T0472

NMR Targets
437 460 462 464
466 467 468 469
471 472 473 474
475 476 480 482
484 492 498 499
500

T0472

UPF0339 protein SO3888 from Shewanella oneidensis

Target type: Server only

Target sequence:

>T0472 SoR190, Shewanella oneidensis MR-1, 110 residues
MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSPIEARYAKEVAKNDKPYFNLKAANHQIIGTSQMYSSTAARDNGIKSVMENGKTTTIKDLT

Structure:
Method: NMR
Determined by: NESG
PDB ID: 2k49

jumping through 472 NMR models
Jumping through 20 NMR models of 2k49

all 20 472 NMR models
All 20 superimposed NMR models of 2k49

PyMOL of 2k49

Domains:  PyMOL of domains

Duplication: two domains. Domain 1: 1-50 and 102-110. Domain 2: 51-101. For this target, evaluation of the whole 2-domain structure is particularly interesting, as the main challenge was in relative positioning of the domains. Poorly structured N- and C-termini. Structurally variable regions were removed from NMR models for evaluation of predictions.

2k49_1:2-110 domains
Domains of T0472: 2k49 model 1 residues 2-110
N- and C-domains are colored blue and red

472 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Tandem duplication of a β3α unit similar to DNA-binding domain, or dsRNA-binding domain (dsRBD) without the first α-helix. Domain-swapped with an additional C-terminal β-strand. This β-strand completes the fold in a manner similar to that in the shorter variants of RNAse H-like fold, e.g. Ada DNA-repair domain.

2k49_1:2-110 cartoon
Cartoon diagram of T0472: 2k49 model 1 residues 2-110

CASP category:

Full chain: Comparative modeling: hard. Closest templates detectable by PSI-BLAST on the second iteration, but relative positioning of the duplicates is a problem.

For individual domains: Comparative modeling: easy.

Closest templates:

The only available template is NMB1088 protein from Neisseria meningitidis: 3bid, which is a domain-swapped dimer. The whole dimer should be used for the tandemly duplicated T0472 sequence. Interestingly, to close the sequence between the duplicates, one β-strand (last strand in chain A, green, after the α-helix) needs to be deleted from the dimeric template composed of chains A and B.

template 3bid_AB
Cartoon diagram of the dimeric template: 3bid chains A (blue-green) and B (lime-red)

template 3bid_A
Chain A of the template 3bid

Duplicates of T0473 are aligned to 3bid. Magenta pairs form ionic interactions (guess which one with which): 

T0472_1  MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSPIEA------
T0472_2  ---RYAKEVAKNDKPYFNLKAANHQIIGTSQMYSSTAARDNGIKSVMENGKTTTIKDLT-
3bid_A   --MYFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEVLE

Target sequence - PDB file inconsistencies:

NMR models contain C-terminal His-tag residues 111-LEHHHHHH-118 not present in the target sequence. Majority of this region was removed from NMR models due to disorder anyway.

T0472    2k49.pdb    T0472.pdb    PyMOL    PyMOL of domains    

T0472    1 MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSPIEARYAKEVAKNDKPYFNLKAANHQIIGTSQMYSSTAARDNGIKSVMENGKTTTIKDLT-------- 110
           *|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~
2k49A    1 MSGWYELSKSSNDQFKFVLKAGNGEVILTSELYTGKSGAMNGIESVQTNSPIEARYAKEVAKNDKPYFNLKAANHQIIGTSQMYSSTAARDNGIKSVMENGKTTTIKDLTLEHHHHHH 118

Residue change log: remove 111-LEHHHHHH-118 as it is not present in target sequence; remove 1 M by 3.5Å SD cutoff;

2-domain protein, both domains used in evaluation:

1st domain: target 2-50, 102-110 ; pdb 2-50, 102-110

2nd domain: target 51-101 ; pdb 51-101

Sequence classification:

Tandem duplicate of DUF1508 from Pfam.

Comments:

Target canceled for human predictions by organizers because of early release. Moved to the "server only" status.

