Psyllid ID: psy13262
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| 193659736 | 287 | PREDICTED: hypothetical protein LOC10016 | 0.462 | 0.369 | 0.631 | 2e-29 | |
| 307211218 | 324 | Protein FAM125B [Harpegnathos saltator] | 0.550 | 0.388 | 0.477 | 3e-27 | |
| 218749841 | 324 | uncharacterized protein LOC551408 [Apis | 0.419 | 0.296 | 0.575 | 5e-26 | |
| 380013740 | 351 | PREDICTED: LOW QUALITY PROTEIN: multives | 0.419 | 0.273 | 0.575 | 5e-26 | |
| 194477810 | 193 | TPA_exp: unknown [Apis mellifera] gi|218 | 0.419 | 0.497 | 0.575 | 8e-26 | |
| 340729074 | 329 | PREDICTED: multivesicular body subunit 1 | 0.419 | 0.291 | 0.565 | 2e-25 | |
| 322801820 | 328 | hypothetical protein SINV_01966 [Solenop | 0.541 | 0.378 | 0.469 | 2e-25 | |
| 350401490 | 329 | PREDICTED: multivesicular body subunit 1 | 0.419 | 0.291 | 0.565 | 4e-25 | |
| 332021467 | 352 | Multivesicular body subunit 12B [Acromyr | 0.436 | 0.284 | 0.518 | 4e-25 | |
| 383857164 | 329 | PREDICTED: multivesicular body subunit 1 | 0.419 | 0.291 | 0.545 | 6e-25 |
| >gi|193659736|ref|XP_001943561.1| PREDICTED: hypothetical protein LOC100164562 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 135 bits (339), Expect = 2e-29, Method: Compositional matrix adjust.
Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 8/114 (7%)
Query: 1 MNKQVFQSFIPDDKPITAIAVIEDIQKCPSGYTVISKTVDQDTDADM----WRESAFFLR 56
M KQVF+SF PD+KPI+ + +IEDI KCP+GY ISKT DQD+DAD+ W+ES F R
Sbjct: 1 MIKQVFKSF-PDNKPISGLCIIEDITKCPTGYNPISKTHDQDSDADLHMQSWKESVFIGR 59
Query: 57 K-TRYLCVSKTESLFQIDYIVENICIINEKETPPDGFCLIARTLDSDQGQICER 109
K TRYLC+SKTE + DYIV NI IINEKE PPDG+CLI RT+DSDQ +R
Sbjct: 60 KITRYLCLSKTEGIS--DYIVVNINIINEKECPPDGYCLIPRTIDSDQKAWRKR 111
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307211218|gb|EFN87418.1| Protein FAM125B [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|218749841|ref|NP_001106142.2| uncharacterized protein LOC551408 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380013740|ref|XP_003690907.1| PREDICTED: LOW QUALITY PROTEIN: multivesicular body subunit 12B-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|194477810|tpg|DAA06289.1| TPA_exp: unknown [Apis mellifera] gi|218670125|gb|ABU68672.2| hypothetical protein [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340729074|ref|XP_003402833.1| PREDICTED: multivesicular body subunit 12B [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|322801820|gb|EFZ22397.1| hypothetical protein SINV_01966 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|350401490|ref|XP_003486169.1| PREDICTED: multivesicular body subunit 12B-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|332021467|gb|EGI61835.1| Multivesicular body subunit 12B [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383857164|ref|XP_003704075.1| PREDICTED: multivesicular body subunit 12B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| FB|FBgn0030894 | 352 | CG7192 [Drosophila melanogaste | 0.410 | 0.267 | 0.484 | 2.3e-23 | |
| RGD|2322311 | 1361 | Msh6 "mutS homolog 6 (E. coli) | 0.358 | 0.060 | 0.454 | 1.3e-12 | |
| UNIPROTKB|F1PM27 | 1263 | MSH6 "Uncharacterized protein" | 0.454 | 0.082 | 0.404 | 8.3e-12 | |
| UNIPROTKB|J9P5H1 | 1279 | MSH6 "Uncharacterized protein" | 0.454 | 0.081 | 0.404 | 8.4e-12 | |
| UNIPROTKB|F5H2F9 | 1058 | MSH6 "DNA mismatch repair prot | 0.454 | 0.098 | 0.383 | 8.5e-12 | |
| UNIPROTKB|B4DF41 | 1230 | MSH6 "DNA mismatch repair prot | 0.454 | 0.084 | 0.383 | 1e-11 | |
| UNIPROTKB|P52701 | 1360 | MSH6 "DNA mismatch repair prot | 0.454 | 0.076 | 0.383 | 1.2e-11 | |
| MGI|MGI:1343961 | 1358 | Msh6 "mutS homolog 6 (E. coli) | 0.362 | 0.061 | 0.428 | 2.4e-11 | |
| UNIPROTKB|E1B9Q4 | 1360 | MSH6 "Uncharacterized protein" | 0.344 | 0.058 | 0.466 | 3.9e-11 | |
| ZFIN|ZDB-GENE-060929-372 | 296 | mvb12ba "multivesicular body s | 0.585 | 0.452 | 0.294 | 1.5e-10 |
| FB|FBgn0030894 CG7192 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 269 (99.8 bits), Expect = 2.3e-23, P = 2.3e-23
Identities = 47/97 (48%), Positives = 74/97 (76%)
Query: 8 SFIPDDKPITAIAVIEDIQKCPSGYTVISKTVDQDTDADMWRESAFFLRK-TRYLCVSKT 66
SF+PD++PIT++ ++ED ++CP ++ IS+T DQD+DAD+WR+ + F R+ TRYLC+SK+
Sbjct: 50 SFLPDNRPITSLHIVEDFERCPKNFSAISRTYDQDSDADLWRDYSLFGRQNTRYLCLSKS 109
Query: 67 ESLFQIDYIVENICIINEKETPPDGFCLIARTLDSDQ 103
E L +Y+VE + +I++K PP F ++RT DSDQ
Sbjct: 110 EGL--PEYVVETLQVISDKTPPPKEFSQVSRTADSDQ 144
|
|
| RGD|2322311 Msh6 "mutS homolog 6 (E. coli)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PM27 MSH6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P5H1 MSH6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5H2F9 MSH6 "DNA mismatch repair protein Msh6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DF41 MSH6 "DNA mismatch repair protein Msh6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P52701 MSH6 "DNA mismatch repair protein Msh6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1343961 Msh6 "mutS homolog 6 (E. coli)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B9Q4 MSH6 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060929-372 mvb12ba "multivesicular body subunit 12Ba" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 229 | |||
| pfam10240 | 251 | pfam10240, DUF2464, Protein of unknown function (D | 3e-26 | |
| PRK05399 | 854 | PRK05399, PRK05399, DNA mismatch repair protein Mu | 3e-16 | |
| pfam00488 | 235 | pfam00488, MutS_V, MutS domain V | 8e-15 | |
| cd03286 | 218 | cd03286, ABC_MSH6_euk, ATP-binding cassette domain | 2e-13 | |
| COG0249 | 843 | COG0249, MutS, Mismatch repair ATPase (MutS family | 3e-13 | |
| cd03243 | 202 | cd03243, ABC_MutS_homologs, ATP-binding cassette d | 1e-12 | |
| smart00534 | 185 | smart00534, MUTSac, ATPase domain of DNA mismatch | 2e-12 | |
| cd03284 | 216 | cd03284, ABC_MutS1, ATP-binding cassette domain of | 3e-12 | |
| TIGR01070 | 840 | TIGR01070, mutS1, DNA mismatch repair protein MutS | 2e-09 | |
| cd03285 | 222 | cd03285, ABC_MSH2_euk, ATP-binding cassette domain | 3e-09 | |
| cd03287 | 222 | cd03287, ABC_MSH3_euk, ATP-binding cassette domain | 1e-07 | |
| cd03281 | 213 | cd03281, ABC_MSH5_euk, ATP-binding cassette domain | 1e-07 | |
| cd03282 | 204 | cd03282, ABC_MSH4_euk, ATP-binding cassette domain | 2e-06 | |
| cd03283 | 199 | cd03283, ABC_MutS-like, ATP-binding cassette domai | 3e-06 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 3e-06 | |
| cd03280 | 200 | cd03280, ABC_MutS2, ATP-binding cassette domain of | 1e-05 | |
| COG1193 | 753 | COG1193, COG1193, Mismatch repair ATPase (MutS fam | 3e-05 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.001 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 0.002 | |
| TIGR01069 | 771 | TIGR01069, mutS2, MutS2 family protein | 0.003 |
| >gnl|CDD|220646 pfam10240, DUF2464, Protein of unknown function (DUF2464) | Back alignment and domain information |
|---|
Score = 101 bits (254), Expect = 3e-26
Identities = 40/101 (39%), Positives = 62/101 (61%), Gaps = 8/101 (7%)
Query: 15 PITAIAVIEDIQKCPSGYTVISKTVDQDTDADMWRESAFFLRKTRYLCVSKTESLFQI-D 73
PITA+ + D +KCP G++ ISKTVD DAD+WR+ F R TRYLC S +ES +
Sbjct: 2 PITALGWVADFEKCPKGFSPISKTVD-GADADLWRDG-FGSRSTRYLCYSTSESKNGLPG 59
Query: 74 YIVENICIINEKETPPDGFCLIARTLDSDQG-----QICER 109
+V ++ +I++K+T P G+ I T D+ + ++C +
Sbjct: 60 NVVVDLQVIDDKDTLPVGYSAIPETADTREKVWRKKRLCVK 100
|
This is a family of proteins conserved from worms to humans. Members have been annotated as FAM125A proteins, but their function is unknown. Length = 251 |
| >gnl|CDD|235444 PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215944 pfam00488, MutS_V, MutS domain V | Back alignment and domain information |
|---|
| >gnl|CDD|213253 cd03286, ABC_MSH6_euk, ATP-binding cassette domain of eukaryotic MutS6 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|223327 COG0249, MutS, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|213210 cd03243, ABC_MutS_homologs, ATP-binding cassette domain of MutS homologs | Back alignment and domain information |
|---|
| >gnl|CDD|197777 smart00534, MUTSac, ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >gnl|CDD|213251 cd03284, ABC_MutS1, ATP-binding cassette domain of MutS1 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|233259 TIGR01070, mutS1, DNA mismatch repair protein MutS | Back alignment and domain information |
|---|
| >gnl|CDD|213252 cd03285, ABC_MSH2_euk, ATP-binding cassette domain of eukaryotic MutS2 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213254 cd03287, ABC_MSH3_euk, ATP-binding cassette domain of eukaryotic MutS3 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213248 cd03281, ABC_MSH5_euk, ATP-binding cassette domain of eukaryotic MutS5 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213249 cd03282, ABC_MSH4_euk, ATP-binding cassette domain of eukaryotic MutS4 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213250 cd03283, ABC_MutS-like, ATP-binding cassette domain of MutS-like homolog | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213247 cd03280, ABC_MutS2, ATP-binding cassette domain of MutS2 | Back alignment and domain information |
|---|
| >gnl|CDD|224114 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 99.95 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 99.92 | |
| TIGR01070 | 840 | mutS1 DNA mismatch repair protein MutS. | 99.89 | |
| KOG4000|consensus | 291 | 99.86 | ||
| PF10240 | 251 | DUF2464: Protein of unknown function (DUF2464); In | 99.86 | |
| PRK05399 | 854 | DNA mismatch repair protein MutS; Provisional | 99.85 | |
| COG0249 | 843 | MutS Mismatch repair ATPase (MutS family) [DNA rep | 99.85 | |
| COG1193 | 753 | Mismatch repair ATPase (MutS family) [DNA replicat | 99.83 | |
| PF00488 | 235 | MutS_V: MutS domain V C-terminus.; InterPro: IPR00 | 99.8 | |
| KOG0218|consensus | 1070 | 99.77 | ||
| KOG0219|consensus | 902 | 99.76 | ||
| KOG0220|consensus | 867 | 99.67 | ||
| KOG0217|consensus | 1125 | 99.61 | ||
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 99.58 | |
| KOG0221|consensus | 849 | 99.56 | ||
