T0492

NMR Targets
437 460 462 464
466 467 468 469
471 472 473 474
475 476 480 482
484 492 498 499
500

T0492

protein FeoA from Clostridium thermocellum

Target type: Human/Server

Target sequence:

>T0492 CmR17, Clostridium thermocellum, 73 residues
MFSLRDAKCGQTVKVVKLHGTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGYELSLRKSAAEMIEVE

Structure:
Method: NMR
Determined by: NESG
PDB ID: 2k5l

jumping through 492 NMR models
Jumping through 20 NMR models of 2k5l

all 20 492 NMR models
All 20 superimposed NMR models of 2k5l

PyMOL of 2k5l

Domains:  PyMOL of domains

Single domain protein with poorly structured C-terminal His-tag, which was not in the target sequence and was removed for evaluation of predictions anyway.

Structure classification:

SH3-like barrel fold, clearly homologous to C-terminal domain of transcriptional repressors superfamily.

2k5l_1:1-74 cartoon
Cartoon diagram of 492: 2k5l model 1 residues 1-74

CASP category:

Comparative modeling:medium.

Closest templates:

Ferrous iron transport proteins A (FeoA): e.g. 2gcx, 1fx7.

T0492   MFSLRDAKCGQTVKVVKLH----GTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGY-ELSLRKSAAEMIEVE----

2gcx_A  ----MQFTPDSAWKITGFSRD--ISPAYRQKLLSLGMLPGSSFHVVRVAPLGDPVHIETRRV-SLVLRKKDLALIELEAVAQ
1fx7_A  -LTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTP--GGGVTIVIPGHENVTLPHEMAHAVKVEKV--
Consea  .....phsssssh.lp.hp.p......h.p+L.shGhlPs.phpl.ph.P.Gsslhh.h....slhL.+c.h.hlclE.V..
Conses     hhh     eeeeeeee      hhhhhhhhh       eeeeeee      eeeee  e eee  hhhh eeeeee  

Target sequence - PDB file inconsistencies:

NMR models contain the C-terminal His-tag residues 74-LEHHHHHH-81, not present in the target sequence. This regions was removed from NMR models due to disorder anyway.

T0492    2k5l.pdb    T0492.pdb    PyMOL    PyMOL of domains    

T0492    1 MFSLRDAKCGQTVKVVKLHGTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGYELSLRKSAAEMIEVE-------- 73
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~
2k5lA    1 MFSLRDAKCGQTVKVVKLHGTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGYELSLRKSAAEMIEVELEHHHHHH 81

Residue change log: remove 74-LEHHHHHH-81 as it is not present in target sequence;

Single domain protein: target 1-73 ; pdb 1-73

Sequence classification:

FeoA domain family PF04023 in Pfam.

Comments:

This protein is a close homolog of T0462 on each its duplicates.

T0492   MFSLRDAKCGQTVKVVKLH----GTGALKRRIMDMGITRGCEIYIRKVAPLGDPIQINVRGY-ELSLRKSAAEMIEVE-------------
T0462_1 -MKLSRLVPGVPARIKRLE----VSGELHEKLVGMGFVPGEEIEIVQVAPLGDPIVCKIGNR-NITLRKREADLIEVEVVGGE--------
T0462_2 --LPLILADDGTYEITKLN----GGRRFLFRMKNLGIESGKKIQVSGR-----GRRYYIEGR-EIDLGYGEATKIWVRRVSDAGEESHPQK

Server predictions:

