T0499

artificial protein L1d expressed in Escherichia coli

Target type: Human/Server

Target sequence:

>T0499 L1d, E coli, 56 residues
TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE

Structure:

Method: NMR

Determined by: Bryan & Orban

PDB ID: 2jwu
(not the target, but close)

jumping through 499 NMR models
Jumping through 20 NMR models of

all 20 499 NMR models
All 20 superimposed NMR models of

PyMOL of 2jwu

Domains: PyMOL of domains

Single domain protein with poorly structured termini. Structurally variable regions were removed from NMR models for evaluation of predictions.

Structure classification:

β-Grasp (ubiquitin-like) fold. Most similar to Immunoglobulin-binding domains: protens G and L.

2jwu_1 cartoon
Cartoon diagram of 499: model 1

CASP category:

Comparative modeling:easy

Closest templates:

Good resolution X-ray structures of proteins G and L, e.g. 1pgx, 1em7

Target sequence - PDB file inconsistencies:

T0499 2jwu.pdb T0499.pdb PyMOL PyMOL of domains

T0499    1 TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE 56
           |||||||||||||||||||:|||:||||||||:|||||||||||||||:|||||||
2jwuA    1 TTYKLILNLKQAKEEAIKELVDAATAEKYFKLYANAKTVEGVWTYKDETKTFTVTE 56

Residue change log: change 20 L to A; change 24 A to G; change 33 Y to I; change 49 T to I;

Single domain protein: target 1-56 ; pdb 1-56

Sequence classification:

N/A for artifical designed protein.

Comments:

This artificial protein sequence is very similar to T0498 (just 3 amino acids differ), but was designed to have a drastically different fold 1).

T0499 TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE

T0498 TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE

1pgx TTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

1zxg MYYLVVNKQQNAFYEVLNMPNLNEDQRNAFIQSLKDDPSQSANVLAEAQKLNDVQA

1zxh MYYLVVNKGQNAFYETLTKAVDAETARNAFIQSLKDDGVQGVWTYDDATKTFTVQA

Server predictions:

T0499:pdb 1-56:seq 1-56:CM_easy; alignment

distribution of
first scores
First models for T0499: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

