T0466

NMR Targets
437 460 462 464
466 467 468 469
471 472 473 474
475 476 480 482
484 492 498 499
500

T0466

protein SAG0934 from Streptococcus agalactiae

Target type: Human/Server

Target sequence:

>T0466 SaR32, Streptococcus agalactiae, 128 residues
MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADDIVLTKDSSSFKAQPQAKKEPTQDK

Structure:
Method: NMR
Determined by: NESG
PDB ID: 2k5d

jumping through 466 NMR models
Jumping through 20 NMR models of 2k5d

all 20 466 NMR models
All 20 superimposed NMR models of 2k5d

PyMOL of 2k5d

Domains:  PyMOL of domains

Single domain protein with poorly structured N-terminus and a loop. Structurally variable regions were removed from NMR models for evaluation of predictions.

Structure classification:

OB-fold. 5-stranded β-barrel. The five strands are shown in the ribbon diagram below as dark blue, cyan-green, lime-green, yellow and red. In addition to the 5-stranded OB-core, this structure is elaborated with a long insertion between β-strands 4 and 5 housing an α-helix. The two β-strands (orange-yellow and orange) in this region are extensions of the β-strands 4 and 5 and they close the barrel.

2k5d_1_14_108_cartoon
Cartoon diagram of T0466: 2k5d model 1 residues 14-108

CASP category:

Fold recognition. Fold similarity not detectable statistically by sequence methods known to us.

Closest templates:

All three COMPASS hit to OB-fold proteins are to the Nucleic acid - binding domain superfamily, however, alignments are wrong as they do not validate structurally. First hit is #27 in the total list of hits and its E-value is around 35, so it can hardy be called statistically significant in any case. Moreover, proteins from all SCOP classes were found by COMPASS prior to this hit. According to structure, proteins from 'Nucleic acid - binding' superfamily are also most similar to T0466.

Target sequence - PDB file inconsistencies:

NMR models contain two C-terminal residues 109-LE-110 not present in the target sequence. Instead of these two residues, target sequence contains the following C-terminus 109-KDSSSFKAQPQAKKEPTQDK-128 apparently cloned out for structure determination.

T0466    2k5d.pdb    T0466.pdb    PyMOL    PyMOL of domains    

T0466    1 MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADDIVLTKDSSSFKAQPQAKKEPTQDK-- 128
           *************||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||********|||||||||||||~~~~~~~~~~~~~~~~~~~~~~
2k5dA    1 MMRLANGIVLDKDTTFGELKFSALRREVRIQNEDGSVSDEIKERTYDLKSKGQGRMIQVSIPASVPLKEFDYNARVELINPIADTVATATYQGADVDWYIKADDIVLT--------------------LE 110

Residue change log: remove 109-LE-110 as it is not present in target sequence; remove 1-MMRLANGIVLDKD-13, 88-TATYQGAD-95 by 3.5Å SD cutoff;

Single domain protein: target 14-87, 96-108 ; pdb 14-87, 96-108

Sequence classification:

DUF961 in Pfam, which includes just a few very close homologs. Below is PROMALS3D alignment of several most distant homologs detectable by PSI-BLAST. 

