensus        97 cHGLPIE~~vek~lg~-~k~~i~~~~~~efr~~Cr~~a~~~v~~q~~~f~RLGv~~Dw~npY~Tmd~~ye~~~~~~f~~~  175 (933)
T COG0060          97 CHGLPIELKVEKKLGI-GKKDIESFGVEEFREKCREFALEQVDEQKEQFKRLGVWGDWENPYKTMDPSYEESVWWAFKEL  175 (933)
T ss_pred             CCCchHHHHHHHHhCC-CcchhhhcCHHHHHHHHHHHHHHHHHHHHHHHHhheEeeccCCCeecCCHHHHHHHHHHHHHH
Confidence            9999999999999876 666778899999999999999999999999999999999999999999999999999999999


Q ss_pred             HHcCCeeeecccccccCCCCcccCCCceeeeeecCCccccccCCCCCCcccceecccccc--CCCCceEEEeeccCcccc
Q psy944          363 HEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKL--DDGSGEIVVATTRLETLF  440 (689)
Q Consensus       363 ~~kGliy~~~~~v~w~~~~~t~ls~~ev~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~l~~~Tt~P~Tl~  440 (689)
                      +++||||+|.+||+|||+|+|+||++||+|.+              +.++++++.|..+-  .+.+.+++||||||||||
T Consensus       176 ~~kGllyrg~Kpv~wsp~c~TaLAeaEvey~d--------------~~dpSIyV~F~v~~~~~~~~~~lviWTTTPWTLP  241 (933)
T COG0060         176 YEKGLLYRGYKPVPWSPRCETALAEAEVEYGD--------------VKDPSIYVKFPVKDEGLDENAYLVIWTTTPWTLP  241 (933)
T ss_pred             HHCCCeecCCeeeeecCCCCcchhhhhhcccc--------------cCCceEEEEEEeccCCCCCCcEEEEEeCCCCCch
Confidence            99999999999999999999999999998754              35666777665432  245789999999999999


Q ss_pred             ccchhhcCCCchhhhhhhhhhhccCCCCCCCCCCCCCcccceeeeEeEEeecCCceEEEEeccHHHHhhccccc--ccCc
Q psy944          441 ADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVA--VHPE  518 (689)
Q Consensus       441 ~n~~~~v~p~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~i~~~~~e~~~~~~~~~--~~~~  518 (689)
                      +|+|||||||.+|..                                  ++.+++.+++|+.+++.++...++.  ....
T Consensus       242 aN~aiav~pd~~Y~l----------------------------------v~~~~~~~IlA~~lve~~~~~~~~~~~~vl~  287 (933)
T COG0060         242 ANLAIAVHPDLDYVL----------------------------------VEVNGEKLILAKALVESVAKKAGVEDYEVLE  287 (933)
T ss_pred             hcceeEeCCCcceEE----------------------------------EEECCEEEEEhHHHHHHHHHHcCCcceEEeE
Confidence            999999999987643                                  2234588999999999998887764  2356


Q ss_pred             ccccccccCceeecCcCC----CceeeeeCCcccccCCCcceEeCCCCCHHHHHHHHHcC-CCceeeccCCcccccCCCC
Q psy944          519 DERYKHLVGKLLVHPFCE----RKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLN-LPLITVFNEEGVIIGDYGE  593 (689)
Q Consensus       519 ~~~~~~l~g~~~~~P~~~----~~~pv~~~~~V~~~~GTGiV~~~Pah~~~D~~~~~~~~-l~i~~~id~~G~~~~~~~~  593 (689)
                      +.+|++|.|..|.|||..    +.+||+.+|||+.+.|||+||+|||||++||.+|+++| +|++++||++|+|+++.+.
T Consensus       288 ~~kG~~Leg~~y~hPf~~~~~~~~~~v~~gd~VT~d~GTG~VHtAPghGeeDy~vg~~~g~l~v~~pVD~~G~yt~~~~~  367 (933)
T COG0060         288 TFKGSELEGLRYEHPFYDFVYDRAFPVILGDHVTLDDGTGLVHTAPGHGEEDYEVGKKYGLLEVLNPVDDNGRYTEEAPK  367 (933)
T ss_pred             EeehhhhCCCEeeCCcccccccceeeEEecCeEecCCCccceecCCCCCHHHHHHHHHcCCcCCccccCCCccccccchh
Confidence            889999999999999995    89999999999999999999999999999999999999 7999999999999999999


Q ss_pred             CCCCchhhhHHHHHHHhhccccccCceeeeE-----------Eeeee---ecccccccCcHHHHHHHHH-hcCCCeeecc
Q psy944          594 FTGMKRFDARTRVTELISLSISSQGLIKVDK-----------EIERL---NKKEEYLKQVIAKLKDQAA-AEDYATKVPE  658 (689)
Q Consensus       594 ~~G~~v~~a~~~i~~~L~~~~~~~g~~~~~~-----------~i~~l---~~~QWFi~~~~~~~k~~~~-~~~~i~~~P~  658 (689)
                      |.|+.++||++.|++.|+    ++|.+...+           |..|+   .++|||+++  +++|++++ ++++++|+|+
T Consensus       368 ~~G~~v~dAn~~Ii~~Lk----~~g~Ll~~e~i~HsYPhcWR~ktPlIyRAt~QWFi~v--~~~r~~~l~~i~~v~w~P~  441 (933)
T COG0060         368 YEGLFVKDANKKIIEDLK----EKGNLLKSEKIEHSYPHCWRTKTPLIYRATPQWFVSV--DKLRDKMLKEINKVNWVPD  441 (933)
T ss_pred             hCCceeccCCHHHHHHHH----hCCceeeeeeEEeCCCcccCCCCeeEEeecchheeEH--HHHHHHHHHHHhcceEECh
Confidence            999999999999999999    878766444           44554   599999995  79999998 8889999999


Q ss_pred             cccchhhhhhhc
Q psy944          659 NVRTQNSEKLSE  670 (689)
Q Consensus       659 ~~~~~~~~~~~~  670 (689)
                      ++++++.+++++
T Consensus       442 ~~~~R~~~mve~  453 (933)
T COG0060         442 WGKNRFGNMVEN  453 (933)
T ss_pred             hHHHHHHHHHcC
Confidence            999999998865