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 99.55 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 99.54 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 99.52 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 99.52 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 99.51 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 99.48 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 99.47 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 99.44 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.38 | |
| KOG0927|consensus | 614 | 99.1 | ||
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 99.07 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.99 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 98.93 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 98.91 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.89 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.88 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 98.78 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 98.76 | |
| KOG0066|consensus | 807 | 98.75 | ||
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 98.72 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 98.71 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 98.7 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 98.7 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 98.7 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 98.69 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 98.69 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 98.69 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 98.68 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 98.68 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 98.68 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 98.67 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 98.67 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 98.67 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 98.67 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 98.67 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 98.67 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 98.67 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 98.67 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 98.67 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 98.67 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 98.67 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 98.67 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 98.67 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 98.67 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.67 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 98.66 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 98.66 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 98.66 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 98.66 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 98.66 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.66 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 98.66 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 98.66 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 98.66 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 98.66 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 98.66 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 98.66 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.66 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.66 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 98.66 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 98.65 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 98.65 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 98.65 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 98.65 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 98.65 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 98.65 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 98.65 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 98.65 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 98.65 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 98.65 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 98.65 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 98.65 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 98.65 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.65 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 98.65 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 98.64 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 98.64 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 98.64 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 98.64 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 98.64 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 98.64 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 98.64 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 98.64 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 98.63 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 98.63 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 98.63 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 98.63 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 98.63 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 98.63 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 98.63 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 98.63 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.63 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 98.63 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 98.63 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 98.62 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 98.62 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 98.62 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 98.62 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 98.61 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 98.61 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.61 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.61 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 98.61 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 98.6 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 98.6 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 98.6 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 98.6 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 98.6 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 98.6 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 98.6 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 98.6 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 98.6 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 98.59 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 98.59 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 98.59 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 98.59 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 98.59 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 98.59 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 98.58 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.58 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 98.58 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 98.58 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 98.58 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 98.58 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 98.58 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 98.58 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.58 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 98.57 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 98.57 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 98.57 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 98.57 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 98.57 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 98.57 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 98.57 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 98.57 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 98.57 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 98.57 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 98.56 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 98.56 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 98.56 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 98.56 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 98.56 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 98.56 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 98.55 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 98.55 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 98.55 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 98.55 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 98.55 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 98.55 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 98.55 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 98.54 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 98.54 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 98.54 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 98.54 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 98.54 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 98.54 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 98.53 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 98.53 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 98.53 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.53 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 98.53 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.52 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.52 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 98.51 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 98.51 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.51 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 98.51 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 98.51 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 98.51 