T0480

30S ribosomal protein S27A from Thermoplasma acidophilum

Target type: Human/Server

Target sequence:

>T0480 TaT88, Thermoplasma acidophilum, 55 residues
MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS

Structure:

Method: NMR

Determined by: NESG

PDB ID: 2k4x

jumping through 480 NMR models
Jumping through 20 NMR models of 2k4x

all 20 480 NMR models
All 20 superimposed NMR models of 2k4x

PyMOL of 2k4x

Domains: PyMOL of domains

Single domain protein with poorly structured termini. Structurally variable regions were removed from NMR models for evaluation of predictions.

Structure classification:

Rubredoxin-like zinc-ribbon with an interesting bulge after the first zinc-knuckle (between green and cyan below). This unexpected bulge was predicted by only one server.

2k4x_1:17-50
Ribbon diagram of 480: 2k4x model 1 residues 17-50
Zinc ion is shown in magenta and side chains of its ligands (four Cys) are displayed.

CASP category:

Comparative modeling:medium. The bulge after the first zinc-knuckle was correctly predicted by a single server.

Closest templates:

A few distant templates are available, e.g. 1vk6, 2ct7, but none contains a bulge after the first zinc-knuckle. Here, de-novo method should result in a better prediction for this region.

Conservation         6     5 5      9    7  7  79 9 5   9  99 95 7

1FFK_W YGLKIRVRVRDVEIKHKKKYKCPV--CGFPKLKRASTS---IWVCGHCGYKIAGGAYTPET

1S1I_9 YGSSLRRQVKKLEIQQHARYDCSF--CGKKTVKRGAAG---IWTCSCCKKTVAGGAYTVST

2CT7_A GALFHKKLTEGVLMRDPKFLWCAQ--CSFGFIYEREQL---EATCPQCHQTFCVRCKRQWE

1VK6_A -----AGRGVQLAEFYRSHKYCGY--CGHEMYPSKTEW---AMLCSHCRERYYPQIAPCII

T0480 MQKRELYEIAD-GKLVRKHRFCPR--CGPGVFLAEHAD---RYSCGRCGYTEFKKAKKSKS

gi_18313341    --TWYELDLEK-GVFRFKNKLCPK--CG--SVMAFHKEPVPRWHCGKCGYTQFQR------

gi_55379150    MPHNEYYNDDG----ELDRETCPR--CGD-TVLAEHED---RQHCGKCGYTEWK-------

gi_47117077    GQKWKLYIVKD-GKVIRKNKFCPR--CGPGVFMADHGD---RWACGRCGYTEWKK------

gi_84489429    SKKYELYEVKD-GKIVRKNPECVR--CSHGIFMADHGD---RYACGRCGYTQWKNE-----

gi_14591759    GQKWKLYIVKD-GKVIRKNKFCPR--CGPGVFMADHGD---RWACGKCGYTEWKRK-----

gi_148642253   VKKSDLYKVDG-DKIERKNPVCPR--CSDGVFMADHGN---RYACGKCGYTEMKKD-----

gi_150403361   TKKSDYYKVEG-NAVERLKKACPK--CGAGVFMAEHLN---RFACGKCGYMEYKKNEKTES

gi_45358007    TKKSDYYKVEG-NTVERLKKVCPK--CGAGVFMAEHLN---RFACGKCGYMEYKKNEKTES

gi_73667830    MAVKDYYKVQG-DSVTRIKQFCPR--CGPGTFLADHKN---RLTCGKCGYTEFKK------

gi_123453431   LKILKLFKIGKDGSVEAQRKECPH--CK-GCFLAKHKD--GRQYCGNCHYTVDKEGKQIKS

gi_68076543    LAILKFYKVGDDGKVFRLKKQCNN--CAPGTLMASHFN---RDYCGRCHLTIMKK------

gi_70949218    LAILKFYKVGDDGKVFRLKKQCNN--CAPGTLMAAHFN---RDYCGRCHLTIMKK------

gi_156102460   LAVLKFYKVGDDGKVFRLKKQCDN--CAPGTLMAAHFN---REYCGRCHLTIMKK------

gi_190589841   LAVLKYYRVDENGKITRLRRECPY--EA-GVFMANHFD---RQYCGKCGATFVFTQEQQQE

gi_19397       LAVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFD---RHYCGKCGLTYVYNKAGGD-