Conservation    6           5   978 5 6                                7 657     5 7 8 58     5     5     6 66 8                             655                      
188584883      TYIEQVERVVARVDITGTVDYLEKGIVVDIYDENG-----------EIMEELEVS----------PGMVEVKIPMNYPEK----------EVPV-------EVDIEDNLP---EFYLESVEISPEQVEVGGWESVIN--------------
29374784       MGLTFENNTIENFDVQATFGMMNFLEVVAINERDGE---------NNVTEEVREQRVTVYSSKL-NDQVEIVIDPDYDVS----GINYDDEIELTGNVTARGWLYTFKGYNDNVQTEQAFKVRAAGIKKVGAVKQTQAPQPKEKQENKQ--
29377029       MGLTFENNTIENFDVQGTFGTMNFLEVVAINERDGE---------GNVTDEVREQRVTVYSSKL-NDQVEIAIDPDYDVS----GINYDDEIELTGNVTARGWLNTFKGFNDNVQTEQAFKVRSAGIKKVGAVKPTQTPQPREKQENK---
116872189      MSLKFEENTIKDFDVKKTFGTCYYLSAQSIYENDSE---------GNRTEIVREQRVTIYSEVK-NDQIDITLPETTDLA----SFSYDDEIELTGEVTALAWLSSYAGYN--DSIQSEQAFKIRAGGIKKVTTPHQKPEKQKSTGTLQGE
49483485       --------MKPVLDIKKTLGQLNFLGVDEKYKYEN-----------GERTDKTVYAYKLASQEQ-GEQITVKTPNKVE-------LDYLQECELVEPDVKMYVQMSGDF------GTIAYSWNAEDIKVVGSNSALKQK------------
24378720       MTLKYAADVIEKFDLDKTFGTLNFLETVPIMKWEDYLDESTGEEKRRETDELEALDVKIYSSAA-GGIITVTVPPEAKVIQLTPEKNYNDEVKLVAPTARFWSNSEVINGR--RVVTSGVKIRAKDVVVSNVGKSNTKEIKPDK-------
167767490      ----MRLSNGFVIDKEKTFGELKFTAVR-DVFLQNED--------GTPSTQLKKRIYDLKCSLH-GGIIPVSVPPEVPLR----EFPYNAVVELVNPVADTVSRKTYTG------ADVDWYVKAEDIVLKNKGNQNAGSPQNHTPQGQPKK
126700965      ----MRLANGIVIDKEATFGALKFSALRREVHLQNED--------GSVSEEIKERTYDLKSRGQ-GRMIQVSIPASVPLK----EFDYNAEVELINPVADTVATATFQG------AEVDWYIKAEDIVLKKGTSMNPQPPKKDTPPVK---
194271962      ----MRLAEGMIINQEKTFGTLKFSALRREVRKQNED--------GTVSTEIKERTYNLKSSTQ-GRMIQVSIPAEVPLR----EFPYDAEVELVQPTVDTVANYVFREG-----TTVSWFIKAEDLILKKNGPVSQQQEKPVPKK-----
153174536      ----MKFTEKVKLDIAATFGTLEFLGHDGERTKAGE----------DNQSVVLNQRYGLSSSAQ-EGTVVIYLPADKKLS-----FDYDTEVTLVNPTISAFATATYNA------MDVITQIFADDIIPVAKNQTNTSHKGKEAN------
153174537      -----MELKF-IATTNETFENVRYAGHDATKDIKTG----------FGRNEKLEKRYFALLSQDFPGGLEVYLPEVAGEK----DFAFKTKVKLVNPVMIPVASRIGNNN-----ALVNWELHADDLVPFK--------------------
194271961      -----MELKFVVPNMEKTFGHLTYAGEGEVLTEGS-----------GRNRVVIGRSYHLYSDIQRADDIEIIVAPEVGEK----IFKDGELVKVVNPKIQVEGYQIDNR------GYTNYLLKVDDLVKVNGGM-----------------
126700966      -----MELKFVIPNMEKTFGNLEFAGEDKTEQRRI-----------NGRMAVLSRSFNLYSDVQRADDIVVILPAEAGEK----HFDFEERVKLVNPRITAEGYKIGTR------GFTNYILHADDMVKA---------------------
167767710      -----MEMKYVVPDMAQSFGTLEFAGESEPVFERDK----------NNRRVLTRRSYNLYSDVQKGENVVVEIPVQAGEK----HFKYEQKVKLVNPKLYGRGYAIGDM------GHTDYVLVADDIVAVEEK------------------
16077552       -----MNLNFIVPDINMTFGDMKFMGLNRERYVYDRE-------NNKRTDVLESRIYNIASAVQ-GGQIEVTIPEYAGAK----EIPPFADIELKNPKISAMATSQRDST----YANVMWKLEADDIVVKGGSSVKPAAATGGNEKK----
166033406      -----MQITLTKEQVKEAFGELRFMGADNCYRYDKDS--------KKKTEEVEALKLHLGSMKL-GNSVDIRLEAT-ELP----KIEPYAVVELEEPVYAPYVQRGNF-------PVLVEKITCKGIRPVANKNM----------------
T0466          ---MMRLANGIVLDKDTTFGELKFSALRREVRIQNED--------GSVSDEIKERTYDLKSKGQ-GRMIQVSIPASVPLK----EFDYNARVELINPIADTVATATYQG------ADVDWYIKADDIVLTKDSSSFKAQPQAKKEPTQDK-
Consensus_aa   ch...........s.p.TFGplp@.............p........p.pp.l..pp@plbtp.p.s..l.V.lP.phsbpp....h.hp.clcllsP.h.h.s.......p....s..sh.l.h-sh........................
Consensus_ss      ee      ee hhh        ee  ee    eee            eeeeeeeeeee      eeeeee                  eeee  eeeeeeee   e      eeeeeeeee eeeee                    