T0492:pdb 1-73:seq 1-73:CM_medium;   alignment

distribution of first scores
First models for T0492: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0492 T0492 T0492 T0492
First score First Z-score Best score Best Z-score
1 DBAKER 93.49 92.58 89.46 3.53 3.72 2.52 93.49 92.58 91.49 3.14 3.27 2.55 DBAKER 1
2 Ozkan−Shell 90.07 76.37 85.01 2.94 1.44 1.93 90.07 77.40 85.01 2.56 1.14 1.65 Ozkan−Shell 2
3 A−TASSER 87.67 84.93 81.97 2.53 2.64 1.53 88.70 85.96 81.97 2.32 2.34 1.23 A−TASSER 3
4 3DShotMQ 86.30 84.47 81.63 2.29 2.58 1.48 86.30 84.47 81.63 1.92 2.13 1.18 3DShotMQ 4
5 Zico 84.93 79.91 82.73 2.06 1.94 1.63 84.93 80.71 82.73 1.69 1.60 1.33 Zico 5
6 ZicoFullSTPFullData 84.93 79.91 82.73 2.06 1.94 1.63 84.93 80.71 82.73 1.69 1.60 1.33 ZicoFullSTPFullData 6
7 3DShot1 84.59 81.85 79.01 2.00 2.21 1.13 84.59 81.85 79.01 1.63 1.76 0.82 3DShot1 7
8 LEE 84.25 78.77 83.52 1.94 1.78 1.73 85.27 82.99 84.75 1.74 1.92 1.61 LEE 8
9 Jiang_Zhu 83.90 81.16 79.27 1.88 2.12 1.17 83.90 81.16 79.27 1.51 1.67 0.86 Jiang_Zhu 9
10 McGuffin 82.88 79.68 81.96 1.71 1.91 1.53 82.88 81.16 82.23 1.34 1.67 1.27 McGuffin 10
11 Elofsson 81.85 78.20 80.08 1.53 1.70 1.27 81.85 79.22 80.62 1.16 1.39 1.04 Elofsson 11
12 Sternberg 81.51 78.77 80.62 1.47 1.78 1.35 81.51 78.77 80.62 1.10 1.33 1.04 Sternberg 12
13 Phyre_de_novo 81.51 78.77 80.62 1.47 1.78 1.35 81.51 78.77 80.62 1.10 1.33 1.04 Phyre_de_novo 13
14 Pcons_multi 81.51 77.85 79.08 1.47 1.65 1.14 81.51 77.85 80.13 1.10 1.20 0.97 Pcons_multi 14
15 MULTICOM 81.51 76.94 85.12 1.47 1.52 1.95 82.19 78.31 85.58 1.22 1.26 1.73 MULTICOM 15
16 Chicken_George 81.16 75.00 78.81 1.41 1.25 1.11 81.16 75.00 78.81 1.05 0.80 0.79 Chicken_George 16
17 KudlatyPredHuman 80.48 74.54 80.36 1.29 1.19 1.31 81.51 77.40 82.11 1.10 1.14 1.25 KudlatyPredHuman 17
18 ZicoFullSTP 79.11 73.63 79.37 1.06 1.06 1.18 84.93 80.71 82.73 1.69 1.60 1.33 ZicoFullSTP 18
19 SAM−T08−human 78.08 68.49 79.57 0.88 0.34 1.21 80.82 75.34 82.95 0.99 0.85 1.37 SAM−T08−human 19
20 fams−ace2 77.74 73.40 80.54 0.82 1.03 1.34 77.74 73.40 80.54 0.46 0.57 1.03 fams−ace2 20
21 Jones−UCL 77.40 71.92 74.61 0.76 0.82 0.55 77.40 71.92 74.61 0.41 0.37 0.21 Jones−UCL 21
22 SAM−T06−server 77.40 68.04 80.74 0.76 0.28 1.36 77.40 68.27 80.74 0.41 -0.15 1.06 SAM−T06−server 22
23 GS−KudlatyPred 76.71 72.15 78.45 0.64 0.85 1.06 79.11 72.72 79.90 0.70 0.48 0.94 GS−KudlatyPred 23
24 GeneSilico 76.71 72.15 78.46 0.64 0.85 1.06 79.11 72.72 79.90 0.70 0.48 0.94 GeneSilico 24
25 nFOLD3 76.71 68.27 75.06 0.64 0.31 0.61 77.06 68.27 75.06 0.35 -0.15 0.27 nFOLD3 25
26 IBT_LT 76.71 62.78 78.63 0.64 -0.46 1.08 76.71 62.78 78.63 0.29 -0.92 0.77 IBT_LT 26
27 keasar 76.71 60.05 80.55 0.64 -0.84 1.34 78.77 68.27 80.55 0.64 -0.15 1.03 keasar 27