>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02882 aminoacyl-tRNA ligase Back     alignment and domain information
>PTZ00427 isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PTZ00419 valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>PLN02843 isoleucyl-tRNA synthetase Back     alignment and domain information
>PLN02381 valyl-tRNA synthetase Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0432|consensus Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase Back     alignment and domain information
>PRK14900 valS valyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02943 aminoacyl-tRNA ligase Back     alignment and domain information
>PLN02959 aminoacyl-tRNA ligase Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0434|consensus Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>PLN02563 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG0433|consensus Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0437|consensus Back     alignment and domain information
>KOG0435|consensus Back     alignment and domain information
>KOG0432|consensus Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>PLN02381 valyl-tRNA synthetase Back     alignment and domain information
>PTZ00419 valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>PTZ00427 isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02882 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02843 isoleucyl-tRNA synthetase Back     alignment and domain information
>PRK14900 valS valyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02943 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase Back     alignment and domain information
>KOG0433|consensus Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase Back     alignment and domain information
>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>PLN02959 aminoacyl-tRNA ligase Back     alignment and domain information
>KOG0434|consensus Back     alignment and domain information
>PLN02563 aminoacyl-tRNA ligase Back     alignment and domain information
>cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>PLN02224 methionine-tRNA ligase Back     alignment and domain information
>PLN02610 probable methionyl-tRNA synthetase Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0436|consensus Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>KOG0435|consensus Back     alignment and domain information
>PLN02224 methionine-tRNA ligase Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase Back     alignment and domain information
>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>PF13603 tRNA-synt_1_2: Leucyl-tRNA synthetase, Domain 2; PDB: 2AJH_B 4ARI_A 2AJG_B 4AQ7_D 2AJI_B 4ARC_A 4AS1_A 2BTE_A 2V0G_A 2BYT_A Back     alignment and domain information
>PLN02610 probable methionyl-tRNA synthetase Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0436|consensus Back     alignment and domain information
>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0437|consensus Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>PLN02946 cysteine-tRNA ligase Back     alignment and domain information
>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase Back     alignment and domain information
>KOG1247|consensus Back     alignment and domain information
>PTZ00399 cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1247|consensus Back     alignment and domain information
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02286 arginine-tRNA ligase Back     alignment and domain information
>PTZ00399 cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete Back     alignment and domain information
>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2007|consensus Back     alignment and domain information
>cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase Back     alignment and domain information
>PLN02946 cysteine-tRNA ligase Back     alignment and domain information
>cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2007|consensus Back     alignment and domain information
>TIGR00463 gltX_arch glutamyl-tRNA synthetase, archaeal and eukaryotic family Back     alignment and domain information
>PRK12558 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete Back     alignment and domain information
>TIGR03838 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthetase Back     alignment and domain information
>cd00807 GlnRS_core catalytic core domain of glutaminyl-tRNA synthetase Back     alignment and domain information
>PTZ00402 glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PF00749 tRNA-synt_1c: tRNA synthetases class I (E and Q), catalytic domain; InterPro: IPR020058 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN03233 putative glutamate-tRNA ligase; Provisional Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PTZ00437 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00440 glnS glutaminyl-tRNA synthetase Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>PRK05347 glutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14703 glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional Back     alignment and domain information
>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed Back     alignment and domain information
>PRK12410 glutamylglutaminyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02859 glutamine-tRNA ligase Back     alignment and domain information
>cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase Back     alignment and domain information
>PF01921 tRNA-synt_1f: tRNA synthetases class I (K); InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00464 gltX_bact glutamyl-tRNA synthetase, bacterial family Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase Back     alignment and domain information
>PRK14895 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02627 glutamyl-tRNA synthetase Back     alignment and domain information
>cd00808 GluRS_core catalytic core domain of discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1195|consensus Back     alignment and domain information
>KOG1147|consensus Back     alignment and domain information
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4426|consensus Back     alignment and domain information
>PF01921 tRNA-synt_1f: tRNA synthetases class I (K); InterPro: IPR002904 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF13603 tRNA-synt_1_2: Leucyl-tRNA synthetase, Domain 2; PDB: 2AJH_B 4ARI_A 2AJG_B 4AQ7_D 2AJI_B 4ARC_A 4AS1_A 2BTE_A 2V0G_A 2BYT_A Back     alignment and domain information
>KOG1148|consensus Back     alignment and domain information
>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02286 arginine-tRNA ligase Back     alignment and domain information
>PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12451 arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12283 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG1149|consensus Back     alignment and domain information
>cd00805 TyrRS_core catalytic core domain of tyrosinyl-tRNA synthetase Back     alignment and domain information
>PRK12284 tryptophanyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12556 tryptophanyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query689
1gax_A 862 Crystal Structure Of Thermus Thermophilus Valyl-Trn 1e-60
1gax_A 862 Crystal Structure Of Thermus Thermophilus Valyl-Trn 2e-28
1wk9_A146 Structural Basis For Non-Cognate Amino Acid Discrim 2e-27
1wka_A147 Structural Basis For Non-Cognate Amino Acid Discrim 2e-27
1qu2_A 917 Insights Into Editing From An Ile-Trna Synthetase S 9e-26
4aq7_A 880 Ternary Complex Of E. Coli Leucyl-Trna Synthetase, 2e-15
1obh_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 2e-15
2v0c_A 878 Leucyl-Trna Synthetase From Thermus Thermophilus Co 2e-15
1jzq_A 821 Isoleucyl-Trna Synthetase Complexed With Isoleucyl- 3e-13
1wkb_A 810 Crystal Structure Of Leucyl-Trna Synthetase From Th 7e-10
1wz2_A 967 The Crystal Structure Of Leucyl-Trna Synthetase And 7e-10
2ajg_A196 Crystal Structure Of The Editing Domain Of E. Coli 5e-07
3pz5_A201 The Crystal Structure Of Aaleurs-Cp1-D20 Length = 2 4e-06
3pz0_A221 The Crystal Structure Of Aaleurs-Cp1 Length = 221 4e-06
3o0a_A219 Crystal Structure Of The Wild Type Cp1 Hydrolitic D 4e-06
2csx_A497 Crystal Structure Of Aquifex Aeolicus Methionyl-Trn 6e-05
3ziu_A 637 Crystal Structure Of Mycoplasma Mobile Leucyl-trna 4e-04
1woy_A500 Crystal Structure Of Methionyl Trna Synthetase Y225 7e-04
1a8h_A500 Methionyl-Trna Synthetase From Thermus Thermophilus 7e-04
2d54_A502 Crystal Structure Of Methionyl Trna Synthetase Y225 7e-04
>pdb|1GAX|A Chain A, Crystal Structure Of Thermus Thermophilus Valyl-Trna Synthetase Complexed With Trna(Val) And Valyl-Adenylate Analogue Length = 862 Back     alignment and structure 
Iteration: 1