gi_68053251    LAVLKYYKVEDDGSVKRLRRECPN--CGASTFMANHKD---RLYCGRCHLTLKLEN-----

gi_19115020    LAVLKYYKVEDDGSVKRLRRECPN--CGASTFMANHKD---RLYCGRCHLTLKLEN-----

gi_1184755     LAVLKYYKVDENGKITRLRKECASPSCGGGVFMASHQN---RYYCGKCHQTLVMQDPK---

gi_114577583  1LAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFD---RHYCGKCCLTYCFNKPEDK-

gi_145534758   LATLKLYNVDNKGVVQRSHKQCPQ--CPQGVYMAKHFD---RHYCGTCHQTFRMDEATIKA

Consensus_aa   h...chYplp..s.l..bpc.Csp..CtsGhhhApHbs...R.hCG+C.hTb.bp......

Consensus_ss   eeeeeeeee    eeeee            eee                 eeee

Target sequence - PDB file inconsistencies:

None. PDB sequence matches target sequence exactly.

T0480 2k4x.pdb T0480.pdb PyMOL PyMOL of domains

T0480    1 MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS 55
           ****************||||||||||||||||||||||||||||||||||*****
2k4xA    1 MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS 55

Residue change log: remove 1-MQKRELYEIADGKLVR-16, 51-KKSKS-55 by 3.5Å SD cutoff;

Single domain protein: target 17-50 ; pdb 17-50

Sequence classification:

Ribosomal protein S27a family PF01599 in Pfam.

Server predictions:

T0480:pdb 17-50:seq 17-50:CM_medium; alignment

distribution of
first scores
First models for T0480: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