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 98.51 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 98.51 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 98.5 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.5 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 98.5 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 98.5 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 98.5 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 98.5 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.5 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 98.49 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.49 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.49 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 98.49 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.49 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 98.49 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.49 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 98.49 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.49 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 98.48 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 98.48 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 98.47 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 98.47 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.47 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.47 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 98.47 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 98.46 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.46 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.46 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 98.46 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.46 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.46 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 98.46 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 98.46 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 98.46 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 98.46 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 98.45 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 98.45 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 98.45 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 98.45 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 98.45 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 98.44 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 98.44 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 98.44 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 98.44 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.44 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.44 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.44 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 98.44 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 98.43 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 98.43 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 98.43 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.43 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 98.43 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 98.43 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.43 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 98.42 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 98.42 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 98.41 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 98.41 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 98.4 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 98.4 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 98.39 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.39 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.39 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 98.39 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 98.39 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 98.39 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 98.39 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 98.39 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.38 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 98.38 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 98.37 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 98.37 | |
| smart00533 | 308 | MUTSd DNA-binding domain of DNA mismatch repair MU | 98.36 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 98.35 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 98.35 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 98.35 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 98.34 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.34 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 98.34 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 98.33 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 98.32 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 98.32 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 98.32 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 98.32 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 98.32 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 98.31 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 98.31 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 98.3 | |
| KOG0064|consensus | 728 | 98.3 | ||
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 98.3 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 98.29 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 98.29 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 98.29 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 98.29 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 98.28 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 98.28 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.27 | |
| KOG0062|consensus | 582 | 98.26 | ||
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 98.25 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 98.23 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 98.23 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.22 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 98.21 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 98.2 | |
| KOG0057|consensus | 591 | 98.19 | ||
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 98.19 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 98.19 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 98.19 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 98.19 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 98.16 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 98.16 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 98.15 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 98.14 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 98.13 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 98.12 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 98.11 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 98.09 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 98.08 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 98.07 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 98.06 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 98.05 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 98.05 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 98.03 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 98.01 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 97.99 | |
| KOG0060|consensus | 659 | 97.99 | ||
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 97.99 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 97.98 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 97.98 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 97.98 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 97.98 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 97.97 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 97.97 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 97.96 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 97.96 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 97.96 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 97.96 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 97.96 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 97.95 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 97.95 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 97.93 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 97.93 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 97.92 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 97.89 | |
| KOG2355|consensus | 291 | 97.88 | ||
| KOG0062|consensus | 582 | 97.86 | ||
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 97.86 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 97.86 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 97.84 | |
| KOG0058|consensus | 716 | 97.84 | ||
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 97.82 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 97.82 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 97.81 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 97.8 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 97.8 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 97.79 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 97.79 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 97.78 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 97.77 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 97.76 | |
| KOG0056|consensus | 790 | 97.76 | ||