28 SAM−T08−server 76.37 61.76 74.55 0.59 -0.60 0.54 76.37 65.07 74.55 0.23 -0.60 0.20 SAM−T08−server 28
29 Kolinski 76.03 71.69 70.25 0.53 0.79 -0.04 76.03 71.69 70.25 0.17 0.33 -0.39 Kolinski 29
30 FALCON 76.03 67.58 73.70 0.53 0.21 0.42 76.03 67.58 76.45 0.17 -0.25 0.47 FALCON 30
31 mufold 76.03 60.05 74.47 0.53 -0.84 0.53 76.37 69.98 78.21 0.23 0.09 0.71 mufold 31
32 mariner1 75.69 63.58 76.00 0.47 -0.35 0.73 76.37 70.43 78.46 0.23 0.16 0.74 mariner1 32
33 JIVE08 75.34 74.43 70.97 0.41 1.17 0.06 75.34 74.43 70.97 0.06 0.72 -0.29 JIVE08 33
34 SMEG−CCP 75.34 68.49 64.92 0.41 0.34 -0.75 75.34 68.49 64.92 0.06 -0.12 -1.13 SMEG−CCP 34
35 Frankenstein 75.34 63.47 77.46 0.41 -0.37 0.93 75.69 64.04 77.46 0.12 -0.74 0.60 Frankenstein 35
36 Bilab−UT 75.00 67.69 76.57 0.35 0.23 0.81 75.69 67.69 78.65 0.12 -0.23 0.77 Bilab−UT 36
37 fais@hgc 75.00 67.01 76.03 0.35 0.13 0.74 77.06 71.12 76.91 0.35 0.25 0.53 fais@hgc 37
38 FEIG 74.31 64.50 73.67 0.23 -0.22 0.42 77.06 70.09 75.58 0.35 0.11 0.34 FEIG 38
39 Bates_BMM 74.31 61.30 75.16 0.23 -0.67 0.62 74.31 64.61 75.16 -0.12 -0.66 0.29 Bates_BMM 39
40 COMA−M 73.97 71.00 71.10 0.17 0.69 0.08 73.97 71.00 71.10 -0.17 0.24 -0.28 COMA−M 40
41 BAKER−ROBETTA 73.97 70.55 73.73 0.17 0.63 0.43 75.69 71.12 74.68 0.12 0.25 0.22 BAKER−ROBETTA 41
42 Zhang 73.97 68.04 73.07 0.17 0.28 0.34 85.96 74.54 79.68 1.86 0.73 0.91 Zhang 42
43 METATASSER 73.63 68.15 72.34 0.11 0.29 0.24 83.22 81.85 81.03 1.39 1.76 1.10 METATASSER 43
44 ABIpro 73.63 59.70 73.89 0.11 -0.89 0.45 74.66 62.44 78.41 -0.06 -0.97 0.74 ABIpro 44
45 FrankensteinLong 73.29 60.50 75.11 0.06 -0.78 0.61 76.03 64.38 75.11 0.17 -0.70 0.28 FrankensteinLong 45
46 circle 73.29 60.05 74.70 0.06 -0.84 0.56 75.69 68.49 76.87 0.12 -0.12 0.52 circle 46
47 Softberry 72.94 70.43 69.68 -0.00 0.61 -0.11 72.94 70.43 69.68 -0.35 0.16 -0.47 Softberry 47
48 MUSTER 72.94 68.84 69.95 -0.00 0.39 -0.08 72.94 68.84 74.49 -0.35 -0.07 0.19 MUSTER 48
49 3DShot2 72.94 68.38 63.97 -0.00 0.32 -0.87 72.94 68.38 63.97 -0.35 -0.13 -1.26 3DShot2 49
50 TJ_Jiang 72.94 65.87 71.83 -0.00 -0.03 0.18 75.00 68.15 72.35 -0.00 -0.17 -0.10 TJ_Jiang 50
51 AMU−Biology 72.94 65.64 70.17 -0.00 -0.06 -0.05 73.29 70.32 71.47 -0.29 0.14 -0.22 AMU−Biology 51
52 LOOPP_Server 72.94 58.79 76.09 -0.00 -1.02 0.74 72.94 69.75 76.09 -0.35 0.06 0.42 LOOPP_Server 52
53 Zhang−Server 72.60 67.58 71.84 -0.06 0.21 0.18 79.80 71.92 75.29 0.81 0.37 0.30 Zhang−Server 53
54 ACOMPMOD 72.60 66.89 68.30 -0.06 0.11 -0.29 72.60 66.89 68.30 -0.41 -0.34 -0.66 ACOMPMOD 54
55 MUProt 72.60 63.24 68.46 -0.06 -0.40 -0.27 81.85 80.48 81.95 1.16 1.57 1.23 MUProt 55
56 FFASstandard 72.26 69.98 67.08 -0.12 0.55 -0.46 72.26 69.98 69.51 -0.47 0.09 -0.50 FFASstandard 56