Comments:

ROSETTA failed to predict this OB-fold de-novo. Metaserver bioinfo.pl did not find similarity to other OB-fold proteins. Although some servers used OB-folds as templates, it is unclear how significant those predictions are, as quite a few all-β folds were used as templates, in particular, lipocalins, also a β-barrel fold. The bias towards lipocalin fold in ab-initio servers is likely caused by the local meander-like nature β-strand interactions in it.

Server predictions:

T0466:pdb 14-108:seq 14-108:FR;   alignment

distribution of first scores
First models for T0466: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0466 T0466 T0466 T0466
First score First Z-score Best score Best Z-score
1 MUSTER 50.86 44.16 49.12 3.98 4.26 2.89 50.86 44.16 49.12 2.64 2.74 2.23 MUSTER 1
2 ZicoFullSTP 48.56 42.15 46.87 3.62 3.89 2.58 48.56 42.91 46.87 2.36 2.56 1.93 ZicoFullSTP 2
3 Chicken_George 44.25 39.08 44.31 2.95 3.32 2.22 45.98 40.04 45.63 2.04 2.15 1.77 Chicken_George 3
4 BAKER−ROBETTA 40.23 32.95 39.65 2.33 2.19 1.58 40.23 32.95 39.65 1.34 1.14 0.99 BAKER−ROBETTA 4
5 3DShotMQ 37.93 25.86 39.79 1.97 0.88 1.60 37.93 25.86 39.79 1.05 0.13 1.01 3DShotMQ 5
6 MULTICOM−REFINE 35.63 28.35 39.68 1.61 1.34 1.58 35.63 29.02 39.95 0.77 0.58 1.03 MULTICOM−REFINE 6
7 Elofsson 35.63 28.35 39.59 1.61 1.34 1.57 35.63 28.35 39.59 0.77 0.49 0.99 Elofsson 7
8 MUProt 35.06 27.97 39.64 1.52 1.27 1.58 35.06 29.60 39.64 0.70 0.66 0.99 MUProt 8
9 Bates_BMM 35.06 27.59 39.94 1.52 1.20 1.62 35.06 29.41 39.99 0.70 0.64 1.04 Bates_BMM 9
10 MULTICOM−CLUSTER 35.06 27.20 39.51 1.52 1.13 1.56 35.06 29.41 39.51 0.70 0.64 0.98 MULTICOM−CLUSTER 10
11 GS−KudlatyPred 34.77 25.57 39.19 1.48 0.83 1.51 38.51 32.95 40.72 1.12 1.14 1.13 GS−KudlatyPred 11
12 MULTICOM−RANK 34.48 31.70 40.18 1.43 1.96 1.65 34.48 31.70 40.18 0.63 0.96 1.06 MULTICOM−RANK 12
13 MULTICOM−CMFR 34.20 29.69 39.93 1.39 1.59 1.62 34.20 29.69 39.93 0.60 0.68 1.03 MULTICOM−CMFR 13
14 Zhang 33.91 28.45 37.20 1.34 1.36 1.24 37.93 28.45 37.34 1.05 0.50 0.69 Zhang 14
15 Zhang−Server 33.62 26.34 35.55 1.30 0.97 1.01 33.62 26.34 35.55 0.52 0.20 0.46 Zhang−Server 15
16 ABIpro 32.18 27.97 35.48 1.07 1.27 1.00 32.18 27.97 35.48 0.35 0.43 0.45 ABIpro 16
17 FALCON 32.18 27.97 35.48 1.07 1.27 1.00 37.64 32.09 39.27 1.02 1.02 0.94 FALCON 17
18 KudlatyPredHuman 31.90 29.21 38.71 1.03 1.50 1.45 35.34 29.31 39.74 0.74 0.62 1.01 KudlatyPredHuman 18
19 MULTICOM 31.90 29.21 40.58 1.03 1.50 1.71 38.79 33.81 41.43 1.16 1.26 1.23 MULTICOM 19
20 GeneSilico 31.90 26.82 31.46 1.03 1.06 0.44 31.90 26.82 32.11 0.31 0.27 0.01 GeneSilico 20
21 McGuffin 31.61 29.31 39.74 0.99 1.52 1.59 37.64 31.70 39.74 1.02 0.96 1.01 McGuffin 21
22 mufold 31.61 28.54 38.86 0.99 1.38 1.47 34.48 28.54 38.86 0.63 0.51 0.89 mufold 22