Server predictions:

T0472:pdb 1-110:seq 1-110:CM_hard;   alignment

distribution of first scores
First models for T0472: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

472_1:pdb 2-50,102-110:seq 2-50,102-110:CM_easy;   alignment

distribution of first scores
First models for T0472_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

472_2:pdb 51-101:seq 51-101:CM_easy;   alignment

distribution of first scores
First models for T0472_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0472 472_1 472_2 T0472 472_1 472_2 T0472 472_1 472_2 T0472 472_1 472_2
First score First Z-score Best score Best Z-score
1 pro−sp3−TASSER 71.56 55.05 70.14 82.76 62.93 78.77 83.33 80.06 83.19 2.73 1.76 1.36 0.91 0.10 0.80 0.88 0.90 0.81 71.56 55.05 70.14 82.76 75.00 78.77 85.78 80.06 87.35 2.63 1.53 1.29 0.86 0.58 0.74 0.94 0.82 0.99 pro−sp3−TASSER 1
2 FAMSD 70.18 59.02 75.70 89.22 84.91 86.50 91.67 90.03 89.67 2.60 2.18 1.70 1.24 1.16 1.25 1.24 1.32 1.11 70.18 59.02 75.70 89.22 84.91 86.50 91.67 90.03 89.67 2.50 1.96 1.65 1.22 1.11 1.26 1.23 1.29 1.14 FAMSD 2
3 pipe_int 69.04 59.40 74.79 87.93 85.34 88.51 89.22 83.99 88.51 2.50 2.22 1.64 1.17 1.18 1.36 1.13 1.06 1.06 69.04 59.40 74.79 87.93 85.34 88.51 89.22 83.99 88.51 2.39 2.00 1.59 1.15 1.13 1.40 1.11 1.01 1.07 pipe_int 3
4 RAPTOR 68.12 59.71 68.83 89.22 86.92 88.91 80.39 75.49 73.31 2.41 2.26 1.28 1.24 1.26 1.38 0.75 0.70 0.35 68.12 59.71 68.83 89.22 86.92 88.91 80.39 75.49 73.31 2.30 2.03 1.20 1.22 1.21 1.43 0.67 0.60 0.11 RAPTOR 4
5 FALCON_CONSENSUS 59.17 46.48 66.48 77.16 75.14 73.65 87.25 85.95 87.33 1.57 0.85 1.13 0.63 0.69 0.50 1.05 1.15 1.00 59.17 53.98 66.72 78.45 76.44 74.73 87.75 85.95 88.33 1.44 1.42 1.07 0.62 0.66 0.47 1.04 1.10 1.05 FALCON_CONSENSUS 5
6 FALCON 56.88 53.98 66.72 78.45 76.44 74.73 87.75 85.13 87.99 1.35 1.65 1.14 0.69 0.75 0.57 1.07 1.11 1.03 59.17 53.98 66.72 78.45 76.72 75.04 89.22 87.25 89.76 1.44 1.42 1.07 0.62 0.67 0.49 1.11 1.16 1.14 FALCON 6
7 PS2−server 56.42 46.79 65.44 79.74 78.59 78.77 86.28 75.49 85.80 1.31 0.88 1.07 0.76 0.85 0.80 1.00 0.70 0.93 66.74 62.00 68.32 80.17 79.31 79.39 86.28 78.59 85.80 2.17 2.28 1.17 0.72 0.81 0.78 0.96 0.75 0.90 PS2−server 7
8 SAM−T08−server 55.27 44.80 61.76 77.59 73.85 76.75 67.65 54.25 70.13 1.20 0.67 0.84 0.65 0.63 0.68 0.20 -0.20 0.20 55.96 50.77 61.76 78.45 77.87 77.44 67.65 62.74 70.13 1.13 1.07 0.75 0.62 0.73 0.65 0.03 -0.01 -0.09 SAM−T08−server 8
9 Zhang−Server 54.59 45.41 56.76 76.29 67.10 65.89 77.45 69.61 74.27 1.14 0.73 0.53 0.58 0.30 0.05 0.62 0.45 0.39 59.40 50.99 65.81 81.03 77.01 74.83 88.23 82.68 88.07 1.46 1.10 1.01 0.77 0.69 0.47 1.06 0.94 1.04 Zhang−Server 9