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 97.75 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 97.74 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 97.73 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 97.72 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 97.71 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 97.7 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 97.7 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 97.65 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 97.6 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 97.6 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 97.59 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 97.59 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 97.56 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 97.56 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 97.55 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 97.53 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 97.53 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 97.52 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 97.52 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 97.52 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 97.51 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 97.49 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 97.48 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 97.47 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 97.44 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 97.43 | |
| KOG0927|consensus | 614 | 97.43 | ||
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 97.41 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 97.4 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 97.38 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 97.38 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 97.35 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 97.31 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 97.29 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.24 | |
| KOG0055|consensus | 1228 | 97.11 | ||
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 97.07 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.07 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 97.07 | |
| KOG0061|consensus | 613 | 97.06 | ||
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 97.06 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 97.01 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 96.91 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 96.83 | |
| KOG0059|consensus | 885 | 96.81 | ||
| KOG0219|consensus | 902 | 96.81 | ||
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.73 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.73 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.73 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 96.69 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 96.68 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 96.67 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.66 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 96.66 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 96.65 | |
| KOG0055|consensus | 1228 | 96.65 | ||
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 96.63 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 96.59 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 96.58 | |
| KOG0054|consensus | 1381 | 96.56 | ||
| PF10240 | 251 | DUF2464: Protein of unknown function (DUF2464); In | 96.56 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 96.49 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 96.47 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 96.46 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 96.46 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.46 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 96.44 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 96.43 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.4 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 96.39 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.35 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 96.34 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 96.34 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 96.31 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 96.3 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 96.3 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.29 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 96.27 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.27 | |
| KOG0066|consensus | 807 | 96.25 | ||
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 96.23 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.23 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 96.22 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.22 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 96.2 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.2 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.2 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 96.13 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 96.13 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 96.1 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 96.09 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 96.07 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 96.04 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 96.01 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 96.01 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.99 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.95 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 95.93 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 95.93 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 95.87 | |
| KOG4000|consensus | 291 | 95.87 | ||
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 95.86 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 95.86 | |
| KOG0018|consensus | 1141 | 95.83 | ||
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.82 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 95.82 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 95.79 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.78 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 95.77 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 95.75 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 95.69 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 95.66 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 95.64 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 95.64 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 95.63 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.62 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 95.6 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 95.53 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 95.49 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 95.49 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 95.47 | |
| PTZ00202 | 550 | tuzin; Provisional | 95.46 | |
| KOG1970|consensus | 634 | 95.43 | ||
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.41 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 95.38 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.38 | |
| PRK06315 | 442 | type III secretion system ATPase; Provisional | 95.37 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 95.33 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 95.32 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 95.28 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 95.23 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 95.23 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 95.21 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 95.2 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 95.07 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 95.07 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 95.05 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 95.03 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 94.99 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 94.96 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 94.94 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 94.93 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 94.85 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 94.83 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.82 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 94.78 | |
| KOG0065|consensus | 1391 | 94.69 | ||
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 94.67 | |
| PRK06526 | 254 | transposase; Provisional | 94.66 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 94.65 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 94.59 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 94.58 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.57 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.55 |
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
Probab=99.95 E-value=7e-28 Score=235.36 Aligned_cols=167 Identities=21% Similarity=0.299 Sum_probs=137.3
Q ss_pred cccccceeeEeeccEEEEEeecccccCCCcEEEEeEEeccc-CCCCchhhHHHHhhhhhhhhhhhcc-ee-------e--
Q psy13262 45 ADMWRESAFFLRKTRYLCVSKTESLFQIDYIVENICIINEK-ETPPDGFCLIARTLDSDQGQICERG-GV-------V-- 113 (229)
Q Consensus 45 a~~~qe~~~~~rkgRyv~~vk~~~~~~~~giV~di~~l~~~-~~~P~~y~~l~~~~~s~qt~l~e~~-~~-------v-- 113 (229)
..+++|..++.+++||++|+|.++++.++|+|||.+..+.+ +..|.....+++..........++. .+ +
T Consensus 181 ~~~L~d~~it~r~~r~~i~vk~~~~~~~~g~v~~~s~sg~t~y~ep~~~~~ln~~l~~l~~~~~~~~~~il~~l~~~i~~ 260 (782)
T PRK00409 181 QKYLQDTIITIRNDRYVLPVKAEYKHAIKGIVHDQSSSGATLYIEPQSVVELNNEIRELRNKEEQEIERILKELSAKVAK 260 (782)
T ss_pred ccccccceEEEECCEEEEEechhhhccCCCceeeEECCCCEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 47789877777889999999999999999999999999988 8889988888886665443333321 00 0
Q ss_pred eecccccccchhhhhhHHHHHH----hCCCccceEecCCCCCceEEeccccCcccCCCceeeCCeeEecCccceeccCCC
Q psy13262 114 DYKPQQSNNTIFSQRNILKDMY----QQGVCVPTFLGLEEPHPYISALESLYPCATGDQTYIPNSTVIGRCKEDVESGGE 189 (229)
Q Consensus 114 ~l~~l~~~~~~~~~~d~l~~~~----~~~~~~P~~~~~~~~~~~i~~~~~~hpll~~~~~~vp~~~~l~~~~~~~~~~~~ 189 (229)
....+....+.++++|++.+++ .+++|+|.+.+. ..+.+.++|||++.. ..+||||+.+++
T Consensus 261 ~~~~l~~~~~~l~~lD~l~a~a~~a~~~~~~~P~~~~~----~~i~l~~~rHPll~~-~~~Vpndi~l~~---------- 325 (782)
T PRK00409 261 NLDFLKFLNKIFDELDFIFARARYAKALKATFPLFNDE----GKIDLRQARHPLLDG-EKVVPKDISLGF---------- 325 (782)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCccceEcCC----CcEEEcCcCCceecc-CceECceeEECC----------