23 Jones−UCL 31.61 23.95 34.79 0.99 0.53 0.90 35.34 32.47 41.03 0.74 1.07 1.17 Jones−UCL 23
24 ZicoFullSTPFullData 31.32 29.69 38.59 0.94 1.59 1.43 48.56 42.15 46.87 2.36 2.45 1.93 ZicoFullSTPFullData 24
25 FALCON_CONSENSUS 31.32 27.49 33.77 0.94 1.18 0.76 37.64 31.70 39.27 1.02 0.96 0.94 FALCON_CONSENSUS 25
26 PSI 31.03 27.78 38.29 0.90 1.24 1.39 31.61 29.31 39.74 0.28 0.62 1.01 PSI 26
27 MidwayFolding 31.03 23.56 34.51 0.90 0.46 0.86 31.03 23.56 34.51 0.21 -0.20 0.32 MidwayFolding 27
28 RAPTOR 31.03 23.56 34.51 0.90 0.46 0.86 31.03 24.14 34.51 0.21 -0.11 0.32 RAPTOR 28
29 PS2−server 30.46 25.10 31.78 0.81 0.74 0.49 30.46 25.10 31.78 0.14 0.02 -0.03 PS2−server 29
30 PS2−manual 30.46 25.10 31.78 0.81 0.74 0.49 30.46 25.10 31.78 0.14 0.02 -0.03 PS2−manual 30
31 fais−server 30.46 24.23 32.76 0.81 0.58 0.62 30.46 24.23 32.76 0.14 -0.10 0.10 fais−server 31
32 fams−ace2 30.17 26.92 37.98 0.76 1.08 1.35 34.77 29.41 39.93 0.67 0.64 1.03 fams−ace2 32
33 GS−MetaServer2 29.89 23.37 28.69 0.72 0.42 0.06 29.89 23.37 28.69 0.07 -0.22 -0.43 GS−MetaServer2 33
34 GeneSilicoMetaServer 29.89 23.37 28.69 0.72 0.42 0.06 29.89 23.37 28.69 0.07 -0.22 -0.43 GeneSilicoMetaServer 34
35 FrankensteinLong 29.60 25.00 31.43 0.67 0.72 0.44 29.60 25.00 31.43 0.03 0.01 -0.08 FrankensteinLong 35
36 Softberry 29.60 24.62 30.22 0.67 0.65 0.27 29.60 24.62 30.22 0.03 -0.05 -0.23 Softberry 36
37 MUFOLD−MD 29.60 24.43 36.14 0.67 0.62 1.09 29.60 24.43 36.14 0.03 -0.07 0.54 MUFOLD−MD 37
38 METATASSER 29.60 24.23 33.79 0.67 0.58 0.76 40.80 36.40 36.95 1.41 1.63 0.64 METATASSER 38
39 FAMS−multi 29.31 22.32 31.96 0.63 0.23 0.51 30.17 25.57 33.51 0.10 0.09 0.19 FAMS−multi 39
40 3DShot1 29.31 22.03 34.36 0.63 0.17 0.84 29.31 22.03 34.36 -0.00 -0.41 0.31 3DShot1 40
41 Kolinski 29.02 25.00 30.85 0.58 0.72 0.36 30.17 25.00 30.85 0.10 0.01 -0.15 Kolinski 41
42 Phyre2 29.02 23.85 29.74 0.58 0.51 0.20 29.02 23.85 31.64 -0.04 -0.15 -0.05 Phyre2 42
43 Sasaki−Cetin−Sasai 28.16 22.99 30.35 0.45 0.35 0.29 28.16 22.99 30.51 -0.15 -0.28 -0.20 Sasaki−Cetin−Sasai 43
44 TASSER 26.72 21.74 27.74 0.23 0.12 -0.07 26.72 22.03 43.09 -0.32 -0.41 1.44 TASSER 44
45 pro−sp3−TASSER 26.72 21.74 27.74 0.23 0.12 -0.07 46.55 40.61 45.98 2.11 2.23 1.82 pro−sp3−TASSER 45
46 JIVE08 26.44 25.29 27.16 0.18 0.78 -0.15 26.44 25.29 27.16 -0.36 0.05 -0.63 JIVE08 46
47 BioSerf 26.44 20.50 32.24 0.18 -0.11 0.55 27.87 24.81 37.81 -0.18 -0.02 0.75 BioSerf 47
48 POEM 26.44 19.92 29.58 0.18 -0.22 0.18 28.74 24.33 34.26 -0.07 -0.09 0.29 POEM 48
49 PRI−Yang−KiharA 25.86 22.41 30.18 0.09 0.24 0.27 25.86 22.41 30.18 -0.43 -0.36 -0.24 PRI−Yang−KiharA 49
50 DBAKER 25.57 21.93 30.11 0.05 0.15 0.26 25.57 24.14 36.73 -0.46 -0.11 0.61 DBAKER 50
51 Poing 25.57 20.21 32.45 0.05 -0.16 0.58 25.57 20.21 32.45 -0.46 -0.67 0.06 Poing 51
52 Ozkan−Shell 24.71 20.31 30.27 -0.09 -0.14 0.28 37.07 32.28 39.23 0.95 1.04 0.94 Ozkan−Shell 52