10 METATASSER 50.69 46.71 61.73 75.86 74.14 70.68 87.25 86.60 88.36 0.77 0.87 0.84 0.56 0.64 0.33 1.05 1.18 1.05 55.51 50.92 62.89 75.86 74.28 73.02 93.14 93.14 88.36 1.09 1.09 0.82 0.48 0.54 0.35 1.31 1.44 1.06 METATASSER 10
11 Pcons_dot_net 50.23 47.48 50.89 77.16 75.14 76.68 50.49 44.94 51.97 0.73 0.95 0.16 0.63 0.69 0.68 -0.55 -0.59 -0.65 50.23 47.48 58.32 78.88 78.31 77.05 55.88 53.59 73.68 0.58 0.72 0.53 0.65 0.75 0.62 -0.56 -0.45 0.14 Pcons_dot_net 11
12 MUSTER 47.25 43.73 63.24 74.14 72.70 75.78 87.25 85.95 87.38 0.45 0.56 0.93 0.47 0.57 0.63 1.05 1.15 1.00 47.71 45.72 64.63 77.59 75.58 77.25 88.23 86.60 89.68 0.34 0.53 0.93 0.57 0.61 0.64 1.06 1.13 1.14 MUSTER 12
13 Phyre_de_novo 47.02 41.67 68.47 77.59 70.11 78.66 85.29 81.70 89.82 0.43 0.34 1.25 0.65 0.45 0.79 0.96 0.97 1.12 47.02 45.11 68.47 77.59 75.72 78.66 85.29 81.70 89.82 0.28 0.47 1.18 0.57 0.62 0.73 0.92 0.90 1.15 Phyre_de_novo 13
14 BAKER−ROBETTA 47.02 39.22 58.32 76.29 75.72 74.68 55.88 53.59 73.68 0.43 0.08 0.62 0.58 0.72 0.56 -0.31 -0.22 0.36 50.23 47.48 58.32 78.88 78.31 77.05 55.88 53.59 73.68 0.58 0.72 0.53 0.65 0.75 0.62 -0.56 -0.45 0.14 BAKER−ROBETTA 14
15 fais−server 45.64 43.81 66.76 79.74 79.74 77.48 89.22 84.64 89.77 0.30 0.56 1.15 0.76 0.91 0.72 1.13 1.09 1.12 48.85 46.94 67.89 84.48 84.48 80.47 91.18 89.54 89.79 0.45 0.66 1.14 0.96 1.08 0.85 1.21 1.27 1.15 fais−server 15
16 GS−KudlatyPred 45.64 43.35 61.16 78.45 76.72 77.73 79.90 78.92 78.52 0.30 0.52 0.80 0.69 0.77 0.74 0.73 0.85 0.59 45.64 43.35 61.16 78.45 76.72 77.73 79.90 78.92 78.52 0.14 0.28 0.71 0.62 0.67 0.67 0.65 0.76 0.44 GS−KudlatyPred 16
17 FOLDpro 45.41 43.42 46.69 80.60 77.73 77.53 31.37 25.98 39.62 0.27 0.52 -0.10 0.80 0.81 0.73 -1.38 -1.40 -1.23 45.41 43.42 46.69 80.60 77.73 77.53 48.04 46.57 60.22 0.12 0.28 -0.22 0.74 0.72 0.65 -0.95 -0.78 -0.71 FOLDpro 17
18 Phragment 45.41 42.81 57.12 75.43 71.69 76.65 72.06 71.41 71.92 0.27 0.46 0.55 0.54 0.52 0.68 0.39 0.53 0.28 47.71 44.42 57.12 76.72 74.14 77.27 72.55 71.89 71.92 0.34 0.39 0.45 0.53 0.53 0.64 0.28 0.43 0.03 Phragment 18
19 MULTICOM−CLUSTER 45.18 39.68 64.56 79.74 78.31 78.13 88.72 86.77 86.12 0.25 0.12 1.01 0.76 0.84 0.76 1.11 1.18 0.94 46.79 44.49 67.43 79.74 78.31 78.68 89.22 87.25 88.28 0.25 0.40 1.11 0.69 0.75 0.73 1.11 1.16 1.05 MULTICOM−CLUSTER 19
20 HHpred4 44.95 43.88 64.26 79.31 77.59 77.04 87.25 87.25 88.45 0.23 0.57 0.99 0.73 0.81 0.70 1.05 1.20 1.05 44.95 43.88 64.26 79.31 77.59 77.04 87.25 87.25 88.45 0.08 0.33 0.91 0.67 0.72 0.62 1.01 1.16 1.06 HHpred4 20
