T0471

NMR Targets
437 460 462 464
466 467 468 469
471 472 473 474
475 476 480 482
484 492 498 499
500

T0471

SAM-methyltransferase MTH_1000 from Methanobacterium thermoautotrophicum

Target type: Human/Server

Target sequence:

>T0471 TR8, Methanothermobacter thermautotrophicus, 133 residues
MWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR

Structure:
Method: NMR
Determined by: NESG
PDB ID: 2k4m

jumping through 471 NMR models
Jumping through 20 NMR models of 2k4m

all 20 471 NMR models
All 20 superimposed NMR models of 2k4m

PyMOL of 2k4m

Domains:  PyMOL of domains

Single domain protein with poorly structured N- and C-termini. Structurally variable regions were removed from NMR models for evaluation of predictions.

Structure classification:

Rossmann-like doubly-wound α/β-sandwich fold SAM-dependent methyltransferase. A shortened, minimal version of SAM-methyltransferase structure. The third (edge) β-strand (green) is very short, as the following it crossover helix (green in the back). The helices between strands 2 and 3 (green) and 5 and 6 (orange) deteriorated into loops. The C-terminal β-hairpin, which is a distinguishing feature of SAM-methyltransferase is well-developed. Thus the last (7th, red) β-strand is parallel to the rest in the β-sheet.

2k4m_1:18-151 cartoon
Cartoon diagram of T0471: 2k4m model 1 residues 18-151 (PDB, not target, numbers)

CASP category:

Comparative modeling: hard. Closest templates detectable by PSI-BLAST, but contain many insertions and are quite different in the details of the structure. Additionally, many servers missed the C-terminal β-hairpin because in closest templates it is separated from the rest of the sequence by a long insertion.

Closest templates:

Many SAM-dependent methyltransferases. One of the closest templates is 3bxo. However, this template contains a very long insertion before the C-terminal β-hairpin.

Target sequence - PDB file inconsistencies:

NMR models contain 20 N-terminal His-tag residues 1-MGSSHHHHHHSSGLVPRGSH-20, not present in the target sequence. Most of this regions was removed from NMR models due to disorder anyway.

T0471    2k4m.pdb    T0471.pdb    PyMOL    PyMOL of domains    

T0471    1 --------------------MWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR 133
           ~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||**
2k4mA    1 MGSSHHHHHHSSGLVPRGSHMWNDLAVYIIRCSGPGTRVVEVGAGRFLYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIYRGAALIYSIRPPAEIHSSLMRVADAVGARLIIKPLTGEDIVTERKMKLVNYGRTYFYEYIAEVRSR 153

Residue change log: remove 1-MGSSHHHHHHSSGLVPRGSH-20 as it is not present in target sequence; remove 152-SR-153 by 3.5Å SD cutoff;

Single domain protein: target 1-131 ; pdb 21-151

Sequence classification:

Uncharacterized protein family UPF0146 in Pfam, which includes several close homologs.

Comments:

Many servers missed the C-terminal β-hairpin due to long insertions in closest templates prior to it. This hairpin is characteristic of SAM-methyltransferases.

Server predictions:

T0471:pdb 21-151:seq 1-131:CM_hard;   alignment

distribution of first scores
First models for T0471: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0471 T0471 T0471 T0471
First score First Z-score Best score Best Z-score
1 TASSER 73.28 66.41 71.63 1.57 1.78 1.61 73.28 66.41 71.63 1.54 1.62 1.56 TASSER 1
2 mufold 73.09 64.31 72.59 1.56 1.62 1.68 73.09 64.31 72.59 1.52 1.44 1.64 mufold 2
3 MULTICOM 71.76 63.10 67.95 1.47 1.53 1.32 72.14 64.50 69.61 1.45 1.46 1.37 MULTICOM 3
4 Zhang 71.18 61.90 73.12 1.43 1.44 1.72 71.37 64.25 73.12 1.39 1.44 1.69 Zhang 4
5 Bates_BMM 70.99 66.41 70.73 1.42 1.78 1.54 71.56 68.26 70.73 1.40 1.77 1.48 Bates_BMM 5
6 fams−ace2 69.85 57.89 69.01 1.34 1.13 1.41 69.85 57.89 69.01 1.26 0.91 1.32 fams−ace2 6
7 Zhang−Server 69.66 61.13 70.38 1.32 1.38 1.51 69.66 61.20 70.42 1.25 1.18 1.45 Zhang−Server 7
8 McGuffin 69.66 61.13 70.38 1.32 1.38 1.51 69.66 61.20 70.42 1.25 1.18 1.45 McGuffin 8
9 Zico 69.66 60.75 70.64 1.32 1.35 1.53 69.66 66.03 70.64 1.25 1.58 1.47 Zico 9
10 ZicoFullSTP 69.66 60.75 70.64 1.32 1.35 1.53 69.66 66.03 70.64 1.25 1.58 1.47 ZicoFullSTP 10
11 ZicoFullSTPFullData 69.66 60.75 70.64 1.32 1.35 1.53 69.66 66.03 70.64 1.25 1.58 1.47 ZicoFullSTPFullData 11
12 KudlatyPredHuman 69.47 60.81 69.59 1.31 1.35 1.45 69.47 60.81 69.59 1.23 1.15 1.37 KudlatyPredHuman 12
13 SAM−T08−human 69.08 61.32 69.27 1.28 1.39 1.43 69.08 61.32 69.36 1.20 1.19 1.35 SAM−T08−human 13
14 DBAKER 69.08 58.52 72.39 1.28 1.18 1.67 72.71 65.33 74.58 1.49 1.53 1.82 DBAKER 14
15 Elofsson 68.89 64.69 68.16 1.27 1.65 1.34 68.89 64.69 68.16 1.19 1.47 1.24 Elofsson 15
16 Ozkan−Shell 68.51 60.24 73.83 1.24 1.31 1.78 68.51 61.51 73.83 1.16 1.21 1.76 Ozkan−Shell 16
17 3DShotMQ 68.51 59.99 66.76 1.24 1.29 1.23 68.51 59.99 66.76 1.16 1.08 1.12 3DShotMQ 17
18 FEIG 68.13 56.04 63.01 1.22 0.99 0.95 68.13 61.58 63.01 1.13 1.21 0.78 FEIG 18
19 Jones−UCL 67.94 60.43 61.00 1.21 1.33 0.79 67.94 60.43 61.00 1.11 1.12 0.59 Jones−UCL 19
20 METATASSER 67.18 60.94 63.53 1.15 1.36 0.99 67.18 60.94 63.53 1.05 1.16 0.82 METATASSER 20
21 ABIpro 67.18 57.00 69.83 1.15 1.07 1.47 68.89 63.93 70.66 1.19 1.41 1.47 ABIpro 21
22 3DShot1 66.98 60.75 58.56 1.14 1.35 0.60 66.98 60.75 58.56 1.03 1.14 0.37 3DShot1 22
23 GeneSilico 66.22 57.82 68.63 1.09 1.13 1.38 66.41 61.32 68.63 0.99 1.19 1.29 GeneSilico 23
24 IBT_LT 65.65 56.74 66.35 1.05 1.05 1.20 65.65 56.74 66.35 0.93 0.81 1.08 IBT_LT 24
25 FAMS−multi 65.46 59.99 62.24 1.03 1.29 0.89 65.46 59.99 62.24 0.91 1.08 0.71 FAMS−multi 25
26 SHORTLE 64.69 53.37 64.59 0.98 0.79 1.07 64.69 53.37 64.59 0.85 0.53 0.92 SHORTLE 26
27 Chicken_George 64.31 54.90 63.79 0.96 0.91 1.01 67.94 60.69 68.62 1.11 1.14 1.28 Chicken_George 27