#	GROUP ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	↓ GROUP	#
		T0499			T0499			T0499			T0499
		First score			First Z-score			Best score			Best Z-score
1	LevittGroup	93.75	92.56	90.70	1.52	1.05	0.80	93.75	92.56	90.85	1.90	1.21	0.83	LevittGroup	1
2	TWPPLAB	92.86	91.67	89.18	1.26	0.89	0.34	92.86	91.67	89.18	1.49	0.94	0.07	TWPPLAB	2
3	Ozkan−Shell	92.41	91.81	90.14	1.13	0.92	0.63	92.41	91.81	90.14	1.28	0.99	0.51	Ozkan−Shell	3
4	RBO−Proteus	92.41	90.62	89.83	1.13	0.71	0.54	93.30	92.71	90.85	1.69	1.26	0.83	RBO−Proteus	4
5	McGuffin	91.96	91.96	89.76	1.00	0.94	0.51	91.96	91.96	90.06	1.07	1.03	0.47	McGuffin	5
6	FEIG	91.96	91.96	89.80	1.00	0.94	0.53	91.96	91.96	89.80	1.07	1.03	0.35	FEIG	6
7	MidwayFolding	91.96	91.37	89.34	1.00	0.84	0.39	91.96	91.37	89.34	1.07	0.85	0.14	MidwayFolding	7
8	Frankenstein	91.96	90.77	90.08	1.00	0.74	0.61	91.96	90.77	90.08	1.07	0.67	0.48	Frankenstein	8
9	FrankensteinLong	91.96	90.77	90.06	1.00	0.74	0.61	91.96	90.77	90.06	1.07	0.67	0.47	FrankensteinLong	9
10	MULTICOM−CLUSTER	91.52	91.52	90.17	0.87	0.87	0.64	91.52	91.52	90.26	0.86	0.90	0.56	MULTICOM−CLUSTER	10
11	ZicoFullSTPFullData	91.52	91.52	89.56	0.87	0.87	0.45	91.52	91.52	90.04	0.86	0.90	0.46	ZicoFullSTPFullData	11
12	MULTICOM	91.52	91.52	90.11	0.87	0.87	0.62	91.52	91.52	90.33	0.86	0.90	0.60	MULTICOM	12
13	Fiser−M4T	91.52	90.92	90.44	0.87	0.76	0.72	91.52	90.92	90.44	0.86	0.71	0.65	Fiser−M4T	13
14	Elofsson	91.07	91.07	90.13	0.74	0.79	0.63	91.52	91.07	90.29	0.86	0.76	0.58	Elofsson	14
15	MUSTER	91.07	91.07	89.88	0.74	0.79	0.55	91.07	91.07	89.88	0.65	0.76	0.39	MUSTER	15
16	3DShot1	91.07	90.48	90.34	0.74	0.69	0.69	91.07	90.48	90.34	0.65	0.58	0.60	3DShot1	16
17	MULTICOM−REFINE	91.07	90.48	89.81	0.74	0.69	0.53	91.07	90.48	89.99	0.65	0.58	0.44	MULTICOM−REFINE	17
18	mumssp	91.07	90.48	90.47	0.74	0.69	0.73	91.07	90.48	90.47	0.65	0.58	0.66	mumssp	18
19	GeneSilico	91.07	90.48	89.77	0.74	0.69	0.52	91.07	90.48	89.77	0.65	0.58	0.34	GeneSilico	19
20	Jones−UCL	91.07	89.88	88.65	0.74	0.58	0.17	91.07	89.88	88.65	0.65	0.40	-0.17	Jones−UCL	20
21	EB_AMU_Physics	91.07	89.88	89.90	0.74	0.58	0.56	91.07	89.88	89.90	0.65	0.40	0.40	EB_AMU_Physics	21
22	Chicken_George	91.07	88.69	89.71	0.74	0.38	0.50	91.96	90.77	89.93	1.07	0.67	0.41	Chicken_George	22
23	Zico	90.62	90.62	89.51	0.61	0.71	0.44	91.52	91.52	90.04	0.86	0.90	0.46	Zico	23
24	ZicoFullSTP	90.62	90.62	89.51	0.61	0.71	0.44	91.52	91.52	90.04	0.86	0.90	0.46	ZicoFullSTP	24
25	PRI−Yang−KiharA	90.62	90.03	90.28	0.61	0.61	0.67	90.62	90.03	90.28	0.44	0.44	0.57	PRI−Yang−KiharA	25
26	Kolinski	90.62	90.03	90.44	0.61	0.61	0.72	90.62	90.03	90.44	0.44	0.44	0.65	Kolinski	26
27	MUProt	90.62	90.03	89.76	0.61	0.61	0.51	90.62	90.18	90.10	0.44	0.49	0.49	MUProt	27