 Score =  231 bits (589), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 168/255 (65%), Gaps = 21/255 (8%)
Query: 231 KNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQV 290
           K+ K  FV+ +PPPNVTG+LH+GHAL N+++D++ R+ RM+G   +W PG DHAGIATQV
Sbjct: 30  KSGKPPFVIFMPPPNVTGSLHMGHALDNSLQDALIRYKRMRGFEAVWLPGTDHAGIATQV 89
Query: 291 VVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPK 350
           VVE+ L +E  KTRH++GREKF+E+VW+WK+E G  I +Q+K +G+S DW R  FTMD K
Sbjct: 90  VVERLLLKE-GKTRHDLGREKFLERVWQWKEESGGTILKQLKRLGASADWSREAFTMDEK 148
Query: 351 LSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPV 410
            SRAV  AF   +  G  YR+ RLV+W    ++ +SD+EV+    T  TP          
Sbjct: 149 RSRAVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSDLEVE----TEPTP---------- 194
Query: 411 DFGVLASFAYKLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDKVELTGRTPLR 470
             G L +  Y++ +G G I +AT R ET+FAD A+AVHPEDERY+HL+ K      T + 
Sbjct: 195 --GKLYTLRYEV-EGGGFIEIATVRPETVFADQAIAVHPEDERYRHLLGKRARIPLTEVW 251
Query: 471 VPGYANPV---DFGV 482
           +P  A+P    DFG 
Sbjct: 252 IPILADPAVEKDFGT 266
>pdb|1GAX|A Chain A, Crystal Structure Of Thermus Thermophilus Valyl-Trna Synthetase Complexed With Trna(Val) And Valyl-Adenylate Analogue Length = 862 Back     alignment and structure
>pdb|1WK9|A Chain A, Structural Basis For Non-Cognate Amino Acid Discrimination By The Valyl-Trna Synthetase Editing Domain Length = 146 Back     alignment and structure
>pdb|1WKA|A Chain A, Structural Basis For Non-Cognate Amino Acid Discrimination By The Valyl-Trna Synthetase Editing Domain Length = 147 Back     alignment and structure
>pdb|1QU2|A Chain A, Insights Into Editing From An Ile-Trna Synthetase Structure With Trna(Ile) And Mupirocin Length = 917 Back     alignment and structure
>pdb|4AQ7|A Chain A, Ternary Complex Of E. Coli Leucyl-Trna Synthetase, Trna(Leu) And Leucyl-Adenylate Analogue In The Aminoacylation Conformation Length = 880 Back     alignment and structure
>pdb|1OBH|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Pre-Transfer Editing Substrate Analogue In Both Synthetic Active Site And Editing Site Length = 878 Back     alignment and structure
>pdb|2V0C|A Chain A, Leucyl-Trna Synthetase From Thermus Thermophilus Complexed With A Sulphamoyl Analogue Of Leucyl-Adenylate In The Synthetic Site And An Adduct Of Amp With 5-Fluoro-1,3- Dihydro-1-Hydroxy-2,1-Benzoxaborole (An2690) In The Editing Site Length = 878 Back     alignment and structure
>pdb|1JZQ|A Chain A, Isoleucyl-Trna Synthetase Complexed With Isoleucyl- Adenylate Analogue Length = 821 Back     alignment and structure
>pdb|1WKB|A Chain A, Crystal Structure Of Leucyl-Trna Synthetase From The Archaeon Pyrococcus Horikoshii Reveals A Novel Editing Domain Orientation Length = 810 Back     alignment and structure
>pdb|1WZ2|A Chain A, The Crystal Structure Of Leucyl-Trna Synthetase And Trna(Leucine) Complex Length = 967 Back     alignment and structure
>pdb|2AJG|A Chain A, Crystal Structure Of The Editing Domain Of E. Coli Leucyl- Trna Synthetase Length = 196 Back     alignment and structure
>pdb|3PZ5|A Chain A, The Crystal Structure Of Aaleurs-Cp1-D20 Length = 201 Back     alignment and structure
>pdb|3PZ0|A Chain A, The Crystal Structure Of Aaleurs-Cp1 Length = 221 Back     alignment and structure
>pdb|3O0A|A Chain A, Crystal Structure Of The Wild Type Cp1 Hydrolitic Domain From Aquifex Aeolicus Leucyl-Trna Length = 219 Back     alignment and structure
>pdb|2CSX|A Chain A, Crystal Structure Of Aquifex Aeolicus Methionyl-Trna Synthetase Complexed With Trna(Met) Length = 497 Back     alignment and structure
>pdb|3ZIU|A Chain A, Crystal Structure Of Mycoplasma Mobile Leucyl-trna Synthetase With Leu-ams In The Active Site Length = 637 Back     alignment and structure
>pdb|1WOY|A Chain A, Crystal Structure Of Methionyl Trna Synthetase Y225f Mutant From Thermus Thermophilus Length = 500 Back     alignment and structure
>pdb|1A8H|A Chain A, Methionyl-Trna Synthetase From Thermus Thermophilus Length = 500 Back     alignment and structure
>pdb|2D54|A Chain A, Crystal Structure Of Methionyl Trna Synthetase Y225a Mutant From Thermus Thermophilus Length = 502 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query689
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 1e-112
1gax_A862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 8e-64
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 6e-57
1gax_A862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 4e-09
1wka_A147 Valyl-tRNA synthetase; editing, CP1, fidelity, the 4e-60
1wka_A147 Valyl-tRNA synthetase; editing, CP1, fidelity, the 3e-19
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 2e-54
1wz2_A967 Leucyl-tRNA synthetase; ligase, riken structural g 4e-12
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 2e-51
1wkb_A810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 2e-12
1ile_A 821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 4e-36
1ile_A821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 8e-17
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, me 1e-31
1ffy_A917 Isoleucyl-tRNA synthetase; protein-RNA complex, me 7e-12
2wfg_A261 Cytosolic leucyl-tRNA synthetase; ligase, editing 3e-15
3pz6_A311 Leurs, leucyl-tRNA synthetase; editing domain, gll 5e-15
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 2e-13
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 4e-04
1wny_A186 Isoleucyl-tRNA synthetase; ligase, structural geno 2e-13
2ajg_A196 Leucyl-tRNA synthetase; editing domain, ligase; 2. 3e-13
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 2e-12
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 2e-04
3o0a_A219 Leucyl-tRNA synthetase subunit alpha; CP1 hydrolyt 1e-10
2wfd_A252 Leucyl-tRNA synthetase, cytoplasmic; aminoacyl-tRN 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3tun_A542 Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta 4e-06
2d5b_A500 Methionyl-tRNA synthetase; rossmann fold, class 1A 1e-05
2d5b_A500 Methionyl-tRNA synthetase; rossmann fold, class 1A 3e-05
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, pro 1e-05
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, pro 1e-04
2csx_A497 Methionyl-tRNA synthetase; ligase, riken structura 1e-05
2csx_A497 Methionyl-tRNA synthetase; ligase, riken structura 1e-04
4dlp_A536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 2e-05
4dlp_A536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 1e-04
3kfl_A 564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 3e-05
3kfl_A564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 2e-04
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Length = 862 Back     alignment and structure
 Score =  358 bits (920), Expect = e-112
 Identities = 119/259 (45%), Positives = 164/259 (63%), Gaps = 29/259 (11%)

Query: 230 EKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQ 289
            K+ K  FV+ +PPPNVTG+LH+GHAL N+++D++ R+ RM+G   +W PG DHAGIATQ
Sbjct: 29  PKSGKPPFVIFMPPPNVTGSLHMGHALDNSLQDALIRYKRMRGFEAVWLPGTDHAGIATQ 88

Query: 290 VVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDP 349
           VVVE+ L  +E KTRH++GREKF+E+VW+WK+E G  I +Q+K +G+S DW R  FTMD 
Sbjct: 89  VVVERLL-LKEGKTRHDLGREKFLERVWQWKEESGGTILKQLKRLGASADWSREAFTMDE 147

Query: 350 KLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANP 409
           K SRAV  AF   +  G  YR+ RLV+W    ++ +SD+EV+     G+           
Sbjct: 148 KRSRAVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSDLEVETEPTPGK----------- 196

Query: 410 VDFGVLASFAYKLDDGSGEIVVATTRLETLFADVAVAVHPEDERYKHLVDK---VELTGR 466
                L +  Y++ +G G I +AT R ET+FAD A+AVHPEDERY+HL+ K   + LT  
Sbjct: 197 -----LYTLRYEV-EGGGFIEIATVRPETVFADQAIAVHPEDERYRHLLGKRARIPLTEV 250