57 GS−MetaServer2 72.26 68.61 68.05 -0.12 0.36 -0.33 72.26 68.61 69.31 -0.47 -0.10 -0.52 GS−MetaServer2 57
58 GeneSilicoMetaServer 72.26 68.61 68.05 -0.12 0.36 -0.33 73.29 68.61 69.20 -0.29 -0.10 -0.54 GeneSilicoMetaServer 58
59 FAMS−multi 72.26 64.04 70.68 -0.12 -0.29 0.02 72.26 68.84 70.68 -0.47 -0.07 -0.33 FAMS−multi 59
60 forecast 72.26 57.42 69.95 -0.12 -1.21 -0.08 73.29 62.78 71.88 -0.29 -0.92 -0.17 forecast 60
61 MULTICOM−REFINE 71.92 63.01 69.01 -0.18 -0.43 -0.20 82.53 81.16 82.23 1.28 1.67 1.27 MULTICOM−REFINE 61
62 COMA 71.58 68.38 68.74 -0.24 0.32 -0.24 71.58 68.38 71.10 -0.58 -0.13 -0.28 COMA 62
63 Pcons_local 71.58 67.92 67.03 -0.24 0.26 -0.46 71.92 69.06 67.58 -0.52 -0.04 -0.76 Pcons_local 63
64 Pcons_dot_net 71.58 67.92 67.03 -0.24 0.26 -0.46 75.00 68.84 76.84 -0.00 -0.07 0.52 Pcons_dot_net 64
65 TASSER 71.58 65.64 70.62 -0.24 -0.06 0.01 84.93 80.82 84.09 1.69 1.62 1.52 TASSER 65
66 pipe_int 71.58 63.81 70.23 -0.24 -0.32 -0.04 71.58 63.81 70.23 -0.58 -0.78 -0.40 pipe_int 66
67 MULTICOM−CLUSTER 71.58 59.48 71.61 -0.24 -0.92 0.15 77.74 67.92 78.70 0.46 -0.20 0.78 MULTICOM−CLUSTER 67
68 FAMSD 71.23 68.49 69.55 -0.30 0.34 -0.13 71.92 68.49 69.55 -0.52 -0.12 -0.49 FAMSD 68
69 fleil 71.23 67.58 68.73 -0.30 0.21 -0.24 73.63 70.89 69.70 -0.23 0.22 -0.47 fleil 69
70 Pushchino 71.23 66.44 67.95 -0.30 0.05 -0.34 71.23 66.44 67.95 -0.64 -0.41 -0.71 Pushchino 70
71 huber−torda−server 71.23 65.98 67.94 -0.30 -0.01 -0.34 71.58 65.98 71.09 -0.58 -0.47 -0.28 huber−torda−server 71
72 PS2−server 71.23 65.75 68.83 -0.30 -0.05 -0.22 73.29 71.23 70.76 -0.29 0.27 -0.32 PS2−server 72
73 PS2−manual 71.23 65.75 68.84 -0.30 -0.05 -0.22 73.29 71.23 70.77 -0.29 0.27 -0.32 PS2−manual 73
74 MUFOLD−Server 71.23 64.38 68.93 -0.30 -0.24 -0.21 71.23 65.53 69.19 -0.64 -0.53 -0.54 MUFOLD−Server 74
75 mGenTHREADER 71.23 63.01 68.17 -0.30 -0.43 -0.31 71.23 63.01 68.17 -0.64 -0.89 -0.68 mGenTHREADER 75
76 Abagyan 71.23 61.42 66.03 -0.30 -0.65 -0.60 71.23 62.22 66.03 -0.64 -1.00 -0.98 Abagyan 76
77 FFASflextemplate 70.89 66.32 66.25 -0.36 0.03 -0.57 71.23 67.58 66.52 -0.64 -0.25 -0.91 FFASflextemplate 77
78 RAPTOR 70.89 64.50 69.07 -0.36 -0.22 -0.19 73.97 71.23 69.53 -0.17 0.27 -0.49 RAPTOR 78
79 fais−server 70.89 64.27 69.76 -0.36 -0.25 -0.10 72.60 69.86 69.76 -0.41 0.08 -0.46 fais−server 79
80 HHpred4 70.89 64.27 69.76 -0.36 -0.25 -0.10 70.89 64.27 69.76 -0.70 -0.71 -0.46 HHpred4 80
81 HHpred2 70.89 64.27 69.76 -0.36 -0.25 -0.10 70.89 64.27 69.76 -0.70 -0.71 -0.46 HHpred2 81
82 Wolfson−FOBIA 70.89 63.36 68.56 -0.36 -0.38 -0.26 70.89 63.36 68.56 -0.70 -0.84 -0.63 Wolfson−FOBIA 82
83 PSI 70.89 63.13 68.70 -0.36 -0.41 -0.24 71.92 63.70 68.70 -0.52 -0.79 -0.61 PSI 83