28	NIM2	90.62	89.44	89.82	0.61	0.51	0.53	90.62	89.44	89.82	0.44	0.26	0.36	NIM2	28
29	NirBenTal	90.62	89.44	90.40	0.61	0.51	0.71	90.62	89.44	90.40	0.44	0.26	0.63	NirBenTal	29
30	SAM−T06−server	90.62	89.44	90.22	0.61	0.51	0.66	90.62	90.62	90.24	0.44	0.62	0.56	SAM−T06−server	30
31	MULTICOM−CMFR	90.18	90.18	90.19	0.49	0.63	0.65	90.18	90.18	90.19	0.23	0.49	0.53	MULTICOM−CMFR	31
32	SAMUDRALA	90.18	90.18	89.82	0.49	0.63	0.53	90.62	90.62	89.82	0.44	0.62	0.36	SAMUDRALA	32
33	Sternberg	90.18	90.18	90.46	0.49	0.63	0.73	90.18	90.18	90.46	0.23	0.49	0.66	Sternberg	33
34	Phyre_de_novo	90.18	90.18	90.50	0.49	0.63	0.74	90.18	90.18	90.50	0.23	0.49	0.67	Phyre_de_novo	34
35	MULTICOM−RANK	90.18	89.58	90.38	0.49	0.53	0.71	91.52	91.52	90.38	0.86	0.90	0.62	MULTICOM−RANK	35
36	SAM−T08−human	90.18	89.58	88.80	0.49	0.53	0.22	90.62	89.58	90.30	0.44	0.31	0.58	SAM−T08−human	36
37	DBAKER	90.18	89.58	90.02	0.49	0.53	0.59	90.18	89.58	90.02	0.23	0.31	0.45	DBAKER	37
38	GS−MetaServer2	90.18	89.58	89.38	0.49	0.53	0.40	90.18	89.58	89.38	0.23	0.31	0.16	GS−MetaServer2	38
39	FAMS−multi	90.18	89.58	89.75	0.49	0.53	0.51	91.96	90.77	89.75	1.07	0.67	0.33	FAMS−multi	39
40	3DShotMQ	90.18	89.58	89.87	0.49	0.53	0.55	90.18	89.58	89.87	0.23	0.31	0.39	3DShotMQ	40
41	Zhang−Server	90.18	88.99	90.00	0.49	0.43	0.59	90.18	90.18	90.00	0.23	0.49	0.45	Zhang−Server	41
42	DelCLab	90.18	88.99	88.59	0.49	0.43	0.15	92.86	92.86	90.64	1.49	1.30	0.74	DelCLab	42
43	RAPTOR	90.18	88.99	90.43	0.49	0.43	0.72	90.18	88.99	90.43	0.23	0.13	0.64	RAPTOR	43
44	xianmingpan	90.18	88.39	86.36	0.49	0.32	-0.53	90.18	88.39	86.36	0.23	-0.05	-1.22	xianmingpan	44
45	FAMSD	90.18	83.63	89.63	0.49	-0.50	0.47	90.18	88.99	89.63	0.23	0.13	0.28	FAMSD	45
46	fleil	89.73	89.73	88.23	0.36	0.56	0.04	91.07	90.48	89.92	0.65	0.58	0.41	fleil	46
47	LEE	89.73	89.73	89.74	0.36	0.56	0.51	91.07	91.07	90.21	0.65	0.76	0.54	LEE	47
48	Pcons_dot_net	89.73	89.73	89.30	0.36	0.56	0.37	90.18	89.73	90.50	0.23	0.35	0.67	Pcons_dot_net	48
49	3D−JIGSAW_V3	89.73	89.14	88.16	0.36	0.45	0.02	89.73	89.14	88.20	0.02	0.17	-0.38	3D−JIGSAW_V3	49
50	PS2−server	89.73	89.14	90.50	0.36	0.45	0.74	89.73	89.14	90.50	0.02	0.17	0.67	PS2−server	50
51	PS2−manual	89.73	89.14	90.46	0.36	0.45	0.73	89.73	89.14	90.46	0.02	0.17	0.66	PS2−manual	51
52	huber−torda−server	89.73	88.54	90.05	0.36	0.35	0.60	91.07	89.88	90.36	0.65	0.40	0.61	huber−torda−server	52
53	IBT_LT	89.73	88.54	89.22	0.36	0.35	0.35	89.73	88.54	89.22	0.02	-0.01	0.09	IBT_LT	53
54	COMA−M	89.73	88.54	89.25	0.36	0.35	0.36	89.73	89.29	89.25	0.02	0.22	0.10	COMA−M	54
55	LOOPP_Server	89.73	88.54	90.02	0.36	0.35	0.59	89.73	88.54	90.02	0.02	-0.01	0.45	LOOPP_Server	55