53 SHORTLE 24.71 20.11 24.65 -0.09 -0.18 -0.50 27.87 24.62 25.66 -0.18 -0.05 -0.83 SHORTLE 53
54 SAM−T08−server 24.71 19.73 28.53 -0.09 -0.25 0.04 24.71 20.21 28.53 -0.57 -0.67 -0.45 SAM−T08−server 54
55 SAM−T08−human 24.43 19.44 26.55 -0.13 -0.30 -0.24 39.37 33.24 41.75 1.23 1.18 1.27 SAM−T08−human 55
56 AMU−Biology 23.85 21.36 27.37 -0.22 0.05 -0.12 35.34 32.85 34.25 0.74 1.13 0.29 AMU−Biology 56
57 fais@hgc 23.85 21.26 28.31 -0.22 0.03 0.01 31.03 21.26 33.32 0.21 -0.52 0.17 fais@hgc 57
58 LEE 23.85 19.64 29.93 -0.22 -0.27 0.23 27.59 22.80 31.80 -0.22 -0.30 -0.03 LEE 58
59 Hao_Kihara 23.56 18.77 24.82 -0.26 -0.43 -0.48 38.51 32.57 35.61 1.12 1.09 0.47 Hao_Kihara 59
60 Scheraga 23.28 18.49 23.92 -0.31 -0.48 -0.60 23.85 20.40 28.78 -0.67 -0.65 -0.42 Scheraga 60
61 SMEG−CCP 23.28 17.62 35.02 -0.31 -0.64 0.94 23.28 17.62 35.02 -0.74 -1.04 0.39 SMEG−CCP 61
62 POISE 22.99 18.97 21.38 -0.35 -0.39 -0.95 23.28 19.06 26.17 -0.74 -0.84 -0.76 POISE 62
63 Wolynes 22.70 21.17 23.19 -0.40 0.01 -0.70 23.85 21.17 27.98 -0.67 -0.54 -0.53 Wolynes 63
64 taylor 22.70 18.97 25.94 -0.40 -0.39 -0.32 22.70 18.97 25.94 -0.82 -0.85 -0.79 taylor 64
65 Sternberg 22.41 20.11 24.86 -0.44 -0.18 -0.47 22.41 20.11 27.86 -0.85 -0.69 -0.54 Sternberg 65
66 ProteinShop 22.13 17.72 27.60 -0.49 -0.62 -0.09 30.46 26.63 30.57 0.14 0.24 -0.19 ProteinShop 66
67 Phyre_de_novo 21.84 19.73 30.10 -0.53 -0.25 0.25 21.84 19.73 30.10 -0.92 -0.74 -0.25 Phyre_de_novo 67
68 FAMSD 21.84 18.01 23.27 -0.53 -0.57 -0.69 26.44 22.03 29.31 -0.36 -0.41 -0.35 FAMSD 68
69 mariner1 21.55 19.54 22.49 -0.58 -0.29 -0.80 50.86 44.73 46.74 2.64 2.82 1.92 mariner1 69
70 MeilerLabRene 21.55 18.30 21.81 -0.58 -0.52 -0.89 21.84 18.49 24.87 -0.92 -0.92 -0.93 MeilerLabRene 70
71 ACOMPMOD 21.55 18.10 20.89 -0.58 -0.55 -1.02 22.99 18.10 20.89 -0.78 -0.97 -1.45 ACOMPMOD 71
72 circle 21.55 16.38 23.83 -0.58 -0.87 -0.61 26.44 22.03 29.31 -0.36 -0.41 -0.35 circle 72
73 Zico 21.26 19.64 26.80 -0.62 -0.27 -0.20 48.56 42.15 46.87 2.36 2.45 1.93 Zico 73
74 HHpred2 21.26 16.86 21.39 -0.62 -0.78 -0.95 21.26 16.86 21.39 -0.99 -1.15 -1.38 HHpred2 74
75 TJ_Jiang 20.98 19.83 22.50 -0.67 -0.23 -0.80 21.84 20.79 28.29 -0.92 -0.59 -0.48 TJ_Jiang 75
76 Bilab−UT 20.98 17.72 32.25 -0.67 -0.62 0.55 27.01 22.80 33.35 -0.29 -0.30 0.17 Bilab−UT 76
77 fleil 20.98 17.53 21.22 -0.67 -0.66 -0.98 22.41 18.97 21.44 -0.85 -0.85 -1.38 fleil 77
78 Handl−Lovell 20.69 18.39 25.21 -0.71 -0.50 -0.42 23.56 20.50 28.75 -0.71 -0.63 -0.42 Handl−Lovell 78
79 FEIG 20.69 17.05 23.41 -0.71 -0.75 -0.67 24.43 21.74 24.12 -0.60 -0.46 -1.03 FEIG 79
80 FLOUDAS 20.69 16.95 23.80 -0.71 -0.76 -0.62 24.43 22.22 30.07 -0.60 -0.39 -0.25 FLOUDAS 80
81 CpHModels 20.69 16.86 21.46 -0.71 -0.78 -0.94 20.69 16.86 21.46 -1.06 -1.15 -1.37 CpHModels 81