28 COMA−M 60.88 52.73 59.40 0.72 0.74 0.67 60.88 52.73 59.40 0.55 0.48 0.45 COMA−M 28
29 Bilab−UT 60.50 47.77 60.57 0.69 0.37 0.76 60.50 47.77 60.57 0.52 0.06 0.56 Bilab−UT 29
30 LevittGroup 59.92 49.87 65.28 0.65 0.53 1.12 60.30 49.87 65.28 0.50 0.24 0.98 LevittGroup 30
31 Sternberg 59.73 50.19 55.03 0.64 0.55 0.33 69.66 61.13 70.38 1.25 1.18 1.44 Sternberg 31
32 LEE 59.35 49.05 57.65 0.61 0.46 0.53 63.36 56.49 60.35 0.74 0.79 0.54 LEE 32
33 A−TASSER 59.16 54.20 53.94 0.60 0.85 0.25 62.79 55.02 55.81 0.70 0.67 0.12 A−TASSER 33
34 circle 58.59 51.72 56.03 0.56 0.67 0.41 58.59 51.72 56.03 0.36 0.39 0.14 circle 34
35 POEM 58.59 49.17 58.41 0.56 0.47 0.59 58.59 49.17 66.98 0.36 0.18 1.14 POEM 35
36 RAPTOR 58.21 53.37 50.74 0.54 0.79 0.00 61.07 53.44 57.54 0.56 0.54 0.28 RAPTOR 36
37 GS−KudlatyPred 58.21 50.45 56.35 0.54 0.57 0.44 58.21 50.45 56.35 0.33 0.29 0.17 GS−KudlatyPred 37
38 Pcons_dot_net 57.44 48.41 58.27 0.48 0.42 0.58 57.44 48.41 58.27 0.27 0.12 0.35 Pcons_dot_net 38
39 Kolinski 57.25 48.98 53.93 0.47 0.46 0.25 57.25 48.98 53.93 0.26 0.17 -0.05 Kolinski 39
40 HHpred5 56.87 49.24 54.46 0.44 0.48 0.29 56.87 49.24 54.46 0.23 0.19 0.00 HHpred5 40
41 MidwayFolding 56.87 48.35 50.19 0.44 0.41 -0.04 56.87 51.53 50.19 0.23 0.38 -0.39 MidwayFolding 41
42 POEMQA 56.49 44.53 55.86 0.42 0.12 0.40 60.30 56.36 66.98 0.50 0.78 1.14 POEMQA 42
43 MULTICOM−REFINE 56.30 49.55 54.94 0.40 0.50 0.33 56.30 49.55 54.94 0.18 0.21 0.05 MULTICOM−REFINE 43
44 BAKER−ROBETTA 56.30 46.56 52.82 0.40 0.28 0.16 57.44 48.41 58.27 0.27 0.12 0.35 BAKER−ROBETTA 44
45 Pcons_multi 56.30 46.56 52.82 0.40 0.28 0.16 56.30 47.33 52.82 0.18 0.03 -0.15 Pcons_multi 45
46 FAMSD 55.92 44.34 53.98 0.38 0.11 0.25 55.92 50.13 53.98 0.15 0.26 -0.04 FAMSD 46
47 3DShot2 55.73 48.85 54.91 0.37 0.45 0.32 55.73 48.85 54.91 0.13 0.15 0.04 3DShot2 47
48 pro−sp3−TASSER 55.34 49.49 53.87 0.34 0.50 0.24 65.84 60.12 58.79 0.94 1.09 0.39 pro−sp3−TASSER 48
49 3D−JIGSAW_AEP 54.96 47.58 51.49 0.31 0.35 0.06 54.96 47.58 51.91 0.07 0.05 -0.23 3D−JIGSAW_AEP 49
50 Phyre_de_novo 54.77 46.12 53.27 0.30 0.24 0.20 54.77 46.12 58.25 0.06 -0.07 0.35 Phyre_de_novo 50
51 HHpred4 54.20 42.37 52.24 0.26 -0.04 0.12 54.20 42.37 52.24 0.01 -0.38 -0.20 HHpred4 51
52 Frankenstein 54.01 43.70 52.66 0.25 0.06 0.15 54.01 44.66 53.15 -0.00 -0.19 -0.12 Frankenstein 52
53 taylor 53.82 44.91 49.66 0.23 0.15 -0.08 56.11 47.20 50.08 0.17 0.02 -0.39 taylor 53
54 EB_AMU_Physics 53.44 47.33 56.37 0.21 0.33 0.44 54.77 51.08 56.37 0.06 0.34 0.17 EB_AMU_Physics 54
55 MULTICOM−CLUSTER 53.24 46.37 52.20 0.19 0.26 0.12 54.77 46.37 52.82 0.06 -0.05 -0.15 MULTICOM−CLUSTER 55
56 TJ_Jiang 52.67 45.29 52.49 0.16 0.18 0.14 57.82 47.52 55.01 0.30 0.04 0.05 TJ_Jiang 56