56	MUFOLD−Server	89.73	87.35	88.56	0.36	0.14	0.14	89.73	89.29	89.01	0.02	0.22	-0.01	MUFOLD−Server	56
57	GeneSilicoMetaServer	89.29	89.29	89.13	0.23	0.48	0.32	90.18	89.58	89.43	0.23	0.31	0.19	GeneSilicoMetaServer	57
58	3DShot2	89.29	89.29	89.19	0.23	0.48	0.34	89.29	89.29	89.19	-0.19	0.22	0.08	3DShot2	58
59	pipe_int	89.29	89.29	89.08	0.23	0.48	0.30	91.07	90.62	90.36	0.65	0.62	0.61	pipe_int	59
60	COMA	89.29	89.29	88.03	0.23	0.48	-0.02	89.29	89.29	89.25	-0.19	0.22	0.10	COMA	60
61	AMU−Biology	89.29	89.29	89.38	0.23	0.48	0.40	89.29	89.29	89.38	-0.19	0.22	0.16	AMU−Biology	61
62	pro−sp3−TASSER	89.29	89.29	89.08	0.23	0.48	0.30	89.29	89.29	89.20	-0.19	0.22	0.08	pro−sp3−TASSER	62
63	BioSerf	89.29	88.69	89.31	0.23	0.38	0.38	89.29	88.69	89.31	-0.19	0.04	0.13	BioSerf	63
64	mGenTHREADER	89.29	88.09	89.42	0.23	0.27	0.41	89.29	88.09	89.42	-0.19	-0.15	0.18	mGenTHREADER	64
65	mariner1	89.29	88.09	89.30	0.23	0.27	0.37	90.18	88.09	89.93	0.23	-0.15	0.41	mariner1	65
66	SAM−T08−server	89.29	87.50	90.19	0.23	0.17	0.65	90.62	90.62	90.19	0.44	0.62	0.53	SAM−T08−server	66
67	Abagyan	89.29	87.50	89.76	0.23	0.17	0.51	89.29	87.65	89.99	-0.19	-0.28	0.44	Abagyan	67
68	Softberry	89.29	86.91	89.27	0.23	0.07	0.36	89.29	86.91	89.27	-0.19	-0.50	0.11	Softberry	68
69	tripos_08	89.29	86.31	90.76	0.23	-0.04	0.82	89.29	86.31	90.76	-0.19	-0.69	0.79	tripos_08	69
70	GS−KudlatyPred	88.84	88.84	89.04	0.10	0.40	0.29	88.84	88.84	89.04	-0.40	0.08	0.01	GS−KudlatyPred	70
71	Hao_Kihara	88.84	88.84	89.05	0.10	0.40	0.30	90.18	89.58	90.14	0.23	0.31	0.51	Hao_Kihara	71
72	Wolfson−FOBIA	88.84	88.24	89.64	0.10	0.30	0.48	88.84	88.24	89.64	-0.40	-0.10	0.28	Wolfson−FOBIA	72
73	YASARA	88.84	87.65	88.70	0.10	0.20	0.19	91.96	90.77	90.52	1.07	0.67	0.68	YASARA	73
74	3D−JIGSAW_AEP	88.84	87.65	86.58	0.10	0.20	-0.47	89.73	89.14	88.20	0.02	0.17	-0.38	3D−JIGSAW_AEP	74
75	Pushchino	88.84	87.05	87.77	0.10	0.09	-0.10	88.84	87.05	87.77	-0.40	-0.46	-0.57	Pushchino	75
76	PSI	88.84	87.05	86.35	0.10	0.09	-0.54	90.18	90.18	90.40	0.23	0.49	0.63	PSI	76
77	Zhang	88.84	86.46	89.22	0.10	-0.01	0.35	88.84	88.24	89.22	-0.40	-0.10	0.09	Zhang	77
78	ACOMPMOD	88.84	85.86	90.23	0.10	-0.12	0.66	88.84	85.86	90.23	-0.40	-0.82	0.55	ACOMPMOD	78
79	3Dpro	88.39	87.80	90.12	-0.03	0.22	0.63	90.18	90.18	90.18	0.23	0.49	0.53	3Dpro	79
80	TASSER	88.39	87.80	88.52	-0.03	0.22	0.13	89.29	89.29	89.02	-0.19	0.22	-0.00	TASSER	80
81	ABIpro	88.39	87.80	90.12	-0.03	0.22	0.63	90.18	90.18	90.12	0.23	0.49	0.50	ABIpro	81
82	TJ_Jiang	88.39	87.20	89.85	-0.03	0.12	0.54	90.62	90.62	90.31	0.44	0.62	0.59	TJ_Jiang	82
83	rivilo	88.39	87.20	87.65	-0.03	0.12	-0.14	88.39	87.20	87.65	-0.61	-0.42	-0.63	rivilo	83
84	HHpred2	88.39	87.20	88.71	-0.03	0.12	0.19	88.39	87.20	88.71	-0.61	-0.42	-0.14	HHpred2	84