82 Distill 20.69 14.94 25.91 -0.71 -1.14 -0.33 22.41 18.20 28.53 -0.85 -0.96 -0.45 Distill 82
83 SAINT1 20.40 18.87 27.10 -0.76 -0.41 -0.16 20.40 18.87 27.10 -1.10 -0.86 -0.64 SAINT1 83
84 FFASsuboptimal 20.40 17.72 20.99 -0.76 -0.62 -1.01 21.84 19.73 21.66 -0.92 -0.74 -1.35 FFASsuboptimal 84
85 A−TASSER 20.40 17.72 27.21 -0.76 -0.62 -0.15 43.68 35.63 43.09 1.76 1.52 1.44 A−TASSER 85
86 igor 20.40 17.15 28.14 -0.76 -0.73 -0.02 20.40 17.15 28.14 -1.10 -1.11 -0.50 igor 86
87 POEMQA 20.40 16.76 23.45 -0.76 -0.80 -0.67 30.46 26.05 34.26 0.14 0.16 0.29 POEMQA 87
88 StruPPi 20.40 16.09 23.53 -0.76 -0.92 -0.66 20.40 16.09 23.53 -1.10 -1.26 -1.10 StruPPi 88
89 MUFOLD−Server 20.40 15.33 26.04 -0.76 -1.06 -0.31 20.69 16.28 26.05 -1.06 -1.23 -0.78 MUFOLD−Server 89
90 EB_AMU_Physics 20.40 15.04 23.31 -0.76 -1.12 -0.69 20.40 17.91 23.31 -1.10 -1.00 -1.13 EB_AMU_Physics 90
91 HHpred5 20.11 18.01 21.48 -0.80 -0.57 -0.94 20.11 18.01 21.48 -1.13 -0.99 -1.37 HHpred5 91
92 mahmood−torda−server 20.11 16.09 18.19 -0.80 -0.92 -1.40 20.11 17.15 19.32 -1.13 -1.11 -1.65 mahmood−torda−server 92
93 3D−JIGSAW_V3 20.11 14.75 20.10 -0.80 -1.17 -1.13 20.69 16.95 20.43 -1.06 -1.14 -1.51 3D−JIGSAW_V3 93
94 3D−JIGSAW_AEP 19.83 17.05 19.96 -0.84 -0.75 -1.15 19.83 17.15 19.99 -1.17 -1.11 -1.57 3D−JIGSAW_AEP 94
95 DistillSN 19.83 16.86 23.99 -0.84 -0.78 -0.59 22.41 18.97 29.93 -0.85 -0.85 -0.27 DistillSN 95
96 HHpred4 19.83 14.46 22.60 -0.84 -1.22 -0.78 19.83 14.46 22.60 -1.17 -1.49 -1.23 HHpred4 96
97 RANDOM 19.38 15.93 19.38 -0.91 -0.95 -1.23 19.38 15.93 19.38 -1.22 -1.28 -1.64 RANDOM 97
98 3Dpro 19.25 17.53 25.54 -0.93 -0.66 -0.38 21.55 19.44 25.54 -0.96 -0.78 -0.84 3Dpro 98
99 3DShot2 19.25 16.19 21.76 -0.93 -0.91 -0.90 19.25 16.19 21.76 -1.24 -1.24 -1.34 3DShot2 99
100 COMA 18.97 16.57 19.55 -0.98 -0.83 -1.21 27.59 25.86 21.47 -0.22 0.13 -1.37 COMA 100
101 keasar−server 18.97 16.09 18.24 -0.98 -0.92 -1.39 18.97 16.09 19.29 -1.27 -1.26 -1.66 keasar−server 101
102 forecast 18.68 17.24 23.23 -1.02 -0.71 -0.70 20.98 17.53 24.19 -1.03 -1.05 -1.02 forecast 102
103 FUGUE_KM 18.68 15.42 13.67 -1.02 -1.05 -2.02 22.70 20.02 21.78 -0.82 -0.70 -1.33 FUGUE_KM 103
104 xianmingpan 18.39 15.71 22.92 -1.07 -0.99 -0.74 18.39 15.71 22.92 -1.34 -1.31 -1.18 xianmingpan 104
105 DelCLab 18.39 14.56 20.01 -1.07 -1.21 -1.14 19.83 18.30 20.88 -1.17 -0.94 -1.45 DelCLab 105
106 nFOLD3 18.39 14.18 21.71 -1.07 -1.28 -0.91 48.85 42.91 46.89 2.39 2.56 1.94 nFOLD3 106
107 SAM−T06−server 18.10 15.61 21.58 -1.11 -1.01 -0.93 20.40 19.83 21.58 -1.10 -0.73 -1.36 SAM−T06−server 107
108 huber−torda−server 18.10 15.23 14.86 -1.11 -1.08 -1.86 21.26 18.58 19.38 -0.99 -0.90 -1.64 huber−torda−server 108
109 keasar 18.10 15.04 17.10 -1.11 -1.12 -1.55 40.80 36.40 41.30 1.41 1.63 1.21 keasar 109