Confidence 0134456788899999999865 688999999864 468899999999964 579999999986
Q ss_pred CCCCCcEEEEEeCCCCChHHHHHHHHHHHHHHhcCCCccC
Q psy13262 190 GNRKPTVLLLTGPNMGGKSTVMRQLGLITILAQMENPQLI 229 (229)
Q Consensus 190 ~~~~~~~~~ltGpN~~GKStlLk~i~l~~~ma~~G~~v~~ 229 (229)
+.++++|||||||||||+||++|++++|||+|+|||.
T Consensus 326 ---~~~~~iITGpN~gGKTt~lktigl~~~maq~G~~vpa 362 (782)
T PRK00409 326 ---DKTVLVITGPNTGGKTVTLKTLGLAALMAKSGLPIPA 362 (782)
T ss_pred ---CceEEEEECCCCCCcHHHHHHHHHHHHHHHhCCCccc
Confidence 4589999999999999999999999999999999983
|
|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >TIGR01070 mutS1 DNA mismatch repair protein MutS | Back alignment and domain information |
|---|
| >KOG4000|consensus | Back alignment and domain information |
|---|
| >PF10240 DUF2464: Protein of unknown function (DUF2464); InterPro: IPR018798 FAM125A and FAM125B (also known as Multivesicular body subunit 12) interacts with CD2AP and CIN85/SH3KBP1, and is thought to be involved in the ligand-mediated internalization and down-regulation of EGF receptor [] | Back alignment and domain information |
|---|
| >PRK05399 DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >COG0249 MutS Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1193 Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00488 MutS_V: MutS domain V C-terminus | Back alignment and domain information |
|---|
| >KOG0218|consensus | Back alignment and domain information |
|---|
| >KOG0219|consensus | Back alignment and domain information |
|---|
| >KOG0220|consensus | Back alignment and domain information |
|---|
| >KOG0217|consensus | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG0221|consensus | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0927|consensus | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >KOG0066|consensus | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >smart00533 MUTSd DNA-binding domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >KOG0064|consensus | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0062|consensus | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0057|consensus | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0060|consensus | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2355|consensus | Back alignment and domain information |
|---|
| >KOG0062|consensus | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0058|consensus | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0056|consensus | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0927|consensus | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0061|consensus | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >KOG0059|consensus | Back alignment and domain information |
|---|
| >KOG0219|consensus | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0055|consensus | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >PF10240 DUF2464: Protein of unknown function (DUF2464); InterPro: IPR018798 FAM125A and FAM125B (also known as Multivesicular body subunit 12) interacts with CD2AP and CIN85/SH3KBP1, and is thought to be involved in the ligand-mediated internalization and down-regulation of EGF receptor [] | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >KOG0066|consensus | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >KOG4000|consensus | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >KOG1970|consensus | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK06315 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >KOG0065|consensus | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 229 | ||||
| 2o8b_B | 1022 | Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M | 4e-12 | ||
| 3tow_A | 152 | Crystal Structure Of The Mabp Domain Of Mvb12b Of H | 5e-10 | ||
| 3thw_B | 918 | Human Mutsbeta Complexed With An Idl Of 4 Bases (Lo | 4e-06 | ||
| 1wbb_A | 800 | Crystal Structure Of E. Coli Dna Mismatch Repair En | 3e-04 | ||
| 3k0s_A | 799 | Crystal Structure Of E.Coli Dna Mismatch Repair Pro | 3e-04 | ||
| 1wbd_A | 800 | Crystal Structure Of E. Coli Dna Mismatch Repair En | 3e-04 | ||
| 1wb9_A | 800 | Crystal Structure Of E. Coli Dna Mismatch Repair En | 3e-04 | ||
| 1oh5_A | 800 | The Crystal Structure Of E. Coli Muts Binding To Dn | 3e-04 | ||
| 1ng9_A | 800 | E.Coli Muts R697a: An Atpase-Asymmetry Mutant Lengt | 3e-04 | ||
| 1nne_A | 765 | Crystal Structure Of The Muts-adpbef3-dna Complex L | 4e-04 | ||
| 2o8b_A | 934 | Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M | 5e-04 | ||
| 2o8e_A | 934 | Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, | 5e-04 |
| >pdb|2O8B|B Chain B, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 1022 | Back alignment and structure |
|
| >pdb|3TOW|A Chain A, Crystal Structure Of The Mabp Domain Of Mvb12b Of Human Escrt-I Complex Length = 152 | Back alignment and structure |
| >pdb|3THW|B Chain B, Human Mutsbeta Complexed With An Idl Of 4 Bases (Loop4) And Adp Length = 918 | Back alignment and structure |
| >pdb|1WBB|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38a Mutant, In Complex With A G.T Mismatch Length = 800 | Back alignment and structure |
| >pdb|3K0S|A Chain A, Crystal Structure Of E.Coli Dna Mismatch Repair Protein Muts, D693n Mutant, In Complex With Gt Mismatched Dna Length = 799 | Back alignment and structure |
| >pdb|1WBD|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38q Mutant, In Complex With A G.T Mismatch Length = 800 | Back alignment and structure |
| >pdb|1WB9|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38t Mutant, In Complex With A G.T Mismatch Length = 800 | Back alignment and structure |
| >pdb|1OH5|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A C:a Mismatch Length = 800 | Back alignment and structure |
| >pdb|1NG9|A Chain A, E.Coli Muts R697a: An Atpase-Asymmetry Mutant Length = 800 | Back alignment and structure |
| >pdb|1NNE|A Chain A, Crystal Structure Of The Muts-adpbef3-dna Complex Length = 765 | Back alignment and structure |
| >pdb|2O8B|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 934 | Back alignment and structure |
| >pdb|2O8E|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, WITH ADP BOUND TO Msh2 Only Length = 934 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 229 | |||
| 3tow_A | 152 | Multivesicular BODY subunit 12B; beta prism, membr | 9e-25 | |
| 3tow_A | 152 | Multivesicular BODY subunit 12B; beta prism, membr | 6e-05 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 5e-22 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 2e-16 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 6e-16 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 8e-16 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 3e-15 |
| >3tow_A Multivesicular BODY subunit 12B; beta prism, membrane binding domain, negatively charged MEMB protein transport; 1.34A {Homo sapiens} Length = 152 | Back alignment and structure |
|---|
Score = 94.8 bits (235), Expect = 9e-25
Identities = 30/91 (32%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
Query: 15 PITAIAVIEDIQKCPSGYTVISKTVDQDTDADMWRESAFFLRKTRYLCVSKTESL--FQI 72
PIT + V+ + P+GY V+++T D DAD+W++ F + TRYLC +++ S +
Sbjct: 3 PITGVGVVASRNRAPTGYDVVAQTAD-GVDADLWKDGLFKSKVTRYLCFTRSFSKENSHL 61
Query: 73 DYIVENICIINEKETPPDGFCLIARTLDSDQ 103
++ ++ +I+ K+T P GF I T+D+ +
Sbjct: 62 GNVLVDMKLIDIKDTLPVGFIPIQETVDTQE 92
|
| >3tow_A Multivesicular BODY subunit 12B; beta prism, membrane binding domain, negatively charged MEMB protein transport; 1.34A {Homo sapiens} Length = 152 | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Length = 1022 | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Length = 918 | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Length = 800 | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Length = 934 | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Length = 765 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| 3tow_A | 152 | Multivesicular BODY subunit 12B; beta prism, membr | 99.84 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 99.8 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 99.77 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 99.74 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 99.69 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 99.68 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 98.83 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 98.8 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 98.79 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 98.79 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 98.78 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 98.76 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 98.76 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 98.76 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 98.75 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 98.74 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 98.73 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 98.7 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 98.69 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 98.68 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 98.68 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 98.67 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 98.64 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 98.63 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 98.63 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 98.63 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 98.63 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 98.61 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 98.59 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 98.59 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 98.58 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 98.57 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 98.56 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 98.56 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 