85	Bates_BMM	88.39	86.61	89.74	-0.03	0.01	0.51	88.84	87.65	89.78	-0.40	-0.28	0.35	Bates_BMM	85
86	A−TASSER	88.39	85.42	88.17	-0.03	-0.19	0.02	95.09	93.90	88.62	2.53	1.62	-0.18	A−TASSER	86
87	Pcons_multi	87.95	86.76	88.95	-0.16	0.04	0.26	91.07	91.07	90.68	0.65	0.76	0.76	Pcons_multi	87
88	nFOLD3	87.50	86.91	86.13	-0.29	0.07	-0.61	91.07	90.62	90.36	0.65	0.62	0.61	nFOLD3	88
89	OLGAFS	87.05	87.05	83.42	-0.42	0.09	-1.44	87.50	87.50	85.57	-1.02	-0.32	-1.58	OLGAFS	89
90	POEMQA	87.05	85.27	88.89	-0.42	-0.22	0.25	87.05	85.27	88.89	-1.23	-1.00	-0.06	POEMQA	90
91	keasar−server	87.05	84.08	89.21	-0.42	-0.42	0.34	87.05	84.23	90.00	-1.23	-1.32	0.45	keasar−server	91
92	rehtnap	87.05	77.23	83.93	-0.42	-1.61	-1.28	87.05	79.46	83.93	-1.23	-2.77	-2.32	rehtnap	92
93	FFASsuboptimal	86.61	83.04	86.98	-0.54	-0.60	-0.34	86.61	83.04	86.98	-1.44	-1.68	-0.93	FFASsuboptimal	93
94	fams−ace2	86.16	83.78	86.83	-0.67	-0.48	-0.39	89.73	88.54	89.85	0.02	-0.01	0.38	fams−ace2	94
95	SAM−T02−server	85.71	85.12	83.86	-0.80	-0.24	-1.31	89.73	88.09	90.24	0.02	-0.15	0.56	SAM−T02−server	95
96	keasar	85.71	83.93	87.73	-0.80	-0.45	-0.11	88.84	86.46	88.08	-0.40	-0.64	-0.43	keasar	96
97	METATASSER	85.71	83.93	86.56	-0.80	-0.45	-0.47	90.18	89.73	87.99	0.23	0.35	-0.47	METATASSER	97
98	circle	85.71	82.74	87.29	-0.80	-0.66	-0.25	89.73	84.23	89.12	0.02	-1.32	0.04	circle	98
99	BAKER−ROBETTA	85.71	80.36	82.52	-0.80	-1.07	-1.72	85.71	80.36	84.37	-1.86	-2.50	-2.12	BAKER−ROBETTA	99
100	FALCON_CONSENSUS	85.27	83.48	81.54	-0.93	-0.53	-2.02	85.27	83.48	81.54	-2.07	-1.55	-3.42	FALCON_CONSENSUS	100
101	Jiang_Zhu	85.27	80.80	89.43	-0.93	-0.99	0.41	85.27	80.80	89.43	-2.07	-2.36	0.19	Jiang_Zhu	101
102	FUGUE_KM	84.82	81.84	86.16	-1.06	-0.81	-0.60	84.82	81.84	86.16	-2.28	-2.05	-1.31	FUGUE_KM	102
103	FFASstandard	84.82	80.06	84.87	-1.06	-1.12	-0.99	87.95	85.56	85.81	-0.81	-0.91	-1.47	FFASstandard	103
104	FFASflextemplate	84.82	80.06	84.87	-1.06	-1.12	-0.99	84.82	80.06	84.87	-2.28	-2.59	-1.90	FFASflextemplate	104
105	POEM	83.93	77.38	86.92	-1.32	-1.59	-0.36	84.38	80.80	88.89	-2.49	-2.36	-0.06	POEM	105
106	SMEG−CCP	83.93	76.79	79.22	-1.32	-1.69	-2.74	83.93	76.79	79.22	-2.70	-3.58	-4.47	SMEG−CCP	106
107	Poing	83.04	67.11	84.71	-1.57	-3.37	-1.04	89.29	89.29	89.81	-0.19	0.22	0.36	Poing	107
108	Phyre2	83.04	67.11	84.71	-1.57	-3.37	-1.04	89.29	89.29	89.81	-0.19	0.22	0.36	Phyre2	108
109	Phragment	83.04	67.11	84.71	-1.57	-3.37	-1.04	89.29	89.29	89.81	-0.19	0.22	0.36	Phragment	109
110	JIVE08	82.14	78.57	81.51	-1.83	-1.38	-2.03	87.95	86.76	85.71	-0.81	-0.55	-1.51	JIVE08	110
111	CpHModels	81.70	74.85	79.81	-1.96	-2.02	-2.55	81.70	74.85	79.81	-3.74	-4.17	-4.20	CpHModels	111