Query: 467 TPLRVP----GYANPVDFG 481
               +P          DFG
Sbjct: 251 ---WIPILADPAVEK-DFG 265
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Length = 862 Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Length = 862 Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Length = 862 Back     alignment and structure
>1wka_A Valyl-tRNA synthetase; editing, CP1, fidelity, thermus thrmophilus, translation, amino acid, structural genomics; 1.70A {Thermus thermophilus} SCOP: b.51.1.1 PDB: 1wk9_A* Length = 147 Back     alignment and structure
>1wka_A Valyl-tRNA synthetase; editing, CP1, fidelity, thermus thrmophilus, translation, amino acid, structural genomics; 1.70A {Thermus thermophilus} SCOP: b.51.1.1 PDB: 1wk9_A* Length = 147 Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Length = 967 Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Length = 967 Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810 Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Length = 810 Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Length = 821 Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Length = 821 Back     alignment and structure
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Length = 917 Back     alignment and structure
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Length = 917 Back     alignment and structure
>2wfg_A Cytosolic leucyl-tRNA synthetase; ligase, editing domain, hydrolysis of MIS-charged trnas, benzoxaborole, anti-fungal; HET: ZZB; 2.20A {Candida albicans} PDB: 2wfe_A* Length = 261 Back     alignment and structure
>3pz6_A Leurs, leucyl-tRNA synthetase; editing domain, glleurs_CP1, ligase; 2.60A {Giardia intestinalis} Length = 311 Back     alignment and structure
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Length = 880 Back     alignment and structure
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Length = 880 Back     alignment and structure
>1wny_A Isoleucyl-tRNA synthetase; ligase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Thermus thermophilus} PDB: 1wnz_A* 1wk8_A* 1udz_A 1ue0_A Length = 186 Back     alignment and structure
>2ajg_A Leucyl-tRNA synthetase; editing domain, ligase; 2.00A {Escherichia coli} PDB: 2ajh_A 2aji_A Length = 196 Back     alignment and structure
>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Length = 878 Back     alignment and structure
>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Length = 878 Back     alignment and structure
>3o0a_A Leucyl-tRNA synthetase subunit alpha; CP1 hydrolytic DOM ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide- protein biosynthesis; 1.77A {Aquifex aeolicus} PDB: 3pz0_A 3pz5_A Length = 219 Back     alignment and structure
>2wfd_A Leucyl-tRNA synthetase, cytoplasmic; aminoacyl-tRNA synthetase, phosphoprotein, editing domain, nucleotide-binding, hydrolysis of MIS-charged trnas; 3.25A {Homo sapiens} Length = 252 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3tun_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, translation, nucleotide binding; HET: C13; 2.55A {Trypanosoma brucei} Length = 542 Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Length = 500 Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Length = 500 Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Length = 524 Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Length = 524 Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Length = 497 Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Length = 497 Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Length = 536 Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Length = 536 Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Length = 564 Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Length = 564 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query689
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, me 100.0
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 100.0
1ile_A 821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 100.0
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 100.0
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 100.0
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 100.0
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 100.0
1wny_A186 Isoleucyl-tRNA synthetase; ligase, structural geno 100.0
1wka_A147 Valyl-tRNA synthetase; editing, CP1, fidelity, the 100.0
3o0a_A219 Leucyl-tRNA synthetase subunit alpha; CP1 hydrolyt 99.98
1gax_A862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 99.97
2ajg_A196 Leucyl-tRNA synthetase; editing domain, ligase; 2. 99.97
2wfg_A261 Cytosolic leucyl-tRNA synthetase; ligase, editing 99.97
1ffy_A917 Isoleucyl-tRNA synthetase; protein-RNA complex, me 99.97
3pz6_A311 Leurs, leucyl-tRNA synthetase; editing domain, gll 99.97
2wfd_A252 Leucyl-tRNA synthetase, cytoplasmic; aminoacyl-tRN 99.97
1ile_A821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 99.97
3u1f_A542 Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta 99.96
4arc_A880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 99.95
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerizati 99.95
2v0c_A878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 99.95
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, pro 99.92
2csx_A497 Methionyl-tRNA synthetase; ligase, riken structura 99.92
3h99_A 560 Methionyl-tRNA synthetase; rossmann fold, aminoacy 99.92
2d5b_A500 Methionyl-tRNA synthetase; rossmann fold, class 1A 99.92
3kfl_A 564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 99.9
4dlp_A536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 99.89
3u1f_A542 Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta 99.89
1rqg_A722 Methionyl-tRNA synthetase; translation, dimerizati 99.88
3kfl_A564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 99.88
1wz2_A967 Leucyl-tRNA synthetase; ligase, riken structural g 99.88
1wkb_A810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 99.87
4dlp_A536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 99.86
2x1l_A524 Methionyl-tRNA synthetase; nucleotide-binding, pro 99.85
2d5b_A500 Methionyl-tRNA synthetase; rossmann fold, class 1A 99.84
3h99_A560 Methionyl-tRNA synthetase; rossmann fold, aminoacy 99.83
2csx_A497 Methionyl-tRNA synthetase; ligase, riken structura 99.8
3tqo_A462 Cysteinyl-tRNA synthetase; protein synthesis, liga 99.74
3sp1_A501 Cysteinyl-tRNA synthetase; structural genomics, se 99.71
3c8z_A414 Cysteinyl-tRNA synthetase; cysteine ligase, rossma 99.67
1li5_A461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys 99.53
1iq0_A592 Arginyl-tRNA synthetase; riken structural genomics 99.28
2zue_A629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase 99.27
1irx_A523 Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin 99.21
3fnr_A464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX 99.18
1f7u_A607 Arginyl-tRNA synthetase; RNA-protein complex, amin 99.14
3sp1_A501 Cysteinyl-tRNA synthetase; structural genomics, se 98.97
3c8z_A414 Cysteinyl-tRNA synthetase; cysteine ligase, rossma 98.95
1li5_A461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys 98.87
3tqo_A462 Cysteinyl-tRNA synthetase; protein synthesis, liga 98.69
1irx_A523 Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin 97.99
3fnr_A464 Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX 97.98
2o5r_A481 Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, g 97.91
1nzj_A298 Hypothetical protein YADB; Zn cluster, glutamyl T- 97.86
1qtq_A 553 GLNRS, protein (glutaminyl-tRNA synthetase); gluta 97.71
3aii_A553 Glutamyl-tRNA synthetase; amino-acyl tRNA syntheta 97.69
1iq0_A592 Arginyl-tRNA synthetase; riken structural genomics 97.6
3al0_C592 Glutamyl-tRNA(Gln) amidotransferase subunit C, GL 97.58
2hz7_A 851 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS c 97.55
4g6z_A490 Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, 97.53
2cfo_A492 Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA s 97.37
2zue_A629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase 97.32
4gri_A512 Glutamate--tRNA ligase; structural genomics, seatt 97.23
3afh_A488 Glutamyl-tRNA synthetase 2; protein-substrate comp 97.21
1j09_A468 Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, r 97.1
2ja2_A498 Glutamyl-tRNA synthetase; non-discriminating gluta 96.92
2cyb_A323 Tyrosyl-tRNA synthetase; rossmann-fold, structural 94.11
2cfo_A492 Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA s 93.03
2g36_A340 Tryptophanyl-tRNA synthetase; TM0492, structural g 90.91
3tzl_A322 Tryptophanyl-tRNA synthetase; structural genomics, 90.5
2yxn_A322 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 90.41
3aii_A553 Glutamyl-tRNA synthetase; amino-acyl tRNA syntheta 88.39
2pid_A356 Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase 88.05
1h3f_A432 Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy 87.36
1qtq_A553 GLNRS, protein (glutaminyl-tRNA synthetase); gluta 87.22
1y42_X392 Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tR 87.2
2o5r_A481 Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, g 86.68
2ajg_A196 Leucyl-tRNA synthetase; editing domain, ligase; 2. 85.18
2jan_A432 Tyrosyl-tRNA synthetase; protein biosynthesis, ami 84.21
1j09_A468 Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, r 84.18
3tzl_A322 Tryptophanyl-tRNA synthetase; structural genomics, 84.06
3afh_A488 Glutamyl-tRNA synthetase 2; protein-substrate comp 83.88
1jil_A420 Tyrrs, tyrosyl-tRNA synthetase; truncation, based 83.73
2ts1_A419 Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 83.63
1yi8_B351 Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2. 83.63
3al0_C592 Glutamyl-tRNA(Gln) amidotransferase subunit C, GL 82.62
2el7_A337 Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synth 82.49
1n3l_A372 Tyrosyl-tRNA synthetase; rossmann fold AS catalyti 81.21
2zp1_A314 Tyrosyl-tRNA synthetase; tRNA synthetases class I, 80.19
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-82  Score=755.55  Aligned_cols=406  Identities=22%  Similarity=0.344  Sum_probs=359.6