#	GROUP ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	↓ GROUP	#
		T0480			T0480			T0480			T0480
		First score			First Z-score			Best score			Best Z-score
1	SAM−T08−human	82.35	75.00	81.06	2.25	2.66	2.46	82.35	75.00	81.06	2.07	2.16	1.91	SAM−T08−human	1
2	MULTICOM−CLUSTER	75.73	73.78	80.14	1.58	2.52	2.36	75.73	73.78	80.14	1.31	2.02	1.81	MULTICOM−CLUSTER	2
3	Chicken_George	73.53	68.63	69.57	1.36	1.96	1.16	78.68	73.28	80.08	1.65	1.96	1.80	Chicken_George	3
4	EB_AMU_Physics	73.53	65.20	71.58	1.36	1.58	1.39	73.53	65.20	71.58	1.06	1.05	0.85	EB_AMU_Physics	4
5	POEM	72.79	58.58	68.36	1.28	0.86	1.02	73.53	65.69	79.16	1.06	1.11	1.70	POEM	5
6	3DShot1	72.06	56.37	66.52	1.21	0.62	0.82	72.06	56.37	66.52	0.89	0.05	0.29	3DShot1	6
7	TASSER	71.32	63.97	64.12	1.13	1.45	0.54	71.32	63.97	66.06	0.81	0.91	0.24	TASSER	7
8	SAINT1	71.32	63.48	63.12	1.13	1.40	0.43	71.32	63.48	63.12	0.81	0.86	-0.09	SAINT1	8
9	METATASSER	70.59	61.77	61.14	1.06	1.21	0.21	70.59	62.26	63.19	0.72	0.72	-0.08	METATASSER	9
10	RBO−Proteus	70.59	61.77	78.75	1.06	1.21	2.20	78.68	73.28	80.08	1.65	1.96	1.80	RBO−Proteus	10
11	Zhang−Server	70.59	59.80	68.88	1.06	0.99	1.08	70.59	62.74	71.53	0.72	0.77	0.85	Zhang−Server	11
12	LEE	70.59	58.33	71.18	1.06	0.83	1.34	70.59	58.33	71.18	0.72	0.28	0.81	LEE	12
13	GeneSilico	70.59	58.33	77.35	1.06	0.83	2.04	70.59	60.05	77.35	0.72	0.47	1.50	GeneSilico	13
14	SAM−T08−server	70.59	55.88	65.88	1.06	0.57	0.74	70.59	59.31	65.88	0.72	0.39	0.22	SAM−T08−server	14
15	Frankenstein	70.59	53.43	61.40	1.06	0.30	0.24	70.59	55.88	70.53	0.72	-0.00	0.74	Frankenstein	15
16	FrankensteinLong	70.59	53.43	61.40	1.06	0.30	0.24	71.32	58.09	71.65	0.81	0.25	0.86	FrankensteinLong	16
17	LevittGroup	69.85	58.09	69.10	0.98	0.81	1.11	70.59	59.31	70.68	0.72	0.39	0.75	LevittGroup	17
18	LOOPP_Server	69.85	58.09	70.51	0.98	0.81	1.27	75.73	69.85	74.10	1.31	1.58	1.13	LOOPP_Server	18
19	pro−sp3−TASSER	69.12	61.77	71.77	0.91	1.21	1.41	70.59	67.16	71.77	0.72	1.27	0.87	pro−sp3−TASSER	19
20	Zhang	69.12	60.78	66.32	0.91	1.10	0.79	70.59	61.03	70.20	0.72	0.58	0.70	Zhang	20
21	DBAKER	69.12	50.98	66.17	0.91	0.03	0.78	69.12	62.50	66.20	0.55	0.75	0.25	DBAKER	21
22	Bates_BMM	68.38	63.48	60.48	0.83	1.40	0.13	68.38	63.48	60.48	0.47	0.86	-0.39	Bates_BMM	22
23	Zico	68.38	60.54	66.70	0.83	1.07	0.84	69.85	61.27	80.57	0.64	0.61	1.86	Zico	23
24	ZicoFullSTP	68.38	60.54	66.70	0.83	1.07	0.84	79.41	74.02	80.57	1.73	2.05	1.86	ZicoFullSTP	24
25	ZicoFullSTPFullData	68.38	60.54	66.70	0.83	1.07	0.84	79.41	74.02	80.57	1.73	2.05	1.86	ZicoFullSTPFullData	25
26	Pcons_local	68.38	53.68	62.85	0.83	0.32	0.40	68.38	53.68	62.85	0.47	-0.25	-0.12	Pcons_local	26