84 BioSerf 70.55 64.16 68.61 -0.42 -0.27 -0.25 70.55 64.16 68.61 -0.76 -0.73 -0.62 BioSerf 84
85 EB_AMU_Physics 70.55 64.16 69.52 -0.42 -0.27 -0.13 70.55 64.16 69.52 -0.76 -0.73 -0.49 EB_AMU_Physics 85
86 xianmingpan 70.55 62.10 63.52 -0.42 -0.56 -0.93 70.55 62.10 63.52 -0.76 -1.02 -1.33 xianmingpan 86
87 MULTICOM−CMFR 70.20 68.38 66.79 -0.48 0.32 -0.50 81.85 80.48 81.95 1.16 1.57 1.23 MULTICOM−CMFR 87
88 FUGUE_KM 70.20 67.47 65.66 -0.48 0.20 -0.65 71.23 67.47 67.94 -0.64 -0.26 -0.71 FUGUE_KM 88
89 Hao_Kihara 70.20 63.81 68.05 -0.48 -0.32 -0.33 71.58 69.75 68.68 -0.58 0.06 -0.61 Hao_Kihara 89
90 pro−sp3−TASSER 70.20 61.99 69.11 -0.48 -0.57 -0.19 84.59 81.85 82.64 1.63 1.76 1.32 pro−sp3−TASSER 90
91 MULTICOM−RANK 69.86 67.58 67.32 -0.53 0.21 -0.43 82.88 79.68 81.96 1.34 1.46 1.23 MULTICOM−RANK 91
92 FFASsuboptimal 69.86 64.61 67.64 -0.53 -0.21 -0.38 71.58 68.38 67.64 -0.58 -0.13 -0.75 FFASsuboptimal 92
93 Poing 69.86 64.16 68.18 -0.53 -0.27 -0.31 71.23 68.49 68.81 -0.64 -0.12 -0.59 Poing 93
94 Phyre2 69.86 64.16 68.29 -0.53 -0.27 -0.30 71.23 68.49 68.89 -0.64 -0.12 -0.58 Phyre2 94
95 Phragment 69.86 64.16 68.28 -0.53 -0.27 -0.30 71.23 68.49 68.92 -0.64 -0.12 -0.58 Phragment 95
96 HHpred5 69.86 60.96 68.56 -0.53 -0.72 -0.26 69.86 60.96 68.56 -0.87 -1.18 -0.63 HHpred5 96
97 SAM−T02−server 69.18 66.89 64.98 -0.65 0.11 -0.74 69.18 66.89 64.98 -0.99 -0.34 -1.12 SAM−T02−server 97
98 panther_server 69.18 62.10 65.78 -0.65 -0.56 -0.63 70.55 65.75 69.48 -0.76 -0.50 -0.50 panther_server 98
99 FALCON_CONSENSUS 69.18 60.96 61.57 -0.65 -0.72 -1.19 76.03 67.58 73.70 0.17 -0.25 0.08 FALCON_CONSENSUS 99
100 MidwayFolding 69.18 57.99 62.76 -0.65 -1.13 -1.03 73.29 69.64 69.36 -0.29 0.04 -0.52 MidwayFolding 100
101 rehtnap 68.49 64.16 62.45 -0.77 -0.27 -1.07 68.49 64.16 62.45 -1.10 -0.73 -1.47 rehtnap 101
102 POEM 67.81 56.39 56.76 -0.89 -1.36 -1.83 67.81 57.99 79.61 -1.22 -1.60 0.90 POEM 102
103 tripos_08 67.81 55.71 56.84 -0.89 -1.45 -1.82 67.81 55.71 56.84 -1.22 -1.92 -2.25 tripos_08 103
104 LevittGroup 67.81 54.80 58.70 -0.89 -1.58 -1.57 70.89 56.73 62.07 -0.70 -1.77 -1.53 LevittGroup 104
105 SAMUDRALA 67.47 62.44 80.96 -0.95 -0.51 1.39 69.86 64.84 80.96 -0.87 -0.63 1.09 SAMUDRALA 105
106 keasar−server 67.47 60.84 64.23 -0.95 -0.73 -0.84 73.29 69.64 70.17 -0.29 0.04 -0.40 keasar−server 106
107 3D−JIGSAW_AEP 67.12 59.59 65.58 -1.01 -0.91 -0.66 67.12 59.82 66.69 -1.34 -1.34 -0.89 3D−JIGSAW_AEP 107
108 3D−JIGSAW_V3 65.75 59.59 65.70 -1.24 -0.91 -0.64 65.75 59.59 65.89 -1.57 -1.37 -1.00 3D−JIGSAW_V3 108
109 DelCLab 65.75 51.37 54.02 -1.24 -2.06 -2.20 66.44 57.19 55.78 -1.45 -1.71 -2.40 DelCLab 109
110 RBO−Proteus 64.04 56.05 51.49 -1.54 -1.41 -2.53 64.04 60.62 51.49 -1.86 -1.23 -2.99 RBO−Proteus 110