110 LevittGroup 18.10 14.08 17.02 -1.11 -1.29 -1.56 31.61 28.54 35.18 0.28 0.51 0.41 LevittGroup 110
111 mGenTHREADER 18.10 13.41 18.83 -1.11 -1.42 -1.31 18.10 13.41 18.83 -1.38 -1.64 -1.72 mGenTHREADER 111
112 Jiang_Zhu 17.53 15.42 21.90 -1.20 -1.05 -0.88 29.02 24.23 32.99 -0.04 -0.10 0.13 Jiang_Zhu 112
113 LOOPP_Server 17.53 12.74 20.13 -1.20 -1.54 -1.13 45.40 39.66 44.56 1.97 2.10 1.63 LOOPP_Server 113
114 Frankenstein 17.53 12.36 18.00 -1.20 -1.61 -1.42 19.25 15.80 25.57 -1.24 -1.30 -0.84 Frankenstein 114
115 SAM−T02−server 17.24 16.09 15.30 -1.25 -0.92 -1.80 20.40 19.83 15.30 -1.10 -0.73 -2.18 SAM−T02−server 115
116 IBT_LT 17.24 13.98 17.05 -1.25 -1.31 -1.55 17.24 13.98 17.05 -1.49 -1.56 -1.95 IBT_LT 116
117 panther_server 16.95 15.80 10.62 -1.29 -0.98 -2.44 17.24 15.80 12.18 -1.49 -1.30 -2.58 panther_server 117
118 Phragment 16.95 15.52 21.39 -1.29 -1.03 -0.95 20.69 19.83 25.47 -1.06 -0.73 -0.85 Phragment 118
119 COMA−M 16.95 15.04 18.13 -1.29 -1.12 -1.40 18.97 16.57 19.55 -1.27 -1.19 -1.62 COMA−M 119
120 SAMUDRALA 16.67 15.90 20.72 -1.33 -0.96 -1.05 17.24 15.90 20.72 -1.49 -1.29 -1.47 SAMUDRALA 120
121 schenk−torda−server 16.67 15.42 19.00 -1.33 -1.05 -1.28 18.10 15.71 22.23 -1.38 -1.31 -1.27 schenk−torda−server 121
122 OLGAFS 16.67 15.13 10.01 -1.33 -1.10 -2.53 16.67 15.52 10.01 -1.56 -1.34 -2.86 OLGAFS 122
123 Pcons_local 16.67 14.65 14.92 -1.33 -1.19 -1.85 16.67 14.65 14.92 -1.56 -1.46 -2.23 Pcons_local 123
124 Pcons_dot_net 16.67 14.65 14.92 -1.33 -1.19 -1.85 40.23 32.95 39.65 1.34 1.14 0.99 Pcons_dot_net 124
125 Pcons_multi 16.67 14.18 16.96 -1.33 -1.28 -1.57 18.97 16.86 21.78 -1.27 -1.15 -1.33 Pcons_multi 125
126 FOLDpro 16.38 14.85 17.38 -1.38 -1.15 -1.51 21.84 20.69 27.59 -0.92 -0.60 -0.58 FOLDpro 126
127 pipe_int 16.38 14.27 17.66 -1.38 -1.26 -1.47 16.38 14.27 17.66 -1.59 -1.52 -1.87 pipe_int 127
128 FFASstandard 16.38 13.89 14.24 -1.38 -1.33 -1.94 16.38 13.89 14.44 -1.59 -1.57 -2.29 FFASstandard 128
129 FFASflextemplate 16.38 13.89 14.24 -1.38 -1.33 -1.94 16.38 13.89 14.44 -1.59 -1.57 -2.29 FFASflextemplate 129
130 TWPPLAB 13.79 13.03 16.49 -1.78 -1.49 -1.63 13.79 13.03 16.49 -1.91 -1.69 -2.02 TWPPLAB 130
131 Pushchino 11.49 8.62 5.38 -2.14 -2.30 -3.17 11.49 8.62 5.38 -2.19 -2.32 -3.47 Pushchino 131
132 rehtnap 3.45 3.45 0.00 -3.39 -3.26 -3.91 3.45 3.45 0.00 -3.18 -3.06 -4.17 rehtnap 132
133 Abagyan                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 Abagyan 133
134 BHAGEERATH                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 BHAGEERATH 134
135 CBSU                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 CBSU 135
136 FEIG_REFINE                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 FEIG_REFINE 136
137 Fiser−M4T                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 Fiser−M4T 137