57 keasar−server 52.67 43.26 52.49 0.16 0.02 0.14 53.24 44.34 52.49 -0.06 -0.22 -0.18 keasar−server 57
58 MULTICOM−CMFR 52.48 45.36 50.88 0.14 0.18 0.02 52.48 45.36 51.66 -0.13 -0.14 -0.25 MULTICOM−CMFR 58
59 Phyre2 52.48 44.59 53.28 0.14 0.13 0.20 52.48 47.52 53.64 -0.13 0.04 -0.07 Phyre2 59
60 nFOLD3 52.48 42.94 57.12 0.14 0.00 0.49 60.88 54.64 57.12 0.55 0.64 0.24 nFOLD3 60
61 SMEG−CCP 52.10 42.30 50.56 0.12 -0.05 -0.01 52.10 42.30 50.56 -0.16 -0.39 -0.35 SMEG−CCP 61
62 HHpred2 51.91 44.15 55.89 0.10 0.09 0.40 51.91 44.15 55.89 -0.17 -0.24 0.13 HHpred2 62
63 FrankensteinLong 51.72 43.45 53.26 0.09 0.04 0.20 58.21 50.95 56.56 0.33 0.33 0.19 FrankensteinLong 63
64 COMA 51.72 41.28 43.73 0.09 -0.13 -0.53 60.30 54.07 59.40 0.50 0.59 0.45 COMA 64
65 PSI 50.76 42.62 55.14 0.02 -0.02 0.34 50.76 42.62 56.12 -0.26 -0.36 0.15 PSI 65
66 SAM−T08−server 50.19 39.88 53.82 -0.02 -0.23 0.24 53.05 46.56 54.79 -0.08 -0.04 0.03 SAM−T08−server 66
67 forecast 50.00 37.47 47.92 -0.03 -0.41 -0.21 53.05 45.29 53.18 -0.08 -0.14 -0.11 forecast 67
68 Jiang_Zhu 49.43 41.54 56.48 -0.07 -0.11 0.44 50.00 43.13 56.48 -0.32 -0.32 0.18 Jiang_Zhu 68
69 Pcons_local 49.24 43.51 43.18 -0.08 0.04 -0.57 49.24 43.51 43.18 -0.38 -0.29 -1.02 Pcons_local 69
70 Hao_Kihara 49.05 40.39 49.13 -0.09 -0.19 -0.12 54.01 42.94 51.82 -0.00 -0.34 -0.24 Hao_Kihara 70
71 SAM−T06−server 47.90 40.52 42.63 -0.17 -0.18 -0.62 55.92 45.23 49.96 0.15 -0.15 -0.41 SAM−T06−server 71
72 MUProt 47.90 40.01 46.82 -0.17 -0.22 -0.30 52.48 44.78 51.31 -0.13 -0.18 -0.28 MUProt 72
73 pipe_int 47.90 38.49 46.38 -0.17 -0.34 -0.33 52.48 47.14 52.72 -0.13 0.01 -0.16 pipe_int 73
74 3Dpro 47.71 43.64 42.10 -0.19 0.05 -0.66 47.71 43.64 46.37 -0.51 -0.28 -0.73 3Dpro 74
75 MULTICOM−RANK 46.95 42.11 45.73 -0.24 -0.06 -0.38 52.10 44.47 50.82 -0.16 -0.21 -0.33 MULTICOM−RANK 75
76 CpHModels 46.37 40.39 47.06 -0.28 -0.19 -0.28 46.37 40.39 47.06 -0.61 -0.55 -0.67 CpHModels 76
77 mGenTHREADER 46.37 36.83 46.61 -0.28 -0.46 -0.31 46.37 36.83 46.61 -0.61 -0.85 -0.71 mGenTHREADER 77
78 keasar 45.99 39.63 40.24 -0.30 -0.25 -0.80 70.23 62.72 70.75 1.29 1.31 1.48 keasar 78
79 FLOUDAS 44.66 34.86 46.80 -0.40 -0.61 -0.30 46.76 36.32 47.89 -0.58 -0.89 -0.59 FLOUDAS 79
80 fais−server 44.47 37.09 51.46 -0.41 -0.44 0.06 49.05 42.94 56.05 -0.40 -0.34 0.15 fais−server 80
81 MUSTER 43.89 31.93 44.19 -0.45 -0.83 -0.50 53.05 46.56 51.34 -0.08 -0.04 -0.28 MUSTER 81
82 LOOPP_Server 43.51 38.80 34.24 -0.47 -0.31 -1.26 52.67 49.87 46.98 -0.11 0.24 -0.68 LOOPP_Server 82
83 AMU−Biology 42.75 36.90 36.44 -0.53 -0.46 -1.09 44.08 39.38 37.53 -0.80 -0.63 -1.53 AMU−Biology 83
84 PS2−manual 41.60 30.66 38.58 -0.61 -0.93 -0.93 54.20 42.68 52.80 0.01 -0.36 -0.15 PS2−manual 84