21 HHpred2 44.95 43.88 64.26 79.31 77.59 77.04 87.25 87.25 88.45 0.23 0.57 0.99 0.73 0.81 0.70 1.05 1.20 1.05 44.95 43.88 64.26 79.31 77.59 77.04 87.25 87.25 88.45 0.08 0.33 0.91 0.67 0.72 0.62 1.01 1.16 1.06 HHpred2 21
22 HHpred5 44.95 43.88 64.26 79.31 77.59 77.04 87.25 87.25 88.45 0.23 0.57 0.99 0.73 0.81 0.70 1.05 1.20 1.05 44.95 43.88 64.26 79.31 77.59 77.04 87.25 87.25 88.45 0.08 0.33 0.91 0.67 0.72 0.62 1.01 1.16 1.06 HHpred5 22
23 MULTICOM−REFINE 44.95 43.73 64.41 79.74 78.31 77.92 88.23 87.25 86.17 0.23 0.56 1.00 0.76 0.84 0.75 1.09 1.20 0.95 47.48 44.49 67.14 79.74 78.31 78.09 89.22 87.91 88.25 0.32 0.40 1.09 0.69 0.75 0.69 1.11 1.19 1.05 MULTICOM−REFINE 23
24 MUProt 44.95 43.12 64.30 79.74 78.31 77.69 88.23 87.91 86.19 0.23 0.49 0.99 0.76 0.84 0.74 1.09 1.23 0.95 47.94 43.58 66.93 79.74 78.31 77.83 89.71 87.91 88.00 0.37 0.30 1.08 0.69 0.75 0.68 1.14 1.19 1.03 MUProt 24
25 BioSerf 44.95 42.20 54.20 79.74 63.36 77.83 44.12 41.99 59.15 0.23 0.39 0.37 0.76 0.12 0.74 -0.82 -0.72 -0.32 44.95 42.20 54.20 79.74 63.36 77.83 44.12 41.99 59.15 0.08 0.15 0.26 0.69 -0.04 0.68 -1.15 -1.00 -0.77 BioSerf 25
26 MULTICOM−CMFR 44.73 43.65 64.60 79.74 78.59 78.12 88.23 87.91 86.42 0.21 0.55 1.01 0.76 0.85 0.76 1.09 1.23 0.96 47.02 43.81 67.16 79.74 78.59 78.21 90.20 88.89 88.12 0.28 0.33 1.10 0.69 0.77 0.70 1.16 1.24 1.04 MULTICOM−CMFR 26
27 GS−MetaServer2 44.73 43.65 26.99 13.79 13.22 4.72 86.77 86.77 87.61 0.21 0.55 -1.32 -2.59 -2.29 -3.48 1.03 1.18 1.01 44.73 43.65 35.45 33.62 27.01 34.94 86.77 86.77 87.61 0.06 0.31 -0.95 -1.88 -1.98 -2.23 0.99 1.14 1.01 GS−MetaServer2 27
28 FFASflextemplate 44.73 43.35 26.51 13.79 12.93 4.65 86.77 86.11 87.08 0.21 0.52 -1.35 -2.59 -2.30 -3.49 1.03 1.15 0.99 44.73 43.35 26.51 13.79 12.93 4.65 86.77 86.11 87.08 0.06 0.28 -1.52 -2.99 -2.73 -4.28 0.99 1.11 0.98 FFASflextemplate 28
29 MULTICOM−RANK 44.49 43.88 64.02 79.31 77.87 77.22 88.23 87.91 86.07 0.19 0.57 0.98 0.73 0.82 0.71 1.09 1.23 0.94 47.71 43.88 66.51 79.31 77.87 77.49 89.71 87.91 87.79 0.34 0.33 1.05 0.67 0.73 0.65 1.14 1.19 1.02 MULTICOM−RANK 29
30 Poing 44.27 40.29 57.75 76.72 73.85 77.30 72.55 70.59 72.16 0.17 0.19 0.59 0.60 0.63 0.71 0.41 0.50 0.29 45.87 41.90 57.75 76.72 73.85 77.53 72.55 70.59 72.16 0.17 0.12 0.49 0.53 0.52 0.65 0.28 0.37 0.04 Poing 30
31 Phyre2 44.27 40.29 57.74 76.72 73.85 77.42 72.55 68.95 71.96 0.17 0.19 0.59 0.60 0.63 0.72 0.41 0.43 0.28 45.87 44.04 57.74 76.72 74.14 77.42 73.53 68.95 71.96 0.17 0.35 0.49 0.53 0.53 0.65 0.33 0.29 0.03 Phyre2 31