112	Distill	79.91	78.12	77.73	-2.47	-1.46	-3.20	81.70	81.25	78.27	-3.74	-2.22	-4.91	Distill	112
113	Pcons_local	77.23	68.30	72.44	-3.25	-3.16	-4.83	77.23	72.47	72.44	-5.84	-4.89	-7.57	Pcons_local	113
114	StruPPi	72.32	65.48	78.99	-4.66	-3.65	-2.81	86.16	83.78	83.88	-1.65	-1.46	-2.35	StruPPi	114
115	FLOUDAS	72.32	60.42	76.50	-4.66	-4.53	-3.58	72.32	60.42	76.50	-8.14	-8.56	-5.72	FLOUDAS	115
116	forecast	71.43	69.05	61.19	-4.92	-3.03	-8.30	75.89	72.32	61.95	-6.46	-4.94	-12.36	forecast	116
117	MUFOLD−MD	70.54	56.55	70.12	-5.18	-5.20	-5.54	72.32	65.77	74.00	-8.14	-6.93	-6.86	MUFOLD−MD	117
118	DistillSN	58.04	51.19	53.74	-8.78	-6.13	-10.60	58.04	51.19	53.74	-14.83	-11.36	-16.10	DistillSN	118
119	mufold	51.79	51.19	41.08	-10.58	-6.13	-14.50	89.73	89.73	88.33	0.02	0.35	-0.32	mufold	119
120	FALCON	50.89	43.01	56.55	-10.84	-7.55	-9.73	51.79	44.49	81.54	-17.75	-13.40	-3.42	FALCON	120
121	Bilab−UT	44.20	35.27	52.84	-12.77	-8.89	-10.87	48.66	42.71	59.20	-19.22	-13.94	-13.61	Bilab−UT	121
122	MeilerLabRene	35.71	31.84	39.89	-15.22	-9.48	-14.87	35.71	34.52	40.96	-25.29	-16.43	-21.93	MeilerLabRene	122
123	schenk−torda−server	33.04	30.66	33.03	-15.99	-9.69	-16.98	35.71	30.66	35.90	-25.29	-17.60	-24.24	schenk−torda−server	123
124	HHpred4	31.70	28.72	33.26	-16.38	-10.02	-16.91	31.70	28.72	33.26	-27.17	-18.19	-25.45	HHpred4	124
125	HHpred5	31.25	29.32	32.85	-16.51	-9.92	-17.04	31.25	29.32	32.85	-27.38	-18.01	-25.64	HHpred5	125
126	FOLDpro	31.25	28.72	32.37	-16.51	-10.02	-17.19	87.50	86.61	86.21	-1.02	-0.60	-1.28	FOLDpro	126
127	RPFM	30.80	26.93	33.18	-16.64	-10.34	-16.94	35.71	31.40	45.01	-25.29	-17.38	-20.09	RPFM	127
128	RANDOM	30.71	25.95	30.71	-16.66	-10.51	-17.70	30.71	25.95	30.71	-27.63	-19.03	-26.61	RANDOM	128
129	mahmood−torda−server	28.12	25.74	32.53	-17.41	-10.54	-17.14	33.04	31.84	38.14	-26.54	-17.24	-23.22	mahmood−torda−server	129
130	BHAGEERATH				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	BHAGEERATH	130
131	CBSU				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	CBSU	131
132	FEIG_REFINE				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	FEIG_REFINE	132
133	HCA				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	HCA	133
134	Handl−Lovell				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	Handl−Lovell	134
135	KudlatyPredHuman				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	KudlatyPredHuman	135
136	LEE−SERVER				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	LEE−SERVER	136
137	Linnolt−UH−CMB				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	Linnolt−UH−CMB	137
138	Nano_team				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	Nano_team	138
139	PHAISTOS				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	PHAISTOS	139