85 MUFOLD−Server 41.03 34.16 42.44 -0.65 -0.66 -0.63 45.42 39.19 47.13 -0.69 -0.65 -0.66 MUFOLD−Server 85
86 ACOMPMOD 40.27 36.32 32.46 -0.70 -0.50 -1.40 40.27 36.32 42.16 -1.10 -0.89 -1.11 ACOMPMOD 86
87 3D−JIGSAW_V3 40.08 27.99 42.30 -0.71 -1.13 -0.64 49.62 41.16 48.33 -0.35 -0.49 -0.55 3D−JIGSAW_V3 87
88 Distill 38.36 27.29 35.16 -0.83 -1.19 -1.19 38.36 29.64 35.16 -1.25 -1.44 -1.75 Distill 88
89 GS−MetaServer2 36.83 34.92 26.51 -0.93 -0.61 -1.85 48.28 43.96 47.62 -0.46 -0.25 -0.62 GS−MetaServer2 89
90 GeneSilicoMetaServer 36.83 34.92 26.51 -0.93 -0.61 -1.85 48.28 43.96 47.62 -0.46 -0.25 -0.62 GeneSilicoMetaServer 90
91 StruPPi 36.83 29.20 32.96 -0.93 -1.04 -1.36 36.83 29.20 32.96 -1.38 -1.48 -1.95 StruPPi 91
92 xianmingpan 36.07 29.33 38.56 -0.99 -1.03 -0.93 36.07 29.33 38.56 -1.44 -1.47 -1.44 xianmingpan 92
93 FFASsuboptimal 30.92 27.80 42.93 -1.34 -1.15 -0.59 32.44 27.80 43.65 -1.73 -1.60 -0.98 FFASsuboptimal 93
94 FALCON 30.73 24.43 27.97 -1.35 -1.40 -1.74 30.73 24.43 41.05 -1.86 -1.88 -1.21 FALCON 94
95 mariner1 29.96 19.98 28.40 -1.41 -1.74 -1.71 39.70 32.82 42.27 -1.15 -1.18 -1.10 mariner1 95
96 Softberry 28.82 24.62 38.94 -1.49 -1.39 -0.90 28.82 24.62 38.94 -2.02 -1.86 -1.40 Softberry 96
97 FFASstandard 28.63 24.43 31.37 -1.50 -1.40 -1.48 41.41 37.21 35.09 -1.01 -0.81 -1.75 FFASstandard 97
98 FFASflextemplate 28.43 23.86 31.32 -1.51 -1.44 -1.48 29.01 24.11 31.32 -2.00 -1.90 -2.09 FFASflextemplate 98
99 FOLDpro 28.24 24.43 27.25 -1.53 -1.40 -1.80 47.71 43.13 46.37 -0.51 -0.32 -0.73 FOLDpro 99
100 DistillSN 28.05 23.47 26.17 -1.54 -1.47 -1.88 28.05 23.47 26.17 -2.08 -1.96 -2.56 DistillSN 100
101 SAINT1 27.48 22.77 38.23 -1.58 -1.53 -0.95 27.48 22.77 38.23 -2.12 -2.02 -1.47 SAINT1 101
102 FUGUE_KM 27.10 22.39 18.88 -1.60 -1.56 -2.44 39.88 35.05 38.79 -1.13 -0.99 -1.42 FUGUE_KM 102
103 PS2−server 26.91 23.66 35.79 -1.62 -1.46 -1.14 54.20 42.68 52.80 0.01 -0.36 -0.15 PS2−server 103
104 fleil 26.72 22.27 30.53 -1.63 -1.57 -1.55 26.72 22.27 30.54 -2.18 -2.06 -2.16 fleil 104
105 MUFOLD−MD 26.53 23.22 40.43 -1.64 -1.49 -0.79 41.79 35.43 50.18 -0.98 -0.96 -0.39 MUFOLD−MD 105
106 RBO−Proteus 26.34 24.17 39.55 -1.66 -1.42 -0.85 30.73 25.13 43.18 -1.86 -1.82 -1.02 RBO−Proteus 106
107 Handl−Lovell 25.38 22.84 44.85 -1.72 -1.52 -0.45 26.53 22.84 45.20 -2.20 -2.01 -0.84 Handl−Lovell 107
108 Scheraga 25.19 21.44 31.12 -1.73 -1.63 -1.50 25.19 21.44 33.49 -2.31 -2.13 -1.90 Scheraga 108
109 Sasaki−Cetin−Sasai 23.86 19.91 33.96 -1.83 -1.74 -1.28 45.42 34.22 56.48 -0.69 -1.06 0.18 Sasaki−Cetin−Sasai 109
110 FALCON_CONSENSUS 22.90 17.81 36.03 -1.89 -1.90 -1.12 41.60 32.82 41.05 -0.99 -1.18 -1.21 FALCON_CONSENSUS 110
111 fais@hgc 22.33 19.85 36.52 -1.93 -1.75 -1.09 49.05 42.94 56.05 -0.40 -0.34 0.15 fais@hgc 111