111 PRI−Yang−KiharA 63.36 57.19 52.25 -1.65 -1.25 -2.43 63.36 57.19 52.25 -1.98 -1.71 -2.89 PRI−Yang−KiharA 111
112 3Dpro 63.36 48.52 59.64 -1.65 -2.46 -1.45 73.63 63.24 68.80 -0.23 -0.86 -0.59 3Dpro 112
113 FOLDpro 63.36 48.52 59.64 -1.65 -2.46 -1.45 73.63 63.24 68.80 -0.23 -0.86 -0.59 FOLDpro 113
114 POEMQA 63.01 57.08 51.26 -1.71 -1.26 -2.57 73.63 66.78 79.61 -0.23 -0.36 0.90 POEMQA 114
115 SHORTLE 60.27 47.49 65.64 -2.18 -2.61 -0.65 60.27 47.49 65.64 -2.50 -3.07 -1.03 SHORTLE 115
116 Fiser−M4T 59.93 58.56 42.96 -2.24 -1.05 -3.67 59.93 58.56 42.96 -2.56 -1.52 -4.17 Fiser−M4T 116
117 MUFOLD−MD 59.25 53.08 60.57 -2.36 -1.82 -1.32 64.38 53.08 60.57 -1.80 -2.29 -1.73 MUFOLD−MD 117
118 StruPPi 58.22 53.65 49.13 -2.54 -1.74 -2.85 58.22 53.65 49.13 -2.85 -2.21 -3.32 StruPPi 118
119 mumssp 56.85 54.34 41.94 -2.77 -1.65 -3.81 56.85 54.34 41.94 -3.08 -2.11 -4.31 mumssp 119
120 CpHModels 55.82 52.85 42.26 -2.95 -1.85 -3.76 55.82 52.85 42.26 -3.25 -2.32 -4.27 CpHModels 120
121 FLOUDAS 55.48 44.06 59.22 -3.01 -3.09 -1.50 55.48 44.86 59.22 -3.31 -3.44 -1.92 FLOUDAS 121
122 Distill 55.14 50.34 48.44 -3.07 -2.21 -2.94 59.59 55.02 52.76 -2.62 -2.01 -2.82 Distill 122
123 DistillSN 38.01 31.62 36.92 -6.02 -4.83 -4.48 38.36 34.36 38.33 -6.22 -4.92 -4.81 DistillSN 123
124 Wolynes 35.96 29.80 39.19 -6.37 -5.09 -4.17 35.96 29.80 39.19 -6.63 -5.56 -4.69 Wolynes 124
125 schenk−torda−server 29.11 26.03 28.14 -7.55 -5.62 -5.65 29.45 26.03 28.49 -7.73 -6.09 -6.18 schenk−torda−server 125
126 MeilerLabRene 28.77 21.92 35.96 -7.61 -6.19 -4.60 34.59 29.80 41.46 -6.86 -5.56 -4.38 MeilerLabRene 126
127 RPFM 25.34 21.23 22.72 -8.20 -6.29 -6.37 28.43 26.60 33.49 -7.90 -6.01 -5.48 RPFM 127
128 TWPPLAB 25.34 19.18 19.84 -8.20 -6.58 -6.75 25.34 19.18 19.84 -8.43 -7.06 -7.37 TWPPLAB 128
129 RANDOM 23.22 19.38 23.22 -8.56 -6.55 -6.30 23.22 19.38 23.22 -8.79 -7.03 -6.91 RANDOM 129
130 mahmood−torda−server 21.92 18.15 28.94 -8.78 -6.72 -5.54 27.05 19.29 30.76 -8.14 -7.04 -5.86 mahmood−torda−server 130
131 Linnolt−UH−CMB 19.86 17.12 23.21 -9.14 -6.87 -6.30 19.86 17.12 23.21 -9.36 -7.35 -6.91 Linnolt−UH−CMB 131
132 OLGAFS 17.81 14.38 21.78 -9.49 -7.25 -6.49 64.04 51.26 59.79 -1.86 -2.54 -1.84 OLGAFS 132
133 BHAGEERATH                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 BHAGEERATH 133
134 CBSU                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 CBSU 134
135 FEIG_REFINE                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 FEIG_REFINE 135
136 HCA                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 HCA 136
137 Handl−Lovell                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 Handl−Lovell 137
138 LEE−SERVER                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 LEE−SERVER 138