140	POISE				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	POISE	140
141	PZ−UAM				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	PZ−UAM	141
142	ProtAnG				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	ProtAnG	142
143	ProteinShop				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	ProteinShop	143
144	SAINT1				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	SAINT1	144
145	SHORTLE				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	SHORTLE	145
146	Sasaki−Cetin−Sasai				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	Sasaki−Cetin−Sasai	146
147	Scheraga				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	Scheraga	147
148	ShakAbInitio				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	ShakAbInitio	148
149	TsaiLab				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	TsaiLab	149
150	UCDavisGenome				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	UCDavisGenome	150
151	Wolynes				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	Wolynes	151
152	YASARARefine				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	YASARARefine	152
153	Zhou−SPARKS				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	Zhou−SPARKS	153
154	dill_ucsf				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	dill_ucsf	154
155	dill_ucsf_extended				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	dill_ucsf_extended	155
156	fais−server				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	fais−server	156
157	fais@hgc				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	fais@hgc	157
158	igor				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	igor	158
159	jacobson				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	jacobson	159
160	mti				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	mti	160
161	panther_server				-16.66	-10.51	-17.70				-0.40	0.08	-26.61	panther_server	161
162	psiphifoldings				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	psiphifoldings	162
163	ricardo				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	ricardo	163
164	sessions				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	sessions	164
165	taylor				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	taylor	165
166	test_http_server_01				-16.66	-10.51	-17.70				-27.63	-19.03	-26.61	test_http_server_01	166

¹⁾ He Y, Chen Y, Alexander P, Bryan PN, Orban J. (2008) "NMR structures of two designed proteins with high sequence identity but different fold and function." Proc Natl Acad Sci U S A. Sep 16. [Epub ahead of print], PMID: 18796611

NMR Targets
437	460	462	464
466	467	468	469
471	472	473	474
475	476	480	482
484	492	498	499
500