112 PRI−Yang−KiharA 21.95 19.53 17.60 -1.96 -1.77 -2.54 21.95 19.53 17.60 -2.57 -2.29 -3.34 PRI−Yang−KiharA 112
113 Phragment 21.76 16.48 23.55 -1.97 -2.00 -2.08 21.76 19.34 28.01 -2.58 -2.30 -2.39 Phragment 113
114 SAM−T02−server 20.99 16.41 13.74 -2.02 -2.01 -2.83 41.79 33.91 29.75 -0.98 -1.09 -2.24 SAM−T02−server 114
115 igor 20.61 17.05 20.37 -2.05 -1.96 -2.32 20.61 17.05 20.37 -2.67 -2.49 -3.09 igor 115
116 Pushchino 19.66 17.88 17.51 -2.12 -1.90 -2.54 19.66 17.88 17.51 -2.75 -2.42 -3.35 Pushchino 116
117 MeilerLabRene 19.47 16.22 29.46 -2.13 -2.02 -1.63 21.18 18.13 31.50 -2.63 -2.40 -2.08 MeilerLabRene 117
118 BioSerf 19.27 17.11 33.60 -2.14 -1.96 -1.31 21.37 20.23 34.66 -2.61 -2.23 -1.79 BioSerf 118
119 Poing 17.94 14.31 27.13 -2.23 -2.17 -1.81 20.99 18.77 35.49 -2.64 -2.35 -1.72 Poing 119
120 RANDOM 17.81 15.01 17.81 -2.24 -2.12 -2.52 17.81 15.01 17.81 -2.90 -2.66 -3.32 RANDOM 120
121 Wolynes 17.56 16.29 23.08 -2.26 -2.02 -2.12 21.37 18.83 30.54 -2.61 -2.34 -2.16 Wolynes 121
122 OLGAFS 17.37 15.27 15.75 -2.27 -2.10 -2.68 17.37 15.39 15.86 -2.93 -2.63 -3.49 OLGAFS 122
123 DelCLab 16.22 13.99 25.08 -2.35 -2.19 -1.96 17.37 14.38 27.16 -2.93 -2.71 -2.47 DelCLab 123
124 mahmood−torda−server 13.74 12.72 16.85 -2.52 -2.29 -2.59 16.22 14.44 22.96 -3.02 -2.71 -2.85 mahmood−torda−server 124
125 TWPPLAB 13.55 13.29 13.97 -2.54 -2.25 -2.81 13.55 13.29 13.97 -3.24 -2.80 -3.67 TWPPLAB 125
126 schenk−torda−server 12.98 11.96 15.70 -2.57 -2.35 -2.68 16.41 15.08 18.69 -3.01 -2.66 -3.24 schenk−torda−server 126
127 rehtnap 8.59 7.44 0.00 -2.88 -2.69 -3.89 9.35 7.44 0.00 -3.57 -3.29 -4.93 rehtnap 127
128 Abagyan                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 Abagyan 128
129 BHAGEERATH                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 BHAGEERATH 129
130 CBSU                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 CBSU 130
131 FEIG_REFINE                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 FEIG_REFINE 131
132 Fiser−M4T                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 Fiser−M4T 132
133 HCA                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 HCA 133
134 JIVE08                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 JIVE08 134
135 LEE−SERVER                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 LEE−SERVER 135
136 Linnolt−UH−CMB                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 Linnolt−UH−CMB 136
137 NIM2                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 NIM2 137
138 Nano_team                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 Nano_team 138