32 nFOLD3 44.04 40.98 27.55 75.86 75.29 70.92 15.69 14.71 3.34 0.14 0.26 -1.28 0.56 0.70 0.35 -2.06 -1.87 -2.93 44.04 42.66 40.10 79.31 78.16 77.25 65.69 58.50 71.83 -0.01 0.20 -0.65 0.67 0.75 0.64 -0.07 -0.21 0.02 nFOLD3 32
33 FUGUE_KM 44.04 40.98 27.55 75.86 75.29 70.92 15.69 14.71 3.34 0.14 0.26 -1.28 0.56 0.70 0.35 -2.06 -1.87 -2.93 44.04 40.98 27.55 75.86 75.29 70.92 51.47 42.97 58.16 -0.01 0.02 -1.46 0.48 0.59 0.21 -0.78 -0.95 -0.84 FUGUE_KM 33
34 COMA 43.81 39.30 64.87 78.02 69.68 77.55 87.25 74.84 87.46 0.12 0.08 1.03 0.67 0.43 0.73 1.05 0.68 1.01 43.81 39.30 64.87 78.02 69.68 77.55 87.25 74.84 87.46 -0.03 -0.16 0.95 0.60 0.30 0.66 1.01 0.57 1.00 COMA 34
35 COMA−M 43.81 39.30 64.87 78.02 69.68 77.55 87.25 74.84 87.46 0.12 0.08 1.03 0.67 0.43 0.73 1.05 0.68 1.01 43.81 39.30 64.87 78.02 69.68 77.55 87.25 74.84 87.46 -0.03 -0.16 0.95 0.60 0.30 0.66 1.01 0.57 1.00 COMA−M 35
36 FFASstandard 43.35 39.22 26.26 13.79 12.93 4.57 85.29 79.74 86.57 0.08 0.08 -1.36 -2.59 -2.30 -3.49 0.96 0.88 0.97 44.73 43.35 26.51 13.79 12.93 4.65 86.77 86.11 87.08 0.06 0.28 -1.52 -2.99 -2.73 -4.28 0.99 1.11 0.98 FFASstandard 36
37 panther_server 43.35 38.61 28.45 78.02 76.29 71.54 9.31 8.66 1.90 0.08 0.01 -1.23 0.67 0.74 0.38 -2.33 -2.13 -3.00 43.35 38.61 28.45 78.02 76.29 71.54 25.49 20.26 30.22 -0.08 -0.23 -1.40 0.60 0.65 0.25 -2.08 -2.04 -2.59 panther_server 37
38 rehtnap 43.12 38.69 27.04 75.00 73.85 70.71 10.78 10.78 2.00 0.06 0.02 -1.31 0.52 0.63 0.33 -2.27 -2.04 -2.99 43.58 42.35 27.53 75.86 73.85 70.71 17.16 15.85 5.16 -0.05 0.17 -1.46 0.48 0.52 0.19 -2.50 -2.25 -4.16 rehtnap 38
39 CpHModels 42.89 41.82 27.72 74.57 73.13 70.82 14.22 13.89 3.10 0.04 0.35 -1.27 0.49 0.59 0.34 -2.12 -1.91 -2.94 42.89 41.82 27.72 74.57 73.13 70.82 14.22 13.89 3.10 -0.12 0.11 -1.45 0.40 0.48 0.20 -2.65 -2.34 -4.29 CpHModels 39
40 3Dpro 42.66 40.21 52.64 78.45 76.72 77.49 45.59 42.32 56.59 0.02 0.18 0.27 0.69 0.77 0.72 -0.76 -0.70 -0.44 46.79 43.58 54.84 80.60 77.59 77.76 50.00 45.91 63.47 0.25 0.30 0.30 0.74 0.72 0.67 -0.85 -0.81 -0.50 3Dpro 40
41 Pushchino 42.43 40.44 25.87 78.02 74.86 70.40 0.00 0.00 0.00 -0.01 0.21 -1.39 0.67 0.68 0.32 -2.74 -2.50 -3.08 42.43 40.44 25.87 78.02 74.86 70.40 0.00 0.00 0.00 -0.16 -0.04 -1.57 0.60 0.57 0.17 -3.36 -3.01 -4.48 Pushchino 41
42 SAM−T02−server 40.37 39.76 25.33 75.86 75.29 70.92 0.00 0.00 0.00 -0.20 0.13 -1.42 0.56 0.70 0.35 -2.74 -2.50 -3.08 40.37 39.76 25.33 75.86 75.29 70.92 44.61 38.07 53.62 -0.36 -0.11 -1.60 0.48 0.59 0.21 -1.12 -1.19 -1.12 SAM−T02−server 42