27	GS−KudlatyPred	68.38	53.68	71.47	0.83	0.32	1.38	68.38	54.17	71.47	0.47	-0.19	0.84	GS−KudlatyPred	27
28	Hao_Kihara	68.38	52.21	65.95	0.83	0.16	0.75	68.38	52.21	65.95	0.47	-0.42	0.22	Hao_Kihara	28
29	FEIG	67.65	62.26	58.32	0.76	1.26	-0.11	71.32	66.42	58.99	0.81	1.19	-0.55	FEIG	29
30	HHpred2	67.65	51.96	62.65	0.76	0.14	0.38	67.65	51.96	62.65	0.38	-0.44	-0.14	HHpred2	30
31	Elofsson	67.65	50.98	71.71	0.76	0.03	1.40	68.38	54.17	71.71	0.47	-0.19	0.87	Elofsson	31
32	fams−ace2	66.91	57.60	65.07	0.69	0.75	0.65	69.85	62.01	71.03	0.64	0.69	0.79	fams−ace2	32
33	KudlatyPredHuman	66.91	56.13	65.31	0.69	0.59	0.68	66.91	59.31	65.37	0.30	0.39	0.16	KudlatyPredHuman	33
34	keasar−server	66.91	55.64	67.23	0.69	0.54	0.90	68.38	57.11	69.98	0.47	0.14	0.67	keasar−server	34
35	IBT_LT	66.91	54.66	64.43	0.69	0.43	0.58	66.91	54.66	64.43	0.30	-0.14	0.05	IBT_LT	35
36	Pcons_dot_net	66.91	54.66	71.49	0.69	0.43	1.38	68.38	54.90	71.49	0.47	-0.11	0.84	Pcons_dot_net	36
37	Pcons_multi	66.91	54.66	71.49	0.69	0.43	1.38	70.59	58.33	71.49	0.72	0.28	0.84	Pcons_multi	37
38	HHpred4	66.91	52.45	62.77	0.69	0.19	0.39	66.91	52.45	62.77	0.30	-0.39	-0.13	HHpred4	38
39	PRI−Yang−KiharA	66.18	62.74	61.38	0.61	1.32	0.23	66.18	62.74	61.38	0.22	0.77	-0.29	PRI−Yang−KiharA	39
40	HHpred5	66.18	61.27	63.30	0.61	1.15	0.45	66.18	61.27	63.30	0.22	0.61	-0.07	HHpred5	40
41	3DShotMQ	66.18	58.82	63.08	0.61	0.89	0.43	66.18	58.82	63.08	0.22	0.33	-0.10	3DShotMQ	41
42	A−TASSER	66.18	56.86	63.66	0.61	0.67	0.49	69.85	64.22	63.66	0.64	0.94	-0.03	A−TASSER	42
43	FOLDpro	66.18	55.39	67.95	0.61	0.51	0.98	66.18	58.33	67.95	0.22	0.28	0.45	FOLDpro	43
44	3DShot2	66.18	54.90	65.11	0.61	0.46	0.66	66.18	54.90	65.11	0.22	-0.11	0.13	3DShot2	44
45	McGuffin	66.18	54.41	65.25	0.61	0.40	0.67	66.18	59.07	65.25	0.22	0.36	0.15	McGuffin	45
46	FALCON	66.18	54.41	65.25	0.61	0.40	0.67	66.18	56.13	65.25	0.22	0.03	0.15	FALCON	46
47	Sternberg	65.44	60.05	60.35	0.54	1.02	0.12	72.06	67.16	71.53	0.89	1.27	0.85	Sternberg	47
48	FALCON_CONSENSUS	65.44	56.13	64.85	0.54	0.59	0.63	65.44	56.13	64.85	0.13	0.03	0.10	FALCON_CONSENSUS	48
49	ACOMPMOD	65.44	54.66	57.37	0.54	0.43	-0.22	67.65	54.66	69.84	0.38	-0.14	0.66	ACOMPMOD	49
50	Phyre2	65.44	51.23	61.11	0.54	0.06	0.20	72.06	69.61	64.01	0.89	1.55	0.01	Phyre2	50
51	Kolinski	64.71	62.26	57.40	0.46	1.26	-0.22	65.44	62.26	58.95	0.13	0.72	-0.56	Kolinski	51
52	MULTICOM−RANK	64.71	59.31	60.46	0.46	0.94	0.13	65.44	59.31	62.42	0.13	0.39	-0.17	MULTICOM−RANK	52
53	GS−MetaServer2	64.71	58.33	67.29	0.46	0.83	0.90	67.65	58.33	70.70	0.38	0.28	0.75	GS−MetaServer2	53
54	GeneSilicoMetaServer	64.71	58.33	67.29	0.46	0.83	0.90	67.65	58.33	70.70	0.38	0.28	0.75	GeneSilicoMetaServer	54