139 NirBenTal                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 NirBenTal 139
140 PHAISTOS                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 PHAISTOS 140
141 POISE                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 POISE 141
142 PZ−UAM                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 PZ−UAM 142
143 ProtAnG                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 ProtAnG 143
144 ProteinShop                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 ProteinShop 144
145 RPFM                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 RPFM 145
146 SAMUDRALA                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 SAMUDRALA 146
147 ShakAbInitio                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 ShakAbInitio 147
148 TsaiLab                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 TsaiLab 148
149 UCDavisGenome                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 UCDavisGenome 149
150 Wolfson−FOBIA                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 Wolfson−FOBIA 150
151 YASARA                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 YASARA 151
152 YASARARefine                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 YASARARefine 152
153 Zhou−SPARKS                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 Zhou−SPARKS 153
154 dill_ucsf                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 dill_ucsf 154
155 dill_ucsf_extended                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 dill_ucsf_extended 155
156 huber−torda−server                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 huber−torda−server 156
157 jacobson                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 jacobson 157
158 mti                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 mti 158
159 mumssp                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 mumssp 159
160 panther_server                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 panther_server 160
161 psiphifoldings                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 psiphifoldings 161
162 ricardo                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 ricardo 162
163 rivilo                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 rivilo 163
164 sessions                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 sessions 164
165 test_http_server_01                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 test_http_server_01 165
166 tripos_08                   -2.24 -2.12 -2.52                   -2.90 -2.66 -3.32 tripos_08 166