43 Pcons_local 40.14 38.00 25.05 12.93 12.93 4.65 81.37 76.80 83.10 -0.22 -0.05 -1.44 -2.63 -2.30 -3.49 0.79 0.76 0.80 40.14 38.00 27.05 43.10 42.24 45.19 81.37 76.80 83.10 -0.38 -0.30 -1.49 -1.35 -1.17 -1.54 0.72 0.66 0.73 Pcons_local 43
44 Distill 39.22 35.55 47.62 64.22 58.76 61.82 41.18 34.31 50.60 -0.31 -0.32 -0.04 -0.03 -0.10 -0.18 -0.95 -1.04 -0.72 39.22 35.55 47.62 64.22 58.76 63.58 41.18 34.31 50.60 -0.47 -0.56 -0.16 -0.17 -0.29 -0.29 -1.29 -1.37 -1.31 Distill 44
45 Fiser−M4T 38.76 38.30 24.38 72.84 72.27 68.65 0.00 0.00 0.00 -0.35 -0.02 -1.48 0.41 0.55 0.21 -2.74 -2.50 -3.08 38.76 38.30 24.38 72.84 72.27 68.65 0.00 0.00 0.00 -0.52 -0.27 -1.66 0.31 0.43 0.05 -3.36 -3.01 -4.48 Fiser−M4T 45
46 SAM−T06−server 37.62 29.89 50.83 55.17 52.30 65.68 48.53 41.99 62.72 -0.46 -0.92 0.16 -0.49 -0.41 0.04 -0.63 -0.72 -0.15 40.37 39.60 50.83 74.14 73.56 68.35 48.53 41.99 62.72 -0.36 -0.13 0.04 0.38 0.50 0.03 -0.93 -1.00 -0.55 SAM−T06−server 46
47 GeneSilicoMetaServer 36.70 32.11 35.45 25.00 22.13 27.79 68.14 61.27 71.18 -0.55 -0.68 -0.79 -2.02 -1.86 -2.15 0.22 0.10 0.25 44.73 43.65 35.45 33.62 27.01 34.94 86.77 86.77 87.61 0.06 0.31 -0.95 -1.88 -1.98 -2.23 0.99 1.14 1.01 GeneSilicoMetaServer 47
48 Frankenstein 32.80 26.07 35.60 33.62 25.29 33.96 62.74 50.00 65.74 -0.91 -1.32 -0.78 -1.58 -1.71 -1.79 -0.02 -0.38 -0.01 34.86 29.36 39.54 38.79 35.92 47.89 62.74 54.58 65.91 -0.89 -1.23 -0.68 -1.60 -1.50 -1.35 -0.21 -0.40 -0.35 Frankenstein 48
49 3DShot2 32.57 26.91 28.35 31.90 25.00 28.69 56.37 49.18 56.29 -0.93 -1.24 -1.23 -1.67 -1.72 -2.10 -0.29 -0.41 -0.45 32.57 26.91 28.35 31.90 25.00 28.69 56.37 49.18 56.29 -1.11 -1.49 -1.41 -1.98 -2.08 -2.65 -0.53 -0.66 -0.95 3DShot2 49
50 RBO−Proteus 31.65 27.68 44.88 56.90 50.86 64.54 59.31 46.57 53.15 -1.02 -1.15 -0.21 -0.40 -0.48 -0.02 -0.17 -0.52 -0.60 31.65 28.21 44.88 59.05 53.30 64.54 59.31 50.33 55.30 -1.20 -1.35 -0.34 -0.46 -0.58 -0.23 -0.39 -0.60 -1.01 RBO−Proteus 50
51 FFASsuboptimal 30.73 29.51 32.56 42.67 36.06 45.88 49.51 40.03 45.42 -1.11 -0.96 -0.97 -1.13 -1.19 -1.10 -0.59 -0.80 -0.96 43.35 42.58 33.57 78.88 78.31 74.66 49.51 40.03 45.42 -0.08 0.19 -1.07 0.65 0.75 0.46 -0.88 -1.09 -1.63 FFASsuboptimal 51
52 PSI 30.27 27.22 47.36 56.47 51.29 59.79 47.55 39.87 65.77 -1.15 -1.20 -0.05 -0.42 -0.46 -0.30 -0.68 -0.81 -0.01 32.57 30.12 48.25 60.34 57.18 61.38 48.04 42.16 66.05 -1.11 -1.14 -0.12 -0.39 -0.37 -0.44 -0.95 -0.99 -0.34 PSI 52
53 MUFOLD−Server 29.36 24.31 32.12 53.88 44.54 46.65 34.80 33.17 43.18 -1.24 -1.51 -1.00 -0.56 -0.78 -1.06 -1.23 -1.09 -1.06 29.59 24.31 39.38 54.31 44.54 46.65 49.51 43.46 61.79 -1.40 -1.77 -0.69 -0.73 -1.04 -1.44 -0.88 -0.93 -0.61 MUFOLD−Server 53