55	MUProt	64.71	57.35	58.84	0.46	0.73	-0.05	64.71	58.33	60.96	0.05	0.28	-0.33	MUProt	55
56	Phyre_de_novo	64.71	56.86	61.80	0.46	0.67	0.28	72.06	67.16	65.14	0.89	1.27	0.13	Phyre_de_novo	56
57	FAMS−multi	64.71	55.88	67.33	0.46	0.57	0.91	69.85	59.56	73.15	0.64	0.41	1.03	FAMS−multi	57
58	RAPTOR	64.71	55.39	68.44	0.46	0.51	1.03	70.59	58.33	73.69	0.72	0.28	1.09	RAPTOR	58
59	mumssp	64.71	50.49	66.12	0.46	-0.02	0.77	64.71	50.49	66.12	0.05	-0.61	0.24	mumssp	59
60	MULTICOM−CMFR	64.71	50.00	65.56	0.46	-0.08	0.71	64.71	57.11	65.56	0.05	0.14	0.18	MULTICOM−CMFR	60
61	MULTICOM−REFINE	63.97	59.07	60.31	0.39	0.91	0.11	65.44	59.07	60.35	0.13	0.36	-0.40	MULTICOM−REFINE	61
62	MULTICOM	63.97	56.62	59.02	0.39	0.65	-0.03	69.12	60.29	69.98	0.55	0.50	0.67	MULTICOM	62
63	mufold	63.97	55.64	61.37	0.39	0.54	0.23	66.18	56.37	61.37	0.22	0.05	-0.29	mufold	63
64	FUGUE_KM	63.97	52.21	61.06	0.39	0.16	0.20	65.44	52.21	66.78	0.13	-0.42	0.32	FUGUE_KM	64
65	3D−JIGSAW_V3	63.23	50.00	49.62	0.31	-0.08	-1.10	63.23	50.49	51.65	-0.12	-0.61	-1.37	3D−JIGSAW_V3	65
66	COMA−M	63.23	44.12	59.76	0.31	-0.72	0.05	71.32	66.91	74.49	0.81	1.24	1.18	COMA−M	66
67	COMA	63.23	44.12	59.76	0.31	-0.72	0.05	71.32	66.91	74.49	0.81	1.24	1.18	COMA	67
68	nFOLD3	62.50	54.17	59.61	0.24	0.38	0.03	63.97	59.56	59.80	-0.04	0.41	-0.46	nFOLD3	68
69	AMU−Biology	62.50	45.83	64.10	0.24	-0.53	0.54	62.50	53.92	67.61	-0.20	-0.22	0.41	AMU−Biology	69
70	SMEG−CCP	61.77	52.45	58.93	0.16	0.19	-0.04	61.77	52.45	58.93	-0.29	-0.39	-0.56	SMEG−CCP	70
71	PSI	61.77	50.00	61.49	0.16	-0.08	0.25	61.77	51.72	62.31	-0.29	-0.47	-0.18	PSI	71
72	FFASsuboptimal	61.03	55.64	56.63	0.09	0.54	-0.30	61.03	55.64	56.63	-0.37	-0.03	-0.82	FFASsuboptimal	72
73	SAM−T02−server	61.03	48.28	58.13	0.09	-0.27	-0.13	63.23	56.13	60.24	-0.12	0.03	-0.41	SAM−T02−server	73
74	Jiang_Zhu	59.56	54.66	56.01	-0.06	0.43	-0.37	61.03	55.64	57.92	-0.37	-0.03	-0.67	Jiang_Zhu	74
75	fais@hgc	59.56	42.40	62.55	-0.06	-0.91	0.37	59.56	51.96	64.15	-0.54	-0.44	0.02	fais@hgc	75
76	fais−server	58.82	51.96	55.28	-0.13	0.14	-0.46	59.56	51.96	62.55	-0.54	-0.44	-0.15	fais−server	76
77	JIVE08	58.09	52.70	58.02	-0.21	0.22	-0.15	58.82	53.43	59.15	-0.63	-0.28	-0.53	JIVE08	77
78	FAMSD	58.09	49.76	61.84	-0.21	-0.10	0.29	74.27	66.91	72.31	1.14	1.24	0.93	FAMSD	78
79	MidwayFolding	58.09	48.77	61.05	-0.21	-0.21	0.20	64.71	55.39	68.44	0.05	-0.06	0.50	MidwayFolding	79
80	TJ_Jiang	58.09	46.32	50.99	-0.21	-0.48	-0.94	58.09	46.32	55.05	-0.71	-1.08	-0.99	TJ_Jiang	80
81	Softberry	58.09	45.83	49.97	-0.21	-0.53	-1.06	58.09	45.83	49.97	-0.71	-1.14	-1.56	Softberry	81
82	fleil	57.35	50.49	58.24	-0.28	-0.02	-0.12	57.35	52.21	59.09	-0.79	-0.42	-0.54	fleil	82