98.55 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 98.54 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 98.53 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 98.5 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 98.48 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 98.48 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 98.44 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 98.38 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 98.36 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 98.34 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 98.25 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 98.22 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.2 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.15 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 98.14 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 98.14 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 98.13 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 98.12 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 98.1 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 98.09 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 98.04 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 98.02 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 98.02 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 98.01 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 97.98 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.96 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 97.93 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.88 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.88 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 97.87 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.87 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 97.87 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 97.86 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.85 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 97.85 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.84 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 97.84 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.83 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 97.79 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 97.74 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 97.74 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.72 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.71 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.71 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.71 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.7 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 97.7 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.69 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 97.67 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 97.67 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 97.66 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 97.66 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 97.65 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.65 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.65 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 97.64 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.63 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 97.62 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.56 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.52 | |
| 3tow_A | 152 | Multivesicular BODY subunit 12B; beta prism, membr | 97.51 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 97.48 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.47 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 97.45 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 97.42 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 97.4 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.39 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 97.38 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 97.37 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 97.37 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 97.37 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.32 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 97.31 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.31 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.3 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 97.29 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 97.29 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.26 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.22 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 97.2 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 97.2 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.15 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 97.1 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.07 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.07 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 97.05 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.04 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.0 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.98 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.96 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 96.92 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 96.92 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.89 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.89 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 96.87 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.84 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 96.81 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 96.81 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 96.81 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 96.75 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.73 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.7 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 96.62 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.59 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.57 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.5 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.43 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 96.43 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.37 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.36 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.28 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 96.23 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.21 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.14 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.11 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.11 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 96.03 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 96.0 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.98 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.92 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.89 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 95.78 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.72 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.7 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 95.68 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.67 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 95.67 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 95.64 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 95.64 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 95.62 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 95.6 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 95.57 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.54 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 95.52 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 95.51 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 95.32 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 95.31 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 95.29 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 95.26 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 95.23 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.12 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 95.03 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 95.01 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 94.95 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 94.93 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 94.84 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 94.79 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 94.75 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 94.67 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 94.61 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 94.59 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 94.59 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 94.52 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 94.52 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 94.52 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 94.51 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 94.49 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 94.46 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 94.3 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 94.27 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 94.25 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 94.24 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 94.17 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 94.08 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 94.06 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 94.06 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 94.05 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 93.98 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 93.91 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 93.89 