139 NIM2                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 NIM2 139
140 Nano_team                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 Nano_team 140
141 NirBenTal                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 NirBenTal 141
142 PHAISTOS                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 PHAISTOS 142
143 POISE                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 POISE 143
144 PZ−UAM                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 PZ−UAM 144
145 ProtAnG                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 ProtAnG 145
146 ProteinShop                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 ProteinShop 146
147 SAINT1                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 SAINT1 147
148 Sasaki−Cetin−Sasai                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 Sasaki−Cetin−Sasai 148
149 Scheraga                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 Scheraga 149
150 ShakAbInitio                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 ShakAbInitio 150
151 TsaiLab                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 TsaiLab 151
152 UCDavisGenome                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 UCDavisGenome 152
153 YASARA                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 YASARA 153
154 YASARARefine                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 YASARARefine 154
155 Zhou−SPARKS                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 Zhou−SPARKS 155
156 dill_ucsf                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 dill_ucsf 156
157 dill_ucsf_extended                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 dill_ucsf_extended 157
158 igor                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 igor 158
159 jacobson                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 jacobson 159
160 mti                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 mti 160
161 psiphifoldings                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 psiphifoldings 161
162 ricardo                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 ricardo 162
163 rivilo                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 rivilo 163
164 sessions                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 sessions 164
165 taylor                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 taylor 165
166 test_http_server_01                   -8.56 -6.55 -6.30                   -8.79 -7.03 -6.91 test_http_server_01 166