83	CpHModels	55.88	48.04	50.56	-0.43	-0.29	-0.99	55.88	48.04	50.56	-0.96	-0.89	-1.49	CpHModels	83
84	MUFOLD−Server	55.15	49.76	48.83	-0.51	-0.10	-1.19	55.15	49.76	48.83	-1.05	-0.69	-1.69	MUFOLD−Server	84
85	Jones−UCL	55.15	44.85	50.26	-0.51	-0.64	-1.03	55.88	47.55	54.42	-0.96	-0.94	-1.06	Jones−UCL	85
86	PS2−server	54.41	45.10	56.10	-0.58	-0.61	-0.36	54.41	45.59	56.10	-1.13	-1.16	-0.87	PS2−server	86
87	PS2−manual	54.41	45.10	56.10	-0.58	-0.61	-0.36	54.41	45.59	56.10	-1.13	-1.16	-0.87	PS2−manual	87
88	Sasaki−Cetin−Sasai	53.68	46.81	56.68	-0.65	-0.43	-0.30	53.68	49.02	56.68	-1.21	-0.78	-0.81	Sasaki−Cetin−Sasai	88
89	POEMQA	52.94	42.16	51.66	-0.73	-0.94	-0.87	73.53	66.18	79.16	1.06	1.16	1.70	POEMQA	89
90	ProteinShop	52.21	43.87	45.81	-0.80	-0.75	-1.53	55.15	50.24	51.57	-1.05	-0.64	-1.38	ProteinShop	90
91	mariner1	52.21	39.46	47.49	-0.80	-1.23	-1.34	57.35	44.12	54.74	-0.79	-1.33	-1.03	mariner1	91
92	BAKER−ROBETTA	51.47	41.67	50.58	-0.88	-0.99	-0.99	61.77	51.47	60.64	-0.29	-0.50	-0.37	BAKER−ROBETTA	92
93	OLGAFS	51.47	41.18	47.65	-0.88	-1.04	-1.32	51.47	41.18	47.98	-1.47	-1.66	-1.78	OLGAFS	93
94	3D−JIGSAW_AEP	50.73	46.81	55.93	-0.95	-0.43	-0.38	56.62	49.76	56.85	-0.88	-0.69	-0.79	3D−JIGSAW_AEP	94
95	FLOUDAS	50.00	44.12	49.27	-1.03	-0.72	-1.14	58.82	44.12	61.55	-0.63	-1.33	-0.27	FLOUDAS	95
96	3Dpro	50.00	38.23	57.31	-1.03	-1.37	-0.23	69.12	56.37	72.29	0.55	0.05	0.93	3Dpro	96
97	FFASstandard	49.27	41.91	53.13	-1.10	-0.96	-0.70	49.27	41.91	53.88	-1.72	-1.58	-1.12	FFASstandard	97
98	Bilab−UT	49.27	41.91	51.74	-1.10	-0.96	-0.86	51.47	49.51	61.71	-1.47	-0.72	-0.25	Bilab−UT	98
99	FFASflextemplate	49.27	41.91	53.13	-1.10	-0.96	-0.70	49.27	41.91	53.88	-1.72	-1.58	-1.12	FFASflextemplate	99
100	huber−torda−server	48.53	44.61	52.86	-1.18	-0.67	-0.73	75.00	68.14	76.49	1.23	1.38	1.40	huber−torda−server	100
101	Ozkan−Shell	47.79	38.97	53.49	-1.25	-1.28	-0.66	55.15	47.30	58.85	-1.05	-0.97	-0.57	Ozkan−Shell	101
102	BioSerf	47.06	41.18	51.84	-1.33	-1.04	-0.85	55.15	50.24	59.11	-1.05	-0.64	-0.54	BioSerf	102
103	Phragment	47.06	39.22	48.87	-1.33	-1.26	-1.18	49.27	40.44	48.87	-1.72	-1.74	-1.68	Phragment	103
104	Wolynes	46.32	39.95	46.02	-1.40	-1.18	-1.51	49.27	42.89	48.76	-1.72	-1.47	-1.69	Wolynes	104
105	dill_ucsf	44.85	38.97	43.46	-1.55	-1.28	-1.80	45.59	38.97	52.34	-2.14	-1.91	-1.29	dill_ucsf	105
106	SAMUDRALA	44.12	34.80	68.27	-1.62	-1.74	1.01	71.32	62.01	68.27	0.81	0.69	0.48	SAMUDRALA	106
107	pipe_int	43.38	36.52	44.25	-1.70	-1.55	-1.71	43.38	36.52	44.25	-2.39	-2.19	-2.20	pipe_int	107
108	SHORTLE	42.65	39.22	43.80	-1.77	-1.26	-1.76	42.65	39.22	43.80	-2.48	-1.88	-2.25	SHORTLE	108
109	DelCLab	42.65	37.74	44.72	-1.77	-1.42	-1.65	66.91	56.37	71.24	0.30	0.05	0.81	DelCLab	109