Q ss_pred             CchHHHHHHhhhccccccccccccc-cCCCCCceeecCCCCCCCccchhHHHHHHHHHHHHHHHHHhcCCeEeeCCCccc
Q psy944          205 TDALRFALAAYMSQGERTGRRKSIG-EKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDH  283 (689)
Q Consensus       205 ~~~~~~iE~~~~~~W~~~~~~~~~~-~~~~~~~f~i~~~pP~~nG~lHiGH~~~~~i~D~laRy~rm~G~~V~~~~G~D~  283 (689)
                      ++++..+|.+|+++|+++++|+... .+.++++|+|++|||||||.|||||++|++++|+++||+||+||+|+|++||||
T Consensus        17 ~~~~~~~E~~~~~~W~~~~~f~~~~~~~~~~~~f~i~~~pPY~nG~lHiGHa~n~~~~Dii~Ry~rm~G~~v~~~~GwD~   96 (917)
T 1ffy_A           17 RGGLPNKEPQIQEKWDAEDQYHKALEKNKGNETFILHDGPPYANGNLHMGHALNKILKDFIVRYKTMQGFYAPYVPGWDT   96 (917)
T ss_dssp             SCCHHHHHHHHHHHHHHTTHHHHHHHHTTTSCBCCEECCCCBSSSCCCHHHHHHHHHHHHHHHHHHTTTCBCCCCCEEBC
T ss_pred             CCChHHHhHHHHHHHHHCCCcccchhhccCCCceeeCCCCCCCCCcchHHHHHHHHHHHHHHHHHHhCCCCCCCcccCch
Confidence            5799999999999999999777643 245788999999999999999999999999999999999999999999999999


Q ss_pred             ccChHHHHHHHHHHHHhcccccccCHHHHHHHHHHHHHHHHHHHHHHHHHhccccccCCccccCChhhHHHHHHHHHHHH
Q psy944          284 AGIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILH  363 (689)
Q Consensus       284 ~Glpie~~~e~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lGi~~Dw~~~~~T~d~~~~~~v~~~f~~L~  363 (689)
                      ||+|||.++++.     |..+.++++++|++.|++|+.++++.|+++|++||+++||+++|.|+||.|+++++|+|.+|+
T Consensus        97 hGlpiE~~a~k~-----G~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~rlG~~~Dwd~~~~T~d~~~~~~v~~~F~~l~  171 (917)
T 1ffy_A           97 HGLPIEQALTKK-----GVDRKKMSTAEFREKCKEFALEQIELQKKDFRRLGVRGDFNDPYITLKPEYEAAQIRIFGEMA  171 (917)
T ss_dssp             CSHHHHHHHHHH-----TCCSTTTCHHHHHHHHHHHHHHHHHHHHHHHHTTTCCSCTTSCEETTSHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHc-----CCCchhCCHHHHHHHHHHHHHHHHHHHHHHHHHhCeEEccCCCeEcCCHHHHHHHHHHHHHHH
Confidence            999999999874     666788999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCeeeecccccccCCCCcccCCCceeeeeecCCccccccCCCCCCcccceeccccccCC------CCceEEEeeccCc
Q psy944          364 EAGDIYRSERLVHWSCSLKSAISDIEVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLDD------GSGEIVVATTRLE  437 (689)
Q Consensus       364 ~kGliy~~~~~v~w~~~~~t~ls~~ev~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~l~~~Tt~P~  437 (689)
                      ++|+||++.++|+|||.|+|+||++||++++..+...              ++.  |++.+      ++.+++|||||||
T Consensus       172 ~kGliYr~~~~v~wcp~~~T~Lae~eVey~d~~~~~~--------------~v~--f~~~~~~g~~~~~~~~~i~TTrP~  235 (917)
T 1ffy_A          172 DKGLIYKGKKPVYWSPSSESSLAEAEIEYHDKRSASI--------------YVA--FNVKDDKGVVDADAKFIIWTTTPW  235 (917)
T ss_dssp             HTTCEEEEEEEEEEETTTTEECCGGGEEEEEEEEEEE--------------ECC--BCCCSSTTGGGTTCCBCCEESCGG
T ss_pred             HcCCeEecccceeccCCCCcCcchhhhhcccccCceE--------------EEE--EEecccccccCCCCeEEEEeCCcc
Confidence            9999999999999999999999999999987655431              111  22222      2578999999999


Q ss_pred             cccccchhhcCCCchhhhhhhhhhhccCCCCCCCCCCCCCcccceeeeEeEEeecCCceEEEEeccHHHHhhcccccc--
Q psy944          438 TLFADVAVAVHPEDERYKHLVDKVELTGRTPLRVPGYANPVDFGVLASFAYKLEDGSGEIVVATTRLETLFADVAVAV--  515 (689)
Q Consensus       438 Tl~~n~~~~v~p~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~i~~~~~e~~~~~~~~~~--  515 (689)
                      |||||+||||||+++|+...                                  .+++.+++++.+++.+....++.-  
T Consensus       236 Tl~~~~av~v~p~~~Y~~v~----------------------------------~~~~~~i~a~~~~~~~~~~~~~~~~~  281 (917)
T 1ffy_A          236 TIPSNVAITVHPELKYGQYN----------------------------------VNGEKYIIAEALSDAVAEALDWDKAS  281 (917)
T ss_dssp             GSSCCBCCCCCTTCCCCCCC----------------------------------TTTTCCCCCHHHHHHHHTTTTCCSSC
T ss_pred             hhhhceEEEECCCCceEEEE----------------------------------eCCceeehHHHHHHHHHHhcCcccce
Confidence            99999999999999876421                                  134567888888888876654321  