54 FEIG 29.13 24.39 34.54 40.52 33.91 48.04 41.67 39.71 46.62 -1.26 -1.50 -0.85 -1.23 -1.29 -0.98 -0.93 -0.81 -0.90 29.13 26.84 38.36 42.67 36.49 52.96 47.06 42.48 50.35 -1.44 -1.50 -0.76 -1.38 -1.47 -1.01 -1.00 -0.98 -1.32 FEIG 54
55 MUFOLD−MD 28.44 23.70 48.78 46.55 42.82 61.46 50.00 41.18 67.43 -1.32 -1.58 0.03 -0.93 -0.87 -0.20 -0.57 -0.75 0.07 37.62 34.86 55.66 63.36 60.34 77.09 50.00 43.46 67.43 -0.62 -0.63 0.35 -0.22 -0.20 0.63 -0.85 -0.93 -0.25 MUFOLD−MD 55
56 mGenTHREADER 26.38 24.62 44.90 40.09 38.65 71.33 47.55 41.99 44.98 -1.52 -1.48 -0.21 -1.26 -1.07 0.37 -0.68 -0.72 -0.98 26.38 24.62 44.90 40.09 38.65 71.33 47.55 41.99 44.98 -1.70 -1.73 -0.34 -1.52 -1.36 0.23 -0.98 -1.00 -1.66 mGenTHREADER 56
57 circle 24.77 21.86 30.32 41.81 36.64 41.41 43.14 42.48 47.06 -1.67 -1.77 -1.11 -1.17 -1.16 -1.36 -0.87 -0.70 -0.88 30.50 25.61 37.01 54.31 44.54 52.31 48.04 46.41 49.20 -1.31 -1.63 -0.85 -0.73 -1.04 -1.05 -0.95 -0.79 -1.40 circle 57
58 3D−JIGSAW_AEP 24.54 22.94 33.76 32.76 32.47 34.64 46.08 41.18 53.27 -1.69 -1.66 -0.90 -1.63 -1.36 -1.75 -0.74 -0.75 -0.59 24.54 22.94 34.14 33.19 32.47 35.44 46.08 41.18 53.49 -1.88 -1.92 -1.03 -1.91 -1.69 -2.20 -1.05 -1.04 -1.13 3D−JIGSAW_AEP 58
59 3D−JIGSAW_V3 24.08 23.01 36.31 34.05 27.73 42.16 45.59 42.97 52.23 -1.73 -1.65 -0.74 -1.56 -1.59 -1.32 -0.76 -0.68 -0.64 25.69 23.01 41.85 37.93 33.91 51.86 46.57 42.97 54.58 -1.77 -1.91 -0.54 -1.64 -1.61 -1.08 -1.02 -0.95 -1.06 3D−JIGSAW_V3 59
60 forecast 22.25 20.26 31.37 32.76 24.71 37.48 41.18 37.26 51.56 -1.90 -1.94 -1.05 -1.63 -1.74 -1.59 -0.95 -0.92 -0.67 23.62 20.72 33.15 32.76 25.43 37.48 44.12 41.83 59.25 -1.97 -2.15 -1.10 -1.93 -2.06 -2.06 -1.15 -1.01 -0.77 forecast 60
61 LOOPP_Server 20.64 16.51 24.16 30.17 23.42 29.69 36.27 29.09 43.14 -2.06 -2.34 -1.49 -1.76 -1.80 -2.04 -1.16 -1.26 -1.07 35.32 29.97 32.78 38.36 32.62 38.72 64.22 55.72 64.08 -0.85 -1.16 -1.12 -1.62 -1.68 -1.97 -0.14 -0.35 -0.46 LOOPP_Server 61
62 mariner1 20.18 15.44 23.02 31.47 25.72 36.37 28.43 23.86 30.15 -2.10 -2.46 -1.56 -1.69 -1.69 -1.65 -1.50 -1.49 -1.67 21.79 19.95 29.04 35.34 31.32 45.89 39.71 37.58 44.66 -2.14 -2.24 -1.36 -1.79 -1.75 -1.49 -1.37 -1.21 -1.68 mariner1 62
63 keasar−server 18.81 16.21 29.13 28.45 22.13 34.20 38.73 33.17 49.66 -2.23 -2.37 -1.18 -1.85 -1.86 -1.78 -1.06 -1.09 -0.76 27.75 24.85 31.25 40.52 35.06 36.34 52.45 43.79 55.94 -1.57 -1.71 -1.22 -1.50 -1.55 -2.14 -0.73 -0.92 -0.97 keasar−server 63
64 ACOMPMOD 18.35 15.67 23.45 25.00 22.70 28.43 29.41 25.98 44.62 -2.27 -2.43 -1.54 -2.02 -1.83 -2.11 -1.46 -1.40 -1.00 20.64 18.73 23.45 31.90 28.74 38.44 30.39 26.14 44.62 -2.25 -2.37 -1.72 -1.98 -1.88 -1.99 -1.83 -1.76 -1.68 ACOMPMOD 64