138 HCA                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 HCA 138
139 LEE−SERVER                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 LEE−SERVER 139
140 Linnolt−UH−CMB                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 Linnolt−UH−CMB 140
141 NIM2                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 NIM2 141
142 Nano_team                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 Nano_team 142
143 NirBenTal                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 NirBenTal 143
144 PHAISTOS                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 PHAISTOS 144
145 PZ−UAM                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 PZ−UAM 145
146 ProtAnG                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 ProtAnG 146
147 RBO−Proteus                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 RBO−Proteus 147
148 RPFM                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 RPFM 148
149 ShakAbInitio                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 ShakAbInitio 149
150 TsaiLab                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 TsaiLab 150
151 UCDavisGenome                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 UCDavisGenome 151
152 Wolfson−FOBIA                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 Wolfson−FOBIA 152
153 YASARA                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 YASARA 153
154 YASARARefine                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 YASARARefine 154
155 Zhou−SPARKS                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 Zhou−SPARKS 155
156 dill_ucsf                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 dill_ucsf 156
157 dill_ucsf_extended                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 dill_ucsf_extended 157
158 jacobson                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 jacobson 158
159 mti                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 mti 159
160 mumssp                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 mumssp 160
161 psiphifoldings                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 psiphifoldings 161
162 ricardo                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 ricardo 162
163 rivilo                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 rivilo 163
164 sessions                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 sessions 164
165 test_http_server_01                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 test_http_server_01 165
166 tripos_08                   -0.91 -0.95 -1.23                   -1.22 -1.28 -1.64 tripos_08 166