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 93.88 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 93.82 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 93.74 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 93.72 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 93.7 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 93.63 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 93.56 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 93.55 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 93.55 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.54 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 93.51 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 93.5 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 93.47 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 93.45 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 93.42 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 93.39 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 93.36 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 93.34 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 93.2 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 93.17 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 93.15 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 93.09 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 93.08 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 93.07 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 93.04 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 93.0 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 92.88 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 92.88 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 92.86 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 92.78 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 92.72 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 92.7 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 92.69 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 92.65 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 92.46 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 92.45 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 92.43 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 92.39 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 92.38 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 92.33 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 92.29 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 92.25 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 92.21 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 92.21 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 92.14 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 92.11 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 92.05 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 91.98 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 91.97 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 91.94 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 91.88 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 91.83 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 91.82 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 91.71 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 91.64 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 91.64 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 91.64 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 91.64 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 91.62 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 91.62 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 91.57 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 91.54 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 91.38 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 91.27 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 91.23 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 91.19 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 91.16 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 91.08 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 91.06 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 90.98 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 90.93 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 90.92 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 90.83 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 90.74 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 90.61 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 90.47 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 90.36 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 90.29 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 90.25 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 90.22 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 90.21 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 90.2 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 90.17 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 90.09 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 90.08 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 90.07 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 89.81 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 89.78 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 89.78 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 89.7 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 89.6 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 89.59 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 89.56 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 89.54 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 89.51 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 89.45 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 89.18 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 89.18 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 89.15 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 89.13 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 88.95 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 88.82 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 88.39 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 88.35 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 88.33 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 88.2 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 87.69 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 87.48 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 87.61 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 87.53 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 87.23 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 87.07 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 86.98 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 86.79 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 86.17 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 85.99 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 85.86 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 85.82 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 85.61 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 85.49 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 85.33 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 85.27 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 84.82 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 84.82 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 84.75 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 84.68 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 84.66 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 84.61 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 84.04 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 83.71 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 83.66 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 83.5 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 83.47 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 83.32 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 83.14 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 82.72 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 82.45 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 82.28 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 82.27 | |
| 3fgn_A | 251 | Dethiobiotin synthetase; biotin biosynthesis, BIOD | 81.96 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 81.85 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 81.23 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 80.46 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 80.09 |
| >3tow_A Multivesicular BODY subunit 12B; beta prism, membrane binding domain, negatively charged MEMB protein transport; 1.34A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.84 E-value=5.3e-22 Score=156.09 Aligned_cols=111 Identities=30% Similarity=0.621 Sum_probs=97.2
Q ss_pred CCeeeEEEeecCCCCCCCeEEEEeeecCccccccccceeeEeec-cEEEEEeeccc--ccCCCcEEEEeEEecccCCCCc
Q psy13262 14 KPITAIAVIEDIQKCPSGYTVISKTVDQDTDADMWRESAFFLRK-TRYLCVSKTES--LFQIDYIVENICIINEKETPPD 90 (229)
Q Consensus 14 ~~~t~~~~~~~~~~~p~g~~~is~t~~~d~~a~~~qe~~~~~rk-gRyv~~vk~~~--~~~~~giV~di~~l~~~~~~P~ 90 (229)
+|||+|+||++.++||+||++|++|+|| .+|+||++ .+|.+| +||||..|... ....+.+|+|+.++++++.+|.
T Consensus 2 ~PIT~v~vv~~~~~~P~gy~~Is~T~dG-~dAdLw~~-~lF~~k~~rYLC~sr~~~~~~~~~~~VvtDl~vi~~Kd~lP~ 79 (152)
T 3tow_A 2 DPITGVGVVASRNRAPTGYDVVAQTADG-VDADLWKD-GLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPV 79 (152)
T ss_dssp CCCCEEEEESSTTCCCTTCEECCBCTTS-CBCCCSCC-CTTSCCCCCEEEEECCCCSTTGGGCEEEEEEEEEETTSCCCT
T ss_pred CCccEEEEEecCCCCCCCCeEEEecCCC-Cchhhccc-cccccCCeEEEEEecCCcccccCCCCeEEEEEEEeCCCCCCC
Confidence 7999999999999999999999999998 99999998 566556 99999998653 2345799999999999999999
Q ss_pred hhhHHHHhhhhhhhhhhhcceeeeecccccccchhh
Q psy13262 91 GFCLIARTLDSDQGQICERGGVVDYKPQQSNNTIFS 126 (229)
Q Consensus 91 ~y~~l~~~~~s~qt~l~e~~~~v~l~~l~~~~~~~~ 126 (229)
||+.+.++.++++++++++..++++.++.+...+..