65 huber−torda−server 18.12 13.69 15.42 23.71 18.82 22.83 29.90 27.61 31.17 -2.29 -2.64 -2.03 -2.09 -2.02 -2.43 -1.44 -1.33 -1.63 18.12 17.05 21.83 32.76 28.74 31.50 29.90 29.57 35.45 -2.50 -2.55 -1.83 -1.93 -1.88 -2.46 -1.86 -1.59 -2.26 huber−torda−server 65
66 RANDOM 17.70 14.78 17.70 26.68 22.06 26.68 29.71 25.56 29.71 -2.33 -2.53 -1.89 -1.94 -1.87 -2.21 -1.45 -1.41 -1.69 17.70 14.78 17.70 26.68 22.06 26.68 29.71 25.56 29.71 -2.54 -2.79 -2.09 -2.27 -2.24 -2.79 -1.87 -1.79 -2.62 RANDOM 66
67 schenk−torda−server 17.66 13.23 16.09 26.72 22.13 26.69 26.47 25.16 28.15 -2.34 -2.69 -1.99 -1.93 -1.86 -2.21 -1.59 -1.43 -1.77 18.35 17.28 22.31 30.17 29.89 35.02 29.90 26.47 41.87 -2.47 -2.52 -1.80 -2.08 -1.82 -2.23 -1.86 -1.74 -1.86 schenk−torda−server 67
68 Pcons_multi 17.43 15.06 20.58 30.60 26.58 37.25 24.51 22.55 24.39 -2.36 -2.50 -1.71 -1.74 -1.65 -1.60 -1.67 -1.54 -1.94 21.33 16.97 24.91 30.60 26.87 37.25 33.82 28.43 45.17 -2.19 -2.56 -1.63 -2.05 -1.98 -2.07 -1.66 -1.65 -1.65 Pcons_multi 68
69 OLGAFS 14.45 11.54 13.95 21.12 16.24 23.18 23.53 21.57 26.55 -2.64 -2.87 -2.12 -2.22 -2.15 -2.41 -1.72 -1.58 -1.84 17.20 16.59 19.28 23.71 18.82 24.05 32.35 31.54 39.63 -2.58 -2.60 -1.99 -2.44 -2.41 -2.97 -1.74 -1.50 -2.00 OLGAFS 69
70 BHAGEERATH                                                       -2.33 -2.53 -1.89 -1.94 -1.87 -2.21 -1.45 -1.41 -1.69                                                       -2.54 -2.79 -2.09 -2.27 -2.24 -2.79 -1.87 -1.79 -2.62 BHAGEERATH 70
71 LEE−SERVER                                                       -2.33 -2.53 -1.89 -1.94 -1.87 -2.21 -1.45 -1.41 -1.69                                                       -2.54 -2.79 -2.09 -2.27 -2.24 -2.79 -1.87 -1.79 -2.62 LEE−SERVER 71
72 YASARA                                                       -2.33 -2.53 -1.89 -1.94 -1.87 -2.21 -1.45 -1.41 -1.69                                                       -2.54 -2.79 -2.09 -2.27 -2.24 -2.79 -1.87 -1.79 -2.62 YASARA 72
73 mahmood−torda−server                                                       -2.33 -2.53 -1.89 -1.94 -1.87 -2.21 -1.45 -1.41 -1.69                                                       -2.06 -2.58 -2.09 -1.88 -1.87 -2.79 -1.71 -1.73 -2.62 mahmood−torda−server 73
74 test_http_server_01                                                       -2.33 -2.53 -1.89 -1.94 -1.87 -2.21 -1.45 -1.41 -1.69                                                       -2.54 -2.79 -2.09 -2.27 -2.24 -2.79 -1.87 -1.79 -2.62 test_http_server_01 74