110	PHAISTOS	42.65	35.78	44.89	-1.77	-1.63	-1.63	51.47	45.10	48.84	-1.47	-1.22	-1.68	PHAISTOS	110
111	SAM−T06−server	42.65	35.29	43.35	-1.77	-1.69	-1.81	71.32	60.54	65.94	0.81	0.52	0.22	SAM−T06−server	111
112	keasar	42.65	32.84	42.95	-1.77	-1.95	-1.85	78.68	69.85	81.68	1.65	1.58	1.98	keasar	112
113	MUFOLD−MD	41.91	34.07	47.40	-1.85	-1.82	-1.35	66.18	58.82	63.65	0.22	0.33	-0.03	MUFOLD−MD	113
114	MUSTER	39.71	30.88	39.63	-2.07	-2.17	-2.23	52.94	37.74	60.57	-1.30	-2.05	-0.38	MUSTER	114
115	forecast	38.97	34.56	40.78	-2.14	-1.77	-2.10	42.65	38.73	40.78	-2.48	-1.94	-2.58	forecast	115
116	Scheraga	38.97	34.07	40.43	-2.14	-1.82	-2.14	43.38	38.48	45.62	-2.39	-1.96	-2.04	Scheraga	116
117	schenk−torda−server	38.97	27.21	43.37	-2.14	-2.57	-1.81	42.65	34.80	44.53	-2.48	-2.38	-2.17	schenk−torda−server	117
118	Distill	38.23	34.31	44.83	-2.22	-1.79	-1.64	38.97	34.31	44.83	-2.90	-2.44	-2.13	Distill	118
119	Poing	38.23	31.86	37.68	-2.22	-2.06	-2.45	38.23	33.09	38.74	-2.98	-2.57	-2.81	Poing	119
120	xianmingpan	38.23	31.37	34.53	-2.22	-2.12	-2.81	38.23	31.37	34.53	-2.98	-2.77	-3.28	xianmingpan	120
121	ABIpro	36.77	30.88	37.81	-2.37	-2.17	-2.44	37.50	32.84	40.46	-3.07	-2.60	-2.62	ABIpro	121
122	DistillSN	36.77	30.39	42.30	-2.37	-2.22	-1.93	45.59	42.65	50.54	-2.14	-1.49	-1.50	DistillSN	122
123	StruPPi	36.77	27.70	47.45	-2.37	-2.52	-1.34	36.77	27.70	47.45	-3.15	-3.18	-1.84	StruPPi	123
124	RANDOM	36.29	30.95	36.29	-2.42	-2.16	-2.61	36.29	30.95	36.29	-3.21	-2.81	-3.09	RANDOM	124
125	circle	36.03	26.72	36.75	-2.44	-2.62	-2.56	59.56	54.66	56.51	-0.54	-0.14	-0.83	circle	125
126	POISE	34.56	31.62	33.43	-2.59	-2.09	-2.93	36.03	32.60	35.07	-3.24	-2.63	-3.22	POISE	126
127	mahmood−torda−server	34.56	28.19	37.33	-2.59	-2.46	-2.49	34.56	28.19	41.90	-3.40	-3.13	-2.46	mahmood−torda−server	127
128	RPFM	34.56	28.19	44.95	-2.59	-2.46	-1.63	39.71	30.39	44.95	-2.81	-2.88	-2.12	RPFM	128
129	Linnolt−UH−CMB	32.35	29.41	33.33	-2.82	-2.33	-2.94	32.35	29.41	33.33	-3.66	-2.99	-3.42	Linnolt−UH−CMB	129
130	Pushchino	31.62	23.28	21.16	-2.89	-3.00	-4.32	31.62	23.28	21.16	-3.74	-3.68	-4.77	Pushchino	130
131	TWPPLAB	30.15	27.70	35.30	-3.04	-2.52	-2.72	30.15	27.70	35.30	-3.91	-3.18	-3.20	TWPPLAB	131
132	mGenTHREADER	26.47	24.51	22.28	-3.41	-2.87	-4.20	26.47	24.51	22.28	-4.33	-3.54	-4.65	mGenTHREADER	132
133	rehtnap	20.59	19.12	16.68	-4.01	-3.46	-4.83	20.59	19.12	16.68	-5.00	-4.15	-5.27	rehtnap	133
134	Abagyan				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	Abagyan	134
135	BHAGEERATH				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	BHAGEERATH	135
136	CBSU				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	CBSU	136