Q ss_pred             --cCcccccccccCceeecCcCCCceeeeeCCcccccCCCcceEeCCCCCHHHHHHHHHcCCCceeeccCCcccccCCCC
Q psy944          516 --HPEDERYKHLVGKLLVHPFCERKIPILADSFVEKDFGTGAVKISPGHDHNDYEVAQRLNLPLITVFNEEGVIIGDYGE  593 (689)
Q Consensus       516 --~~~~~~~~~l~g~~~~~P~~~~~~pv~~~~~V~~~~GTGiV~~~Pah~~~D~~~~~~~~l~i~~~id~~G~~~~~~~~  593 (689)
                        ...+..|.+|.|+++.||++++.+||++++||++++|||+||+|||||++||+++++||||++++||++|+|+++.|+
T Consensus       282 ~~~~~~~~G~~l~g~~~~~P~~~~~~pvi~~~~V~~~~GTG~V~~~Pah~~~D~~~~~~~~L~~~~~vd~~G~~~~~~~~  361 (917)
T 1ffy_A          282 IKLEKEYTGKELEWVVAQHPFLDRESLVINGDHVTTDAGTGCVHTAPGHGEDDYIVGQQYELPVISPIDDKGVFTEEGGQ  361 (917)
T ss_dssp             CCCCCCCCTTTCTTCCCBCCTTCCSBCCCCCCSSCCSSSCSCCCBCTTSCSHHHHTTTSSSCCCCCCCCSSSCCCTTCSS
T ss_pred             eeeeeeeecccccCCEEECCCCCCeeeEEeccccccCCCCceeEeCCCCCHHHHHHHHHcCCCeeeeECCCceeCCcccc
Confidence              234678899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCchhhhHHHHHHHhhccccccCceeeeE--------------EeeeeecccccccCcHHHHHHHHH-hcCCCeeecc
Q psy944          594 FTGMKRFDARTRVTELISLSISSQGLIKVDK--------------EIERLNKKEEYLKQVIAKLKDQAA-AEDYATKVPE  658 (689)
Q Consensus       594 ~~G~~v~~a~~~i~~~L~~~~~~~g~~~~~~--------------~i~~l~~~QWFi~~~~~~~k~~~~-~~~~i~~~P~  658 (689)
                      |+|+++++|+++|++.|+    ++|.+.+.+              ++++++++|||+++  +++|+.++ ++++++|+|+
T Consensus       362 ~~G~~v~~A~~~Ii~~L~----~~g~l~~~~~~~hs~p~c~R~~~pv~~r~t~QWFi~~--~~lr~~~l~~i~~~~~~P~  435 (917)
T 1ffy_A          362 FEGMFYDKANKAVTDLLT----EKGALLKLDFITHSYPHDWRTKKPVIFRATPQWFASI--SKVRQDILDAIENTNFKVN  435 (917)
T ss_dssp             CSSSCSSHHHHTTGGGSS----HHHHCCCCEEEEEEEEEETTTCCBCEEEEEEEEEECH--HHHHHHHHHHHHTSEESSH
T ss_pred             cCCcCHHHHHHHHHHHHH----hCCCccccccccccCCEecCCCCEEEEEeccceEeeH--HHHHHHHHHHHhcCcccCH
Confidence            999999999999999999    888765422              45667899999996  68999887 6778999999