T Consensus 80 Gf~~I~~T~dt~~~a~rKkrLCvK~~p~~s~~~AVt 115 (152)
T 3tow_A 80 GFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAIC 115 (152)
T ss_dssp TCEECCBCTTTCCBCCSSEEEEEEEEEGGGCSCEEE
T ss_pred CcEEeeccCCcchhhhceeEEEEEEccCCccceeEE
Confidence 999999999999999999999998877665544333
|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3tow_A Multivesicular BODY subunit 12B; beta prism, membrane binding domain, negatively charged MEMB protein transport; 1.34A {Homo sapiens} | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >3fgn_A Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP-BIND ligase, magnesium, nucleotide-binding; 1.85A {Mycobacterium tuberculosis} PDB: 3fmf_A* 3fmi_A* 3fpa_A* | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 229 | ||||
| d1ewqa2 | 224 | c.37.1.12 (A:542-765) DNA repair protein MutS, the | 2e-04 |
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Length = 224 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: DNA repair protein MutS, the C-terminal domain species: Thermus aquaticus [TaxId: 271]
Score = 39.4 bits (91), Expect = 2e-04
Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 15/63 (23%)
Query: 161 YPCATGDQTYIPNSTVIGRCKEDVESGGEGNRKPTVLLLTGPNMGGKSTVMRQLGLITIL 220
+P ++PN + ++L+TGPNM GKST +RQ LI +L
Sbjct: 17 HPVVERRTEFVPNDLEMA---------------HELVLITGPNMAGKSTFLRQTALIALL 61
Query: 221 AQM 223
AQ+
Sbjct: 62 AQV 64
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 99.84 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 99.83 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 98.81 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 98.79 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 98.78 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 98.75 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 98.75 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 98.74 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 98.71 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 98.67 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 98.66 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 98.63 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 98.63 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 98.6 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 98.58 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 98.56 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 98.51 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 98.5 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 98.43 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 98.43 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 98.38 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 97.43 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 96.96 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.4 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.32 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.14 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.06 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 95.91 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.9 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.65 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.64 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 95.62 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.54 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 95.49 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.47 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.26 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 95.22 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 95.15 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.03 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.85 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 94.78 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.61 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.52 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 94.47 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 94.41 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.05 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 93.98 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 93.89 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 93.62 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 93.36 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 93.28 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 93.16 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.12 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 92.91 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 92.86 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 92.71 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 92.55 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 92.52 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 91.76 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 91.56 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 91.08 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 90.96 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 90.5 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 90.05 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 89.73 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 89.27 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 88.84 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 88.7 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 88.44 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 88.08 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 86.48 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 84.96 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 84.54 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 83.79 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 83.75 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 83.21 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 83.11 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 83.02 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 82.05 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 81.95 |
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: DNA repair protein MutS, the C-terminal domain species: Escherichia coli [TaxId: 562]
Probab=99.84 E-value=1.5e-21 Score=163.36 Aligned_cols=73 Identities=36% Similarity=0.543 Sum_probs=65.4
Q ss_pred CccceEecCCCCCceEEeccccCcccC--CCceeeCCeeEecCccceeccCCCCCCCCcEEEEEeCCCCChHHHHHHHHH
Q psy13262 139 VCVPTFLGLEEPHPYISALESLYPCAT--GDQTYIPNSTVIGRCKEDVESGGEGNRKPTVLLLTGPNMGGKSTVMRQLGL 216 (229)
Q Consensus 139 ~~~P~~~~~~~~~~~i~~~~~~hpll~--~~~~~vp~~~~l~~~~~~~~~~~~~~~~~~~~~ltGpN~~GKStlLk~i~l 216 (229)
||+|++.++ +.++++++|||++. ....+||||+.+++ +.+.++|||||||||||+||++||
T Consensus 1 y~~P~~~~~----~~l~i~~~rHPlle~~~~~~~VpNdi~l~~-------------~~~~~iiTGpN~~GKSt~lk~i~l 63 (234)
T d1wb9a2 1 YTCPTFIDK----PGIRITEGRHPVVEQVLNEPFIANPLNLSP-------------QRRMLIITGPNMGGKSTYMRQTAL 63 (234)
T ss_dssp CBCCEECSS----SCEEEEEECCTTHHHHCSSCCCCEEEEECS-------------SSCEEEEECCTTSSHHHHHHHHHH
T ss_pred CCCCEEcCC----CcEEEEEeECCEEEcccCCCccceeEEECC-------------CceEEEEeccCchhhHHHHHHHHH
Confidence 689999874 67999999999984 23579999999986 458999999999999999999999
Q ss_pred HHHHHhcCCCcc
Q psy13262 217 ITILAQMENPQL 228 (229)
Q Consensus 217 ~~~ma~~G~~v~ 228 (229)
+++|||+|+|||
T Consensus 64 ~~~laq~G~~Vp 75 (234)
T d1wb9a2 64 IALMAYIGSYVP 75 (234)
T ss_dssp HHHHHTTTCCBS
T ss_pred HHHHHHcCCeEe
Confidence 999999999998
|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|