137	FEIG_REFINE				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	FEIG_REFINE	137
138	Fiser−M4T				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	Fiser−M4T	138
139	HCA				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	HCA	139
140	Handl−Lovell				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	Handl−Lovell	140
141	LEE−SERVER				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	LEE−SERVER	141
142	MeilerLabRene				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	MeilerLabRene	142
143	NIM2				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	NIM2	143
144	Nano_team				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	Nano_team	144
145	NirBenTal				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	NirBenTal	145
146	PZ−UAM				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	PZ−UAM	146
147	ProtAnG				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	ProtAnG	147
148	ShakAbInitio				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	ShakAbInitio	148
149	TsaiLab				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	TsaiLab	149
150	UCDavisGenome				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	UCDavisGenome	150
151	Wolfson−FOBIA				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	Wolfson−FOBIA	151
152	YASARA				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	YASARA	152
153	YASARARefine				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	YASARARefine	153
154	Zhou−SPARKS				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	Zhou−SPARKS	154
155	dill_ucsf_extended				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	dill_ucsf_extended	155
156	igor				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	igor	156
157	jacobson				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	jacobson	157
158	mti				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	mti	158
159	panther_server				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	panther_server	159
160	psiphifoldings				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	psiphifoldings	160
161	ricardo				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	ricardo	161
162	rivilo				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	rivilo	162
163	sessions				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	sessions	163
164	taylor				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	taylor	164
165	test_http_server_01				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	test_http_server_01	165
166	tripos_08				-2.42	-2.16	-2.61				-3.21	-2.81	-3.09	tripos_08	166

NMR Targets
437	460	462	464
466	467	468	469
471	472	473	474
475	476	480	482
484	492	498	499
500