Q ss_pred             cccchhhhhhhch
Q psy944          659 NVRTQNSEKLSEA  671 (689)
Q Consensus       659 ~~~~~~~~~~~~~  671 (689)
                      +.++++.+++++.
T Consensus       436 ~~~~r~~~~l~~~  448 (917)
T 1ffy_A          436 WGKTRIYNMVRDR  448 (917)
T ss_dssp             HHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHhcC
Confidence            9999998888753
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Back     alignment and structure
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Back     alignment and structure
>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Back     alignment and structure
>1wny_A Isoleucyl-tRNA synthetase; ligase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Thermus thermophilus} PDB: 1wnz_A* 1wk8_A* 1udz_A 1ue0_A Back     alignment and structure
>1wka_A Valyl-tRNA synthetase; editing, CP1, fidelity, thermus thrmophilus, translation, amino acid, structural genomics; 1.70A {Thermus thermophilus} SCOP: b.51.1.1 PDB: 1wk9_A* Back     alignment and structure
>3o0a_A Leucyl-tRNA synthetase subunit alpha; CP1 hydrolytic DOM ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide- protein biosynthesis; 1.77A {Aquifex aeolicus} PDB: 3pz0_A 3pz5_A Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Back     alignment and structure
>2ajg_A Leucyl-tRNA synthetase; editing domain, ligase; 2.00A {Escherichia coli} PDB: 2ajh_A 2aji_A Back     alignment and structure
>2wfg_A Cytosolic leucyl-tRNA synthetase; ligase, editing domain, hydrolysis of MIS-charged trnas, benzoxaborole, anti-fungal; HET: ZZB; 2.20A {Candida albicans} PDB: 2wfe_A* Back     alignment and structure
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Back     alignment and structure
>3pz6_A Leurs, leucyl-tRNA synthetase; editing domain, glleurs_CP1, ligase; 2.60A {Giardia intestinalis} Back     alignment and structure
>2wfd_A Leucyl-tRNA synthetase, cytoplasmic; aminoacyl-tRNA synthetase, phosphoprotein, editing domain, nucleotide-binding, hydrolysis of MIS-charged trnas; 3.25A {Homo sapiens} Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Back     alignment and structure
>3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A* Back     alignment and structure
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Back     alignment and structure
>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A* Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Back     alignment and structure
>3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} Back     alignment and structure
>3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} Back     alignment and structure
>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Back     alignment and structure
>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Back     alignment and structure
>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Back     alignment and structure
>3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, struc genomics, protein structure initiative; 2.20A {Campylobacter jejuni} Back     alignment and structure
>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Back     alignment and structure
>3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} Back     alignment and structure
>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Back     alignment and structure
>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Back     alignment and structure
>3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Back     alignment and structure
>3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, struc genomics, protein structure initiative; 2.20A {Campylobacter jejuni} Back     alignment and structure
>2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate-T ligase 1, glurs 1, structural genomics, joint center for ST genomics, JCSG; 2.34A {Thermotoga maritima} Back     alignment and structure
>1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* 4a91_A* Back     alignment and structure
>1qtq_A GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, trnaGln, E. coli, complex, ligase/RNA complex; HET: QSI; 2.25A {Escherichia coli} SCOP: b.53.1.2 c.26.1.1 PDB: 1gsg_P* 1gts_A* 1gtr_A* 1zjw_A* 1o0b_A* 1o0c_A* 1qru_A* 1qrs_A* 1qrt_A* 1euy_A* 1euq_A* 1exd_A* 2rd2_A* 2re8_A* 1nyl_A Back     alignment and structure
>3aii_A Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, ligase; 1.65A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Back     alignment and structure
>3al0_C Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA synthetase 2; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} Back     alignment and structure
>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} Back     alignment and structure
>4g6z_A Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, AARS, class 1B AARS, ATP-dependen charging, protein synthesis, structural genomics; HET: GLU; 2.05A {Burkholderia thailandensis} Back     alignment and structure
>2cfo_A Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide-B; HET: GLU; 2.45A {Synechococcus elongatus} Back     alignment and structure
>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Back     alignment and structure
>4gri_A Glutamate--tRNA ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, aminoacyl-tRNA synthetase; HET: GLU; 2.60A {Borrelia burgdorferi} Back     alignment and structure
>3afh_A Glutamyl-tRNA synthetase 2; protein-substrate complex, aminoacyl-tRNA synthetase, ATP-binding, ligase, nucleotide-binding; HET: GSU; 2.00A {Thermotoga maritima} PDB: 3akz_B* Back     alignment and structure
>1j09_A Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLU ATP; 1.80A {Thermus thermophilus} SCOP: a.97.1.1 c.26.1.1 PDB: 1n75_A* 1n77_A* 1n78_A* 2cuz_A* 2cv0_A* 2cv1_A* 2cv2_A* 2dxi_A* 1g59_A 1gln_A Back     alignment and structure
>2ja2_A Glutamyl-tRNA synthetase; non-discriminating glutamyl-tRNA aminoacylation, protein biosynthesis, aminoacyl-tRNA synthetase, ligase; 1.65A {Mycobacterium tuberculosis} PDB: 3pny_A 3pnv_A Back     alignment and structure
>2cyb_A Tyrosyl-tRNA synthetase; rossmann-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TYR; 1.80A {Archaeoglobus fulgidus} Back     alignment and structure
>2cfo_A Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide-B; HET: GLU; 2.45A {Synechococcus elongatus} Back     alignment and structure
>2g36_A Tryptophanyl-tRNA synthetase; TM0492, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI, ligase; HET: TRP; 2.50A {Thermotoga maritima} Back     alignment and structure
>3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3m5w_A* Back     alignment and structure
>2yxn_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: AZY; 1.80A {Escherichia coli str} PDB: 1wq3_A* 1wq4_A* 1x8x_A* 1vbn_A* 1vbm_A* Back     alignment and structure
>3aii_A Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, ligase; 1.65A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2pid_A Tyrosyl-tRNA synthetase; aminoacyl-tRNA synthetase, protein-substrate complex, ATP-BI ligase, mitochondrion, nucleotide-binding, protein biosynth; HET: YSA; 2.20A {Homo sapiens} PDB: 3zxi_A* Back     alignment and structure
>1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* Back     alignment and structure
>1qtq_A GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, trnaGln, E. coli, complex, ligase/RNA complex; HET: QSI; 2.25A {Escherichia coli} SCOP: b.53.1.2 c.26.1.1 PDB: 1gsg_P* 1gts_A* 1gtr_A* 1zjw_A* 1o0b_A* 1o0c_A* 1qru_A* 1qrs_A* 1qrt_A* 1euy_A* 1euq_A* 1exd_A* 2rd2_A* 2re8_A* 1nyl_A Back     alignment and structure
>1y42_X Tyrosyl-tRNA synthetase, mitochondrial; CYT-18, tRNA ligase, group I intron; HET: TYR; 1.95A {Neurospora crassa} PDB: 2rkj_A Back     alignment and structure
>2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate-T ligase 1, glurs 1, structural genomics, joint center for ST genomics, JCSG; 2.34A {Thermotoga maritima} Back     alignment and structure
>2ajg_A Leucyl-tRNA synthetase; editing domain, ligase; 2.00A {Escherichia coli} PDB: 2ajh_A 2aji_A Back     alignment and structure
>2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} Back     alignment and structure
>1j09_A Glutamyl-tRNA synthetase; glurs-ATP-Glu complex, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLU ATP; 1.80A {Thermus thermophilus} SCOP: a.97.1.1 c.26.1.1 PDB: 1n75_A* 1n77_A* 1n78_A* 2cuz_A* 2cv0_A* 2cv1_A* 2cv2_A* 2dxi_A* 1g59_A 1gln_A Back     alignment and structure
>3tzl_A Tryptophanyl-tRNA synthetase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta structure; HET: ADP TRP; 2.15A {Campylobacter jejuni subsp} SCOP: c.26.1.0 PDB: 3m5w_A* Back     alignment and structure
>3afh_A Glutamyl-tRNA synthetase 2; protein-substrate complex, aminoacyl-tRNA synthetase, ATP-binding, ligase, nucleotide-binding; HET: GSU; 2.00A {Thermotoga maritima} PDB: 3akz_B* Back     alignment and structure
>1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* Back     alignment and structure
>2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A Back     alignment and structure
>1yi8_B Tryptophanyl-tRNA synthetase; ligase; HET: TRP; 2.10A {Deinococcus radiodurans} PDB: 1yia_B* 1yid_B* 2a4m_A* Back     alignment and structure
>3al0_C Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA synthetase 2; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} Back     alignment and structure
>2el7_A Tryptophanyl-tRNA synthetase; aminoacyl-tRNA synthetase, translation, structural GEN NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1n3l_A Tyrosyl-tRNA synthetase; rossmann fold AS catalytic domain, unique anticodon recognit domain, dimer, ligase; 1.18A {Homo sapiens} SCOP: c.26.1.1 PDB: 1q11_A* Back     alignment and structure
>2zp1_A Tyrosyl-tRNA synthetase; tRNA synthetases class I, ligase, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, nucleotide-binding; HET: IYR; 1.70A {Methanocaldococcus jannaschii} PDB: 1zh6_A* 1j1u_A* 1u7d_A 2q1g_A* 2pxh_A* 1zh0_A* 2q1i_A* 2ag6_A* 3qe4_A* 3d6u_A* 3d6v_A* 1u7x_A 3n2y_A* 2hgz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 689
d1ivsa4425 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase 2e-41
d1ivsa4425 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase 4e-21
d1h3na3494 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetas 9e-36
d1h3na3494 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetas 1e-10
d1ilea3452 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthe 3e-33
d1ilea3452 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthe 8e-21
d1ffya3450 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthe 2e-29
d1ffya3450 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthe 8e-21
d1wkaa1143 b.51.1.1 (A:195-337) Valyl-tRNA synthetase (ValRS) 8e-23
d1wkaa1143 b.51.1.1 (A:195-337) Valyl-tRNA synthetase (ValRS) 7e-07
d1h3na2192 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS 2e-20
d1ffya2194 b.51.1.1 (A:201-394) Isoleucyl-tRNA synthetase (Il 1e-18
d1pfva2350 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthe 2e-18
d1pfva2350 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthe 1e-05
d2d5ba2348 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetR 2e-16
d2d5ba2348 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetR 3e-09
d1rqga2361 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthe 1e-14
d1rqga2361 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthe 3e-07
d1udza_179 b.51.1.1 (A:) Isoleucyl-tRNA synthetase (IleRS) {T 6e-14
d1ivsa166 a.2.7.3 (A:797-862) Valyl-tRNA synthetase (ValRS) 5e-12
d1irxa2317 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase { 7e-08
d1li5a2315 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysR 5e-06
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 425 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Valyl-tRNA synthetase (ValRS)
species: Thermus thermophilus [TaxId: 274]

 Score =  153 bits (388), Expect = 2e-41
 Identities = 84/159 (52%), Positives = 116/159 (72%), Gaps = 1/159 (0%)

Query: 230 EKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHAGIATQ 289
            K+ K  FV+ +PPPNVTG+LH+GHAL N+++D++ R+ RM+G   +W PG DHAGIATQ
Sbjct: 29  PKSGKPPFVIFMPPPNVTGSLHMGHALDNSLQDALIRYKRMRGFEAVWLPGTDHAGIATQ 88

Query: 290 VVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDP 349
           VVVE+ L  +E KTRH++GREKF+E+VW+WK+E G  I +Q+K +G+S DW R  FTMD 
Sbjct: 89  VVVERLL-LKEGKTRHDLGREKFLERVWQWKEESGGTILKQLKRLGASADWSREAFTMDE 147

Query: 350 KLSRAVTEAFVILHEAGDIYRSERLVHWSCSLKSAISDI 388
           K SRAV  AF   +  G  YR+ RLV+W    ++ +SD+
Sbjct: 148 KRSRAVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSDL 186
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 425 Back     information, alignment and structure
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 494 Back     information, alignment and structure
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 494 Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 452 Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 452 Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 450 Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 450 Back     information, alignment and structure
>d1wkaa1 b.51.1.1 (A:195-337) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure
>d1wkaa1 b.51.1.1 (A:195-337) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure
>d1h3na2 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Length = 192 Back     information, alignment and structure
>d1ffya2 b.51.1.1 (A:201-394) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Length = 194 Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Length = 350 Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Length = 350 Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Length = 348 Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Length = 348 Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Length = 361 Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Length = 361 Back     information, alignment and structure
>d1udza_ b.51.1.1 (A:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Length = 179 Back     information, alignment and structure
>d1ivsa1 a.2.7.3 (A:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 66 Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 317 Back     information, alignment and structure
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query689
d1h3na3494 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 100.0
d1ffya3450 Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus 100.0
d1udza_179 Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop 100.0
d1wkaa1143 Valyl-tRNA synthetase (ValRS) {Thermus thermophilu 100.0
d1ivsa4425 Valyl-tRNA synthetase (ValRS) {Thermus thermophilu 100.0
d1ffya2194 Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus 100.0
d1ilea3452 Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop 99.98
d1h3na2192 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 99.97
d1ffya3450 Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus 99.94
d1pfva2350 Methionyl-tRNA synthetase (MetRS) {Escherichia col 99.88
d1ivsa4425 Valyl-tRNA synthetase (ValRS) {Thermus thermophilu 99.86
d1ilea3452 Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop 99.85
d2d5ba2348 Methionyl-tRNA synthetase (MetRS) {Thermus thermop 99.85
d1rqga2361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 99.82
d1rqga2361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 99.76
d1h3na3494 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 99.65
d1pfva2350 Methionyl-tRNA synthetase (MetRS) {Escherichia col 99.51
d1li5a2315 Cysteinyl-tRNA synthetase (CysRS) {Escherichia col 99.48
d2d5ba2348 Methionyl-tRNA synthetase (MetRS) {Thermus thermop 99.37
d1f7ua2348 Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa 99.08
d1irxa2317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 99.03
d1iq0a2370 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi 98.83
d1li5a2315 Cysteinyl-tRNA synthetase (CysRS) {Escherichia col 98.73
d1irxa2317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 98.31
d1j09a2305 Glutamyl-tRNA synthetase (GluRS) {Thermus thermoph 97.95
d1nzja_286 Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia c 97.47
d1gtra2331 Glutaminyl-tRNA synthetase (GlnRS) {Escherichia co 97.44
d1iq0a2370 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi 94.53
d1wkaa1143 Valyl-tRNA synthetase (ValRS) {Thermus thermophilu 93.8
d1f7ua2348 Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa 86.52
d1j09a2305 Glutamyl-tRNA synthetase (GluRS) {Thermus thermoph 84.44
d1n3la_339 Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapie 83.76
d1h3fa1343 Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophi 82.49
d1h3na2192 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 80.44
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Leucyl-tRNA synthetase (LeuRS)
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=1.1e-39  Score=364.38  Aligned_cols=171  Identities=25%  Similarity=0.363  Sum_probs=161.6

Q ss_pred             CchHHHHHHhhhccccccccccccccCCCCCceeecCCCCCCCccchhHHHHHHHHHHHHHHHHHhcCCeEeeCCCcccc
Q psy944          205 TDALRFALAAYMSQGERTGRRKSIGEKNPKGKFVMVIPPPNVTGTLHLGHALTNAVEDSITRWNRMKGKTTLWNPGCDHA  284 (689)
Q Consensus       205 ~~~~~~iE~~~~~~W~~~~~~~~~~~~~~~~~f~i~~~pP~~nG~lHiGH~~~~~i~D~laRy~rm~G~~V~~~~G~D~~  284 (689)
                      .|+|+.+|++|+++|+++++|+....+.++++|+|++|||||||.||||||++++++|+++||+||+|++|+|++|||||
T Consensus         3 ~Y~p~~iE~~~~~~W~~~~~~~~~~~~~~~~~~~i~~~pP~~nG~lHiGH~~~~~~~D~~~R~~rm~G~~v~~~~G~D~~   82 (494)
T d1h3na3           3 KYNPHAIEAKWQRFWEEKGFMKAKDLPGGRGKQYVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGYEVLHPMGWDAF   82 (494)
T ss_dssp             CCCCTTHHHHHHHHHHHHTTTCCCSSCCTTCEEEEEECCCCSSSCCBHHHHHHHHHHHHHHHHHHHTTCEEECCCCBCCS
T ss_pred             CCCHHHHHHHHHHHHHHCCCcccCccccCCCCeEEEeCCCCCCCchhhhHHHHHHHHHHHHHHHHccCCcccCcCCcCcc
Confidence            69999999999999999998877656778889999999999999999999999999999999999999999999999999


Q ss_pred             cChHHHHHHHHHHHHhcccccccCHHHHHHHHHHHHHHHHHHHHHHHHHhccccccCCccccCChhhHHHHHHHHHHHHH
Q psy944          285 GIATQVVVEKKLWREEKKTRHEIGREKFIEKVWEWKKEKGDRIYEQMKLMGSSLDWDRACFTMDPKLSRAVTEAFVILHE  364 (689)
Q Consensus       285 Glpie~~~e~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lGi~~Dw~~~~~T~d~~~~~~v~~~f~~L~~  364 (689)
                      |+|||.++++.                 ...|++|++++...+++++++||+++||+++|+|+|+.|.+.++++|.+|++
T Consensus        83 G~~~e~~~~k~-----------------~~~~~~~~~~~~~~~~~~~~~~g~~~d~~~~~~T~d~~~~~~~~~~f~~l~~  145 (494)
T d1h3na3          83 GLPAENAALKF-----------------GVHPKDWTYANIRQAKESLRLMGILYDWDREVTTCEPEYYRWNQWIFLKMWE  145 (494)
T ss_dssp             SHHHHHHHHHT-----------------TCCHHHHHHHHHHHHHHHHHHTTCCCCGGGCCBTTSHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHh-----------------CCChHHHHHHHHHHhHHHHHhcCcccCCCCceecCCccccchHHHHHHHhhh
Confidence            99999998752                 2347899999999999999999999999999999999999999999999999


Q ss_pred             cCCeeeecccccccCCCCcccCCCceee
Q psy944          365 AGDIYRSERLVHWSCSLKSAISDIEVDK  392 (689)
Q Consensus       365 kGliy~~~~~v~w~~~~~t~ls~~ev~~  392 (689)
                      +|+||++.++|+|||+|+|+||++||+.
T Consensus       146 ~g~iy~~~~~~~~~~~~~t~l~~~ev~~  173 (494)
T d1h3na3         146 KGLAYRAKGLVNWCPKCQTVLANEQVVE  173 (494)
T ss_dssp             TTCEEEEEEEEEEETTTTEEECGGGEET
T ss_pred             CCcEEeeeEEEEeecCccceecchhccc
Confidence            9999999999999999999999999964
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1udza_ b.51.1.1 (A:) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wkaa1 b.51.1.1 (A:195-337) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ffya2 b.51.1.1 (A:201-394) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h3na2 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nzja_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtra2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wkaa1 b.51.1.1 (A:195-337) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n3la_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h3fa1 c.26.1.1 (A:5-347) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h3na2 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure