Psyllid ID: psy3787


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MLSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKINNMENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLFHLKSLFLGGNPIKTVRNDILQDSKRIISHIKTSRLDYHCQNVDGGGMSSQESTSEINIDKYKLDRTKTLTLCKVINIPESVYMRGMSSQECTIEINIDKYKLDRTKTLTLCKVINIPESVYMNRPFALTYNYVGDFFHFCLIKE
ccccccEEEccccccccccHHHHHccccccEEccccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHccccccccEEEccccccccccHHHHHcccHHHHccccccccccccccccccccccccccEEEcccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccc
ccccccEEEcccccccccccHHHHHcccccEEEccccccccccHHcccccccEEEccccccccccHHHHHHHccccEEEccccccccccHHHHcHHcccEEEccccccccccHHHHHHHcccEEEccccccccccHHHHccccccEEEccccccccccHHcccccHHHHHcHcEEEcccccccccccccHHHHHHHHHHHHHcccccccccccHHHHccccccEEEccccccccccHHHHHccccHEEEEccccccEEEEEcc
mlshlktldlshnklvsdslplfidmRSLTELNLsynqltmlpvctdcknlthLLLGFNkinnmendYFLTLTKLSLLNlknnkisevssnvgDLINLAildlsdneltdvpcelsslfhlkslflggnpiktvrNDILQDSKRIISHIKTsrldyhcqnvdgggmssqestseinidkykldrtktltlckvinipesvymrgmssqectieinidkykldrtktltlckvinipesvymnrpfaltynyvgdFFHFCLIKE
mlshlktldlshnklvsdslpLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKINNMENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLFHLKSLFLGGNPIKTVRNDILQDSKRIISHIKTSRLDYHCQNVDgggmssqestseinidkykldrtktltlckvinipesvymrgmssQECTIEInidkykldrtKTLTLCKVinipesvymNRPFALTYNYVGDFFHFCLIKE
MLSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKINNMENDYFltltklsllnlknnkISEVSSNVGDLINLAILDLSDNELTDVPCElsslfhlkslflGGNPIKTVRNDILQDSKRIISHIKTSRLDYHCQNVDGGGMSSQESTSEINIDKYKLDRTKTLTLCKVINIPESVYMRGMSSQECTIEINIDKYKLDRTKTLTLCKVINIPESVYMNRPFALTYNYVGDFFHFCLIKE
************NKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKINNMENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLFHLKSLFLGGNPIKTVRNDILQDSKRIISHIKTSRLDYHCQNV*************INIDKYKLDRTKTLTLCKVINIPESVYMRGMSSQECTIEINIDKYKLDRTKTLTLCKVINIPESVYMNRPFALTYNYVGDFFHFCLI**
MLSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKINNMENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLFHLKSLFLGGNPIKTVRNDILQDSKRIISHIKTSRLDYHCQNVDGGGMSSQESTSEINIDKYKLDRTKTLTLCKVINIPESVYMRGMSSQECTIEINIDKYKLDRTKTLTLCKVINIPESVYMNRPFALTYNYVGDFFHFCLIKE
MLSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKINNMENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLFHLKSLFLGGNPIKTVRNDILQDSKRIISHIKTSRLDYHCQNVDG**********EINIDKYKLDRTKTLTLCKVINIPESVYMRGMSSQECTIEINIDKYKLDRTKTLTLCKVINIPESVYMNRPFALTYNYVGDFFHFCLIKE
*LSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKINNMENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLFHLKSLFLGGNPIKTVRNDILQDSKRIISHIKTSRLDYHCQNVDGGGMSSQESTSEINIDKYKLDRTKTLTLCKVINIPESVYMRGMSSQECTIEINIDKYKLDRTKTLTLCKVINIPESVYMNRPFALTYNYVGDFFHFCLIKE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKINNMENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLFHLKSLFLGGNPIKTVRNDILQDSKRIISHIKTSRLDYHCQNVDGGGMSSQESTSEINIDKYKLDRTKTLTLCKVINIPESVYMRGMSSQECTIEINIDKYKLDRTKTLTLCKVINIPESVYMNRPFALTYNYVGDFFHFCLIKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query263 2.2.26 [Sep-21-2011]
Q7SXW3 601 Leucine-rich repeat-conta yes N/A 0.737 0.322 0.307 7e-19
Q5M8G4 605 Leucine-rich repeat-conta yes N/A 0.752 0.327 0.325 3e-16
Q6GPJ5 605 Leucine-rich repeat-conta N/A N/A 0.851 0.370 0.305 1e-15
Q5ZLN0 603 Leucine-rich repeat-conta yes N/A 0.752 0.328 0.308 7e-14
Q9CRC8 602 Leucine-rich repeat-conta yes N/A 0.703 0.307 0.297 1e-13
Q9H9A6 602 Leucine-rich repeat-conta yes N/A 0.623 0.272 0.341 8e-13
Q4R3P6 602 Leucine-rich repeat-conta N/A N/A 0.623 0.272 0.329 9e-13
Q5RFE9 602 Leucine-rich repeat-conta yes N/A 0.623 0.272 0.329 1e-12
Q5R6B1 522 Leucine-rich repeat trans no N/A 0.570 0.287 0.299 1e-11
Q86UE6 522 Leucine-rich repeat trans no N/A 0.570 0.287 0.292 4e-11
>sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 111/208 (53%), Gaps = 14/208 (6%)

Query: 2   LSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKI 61
           + +L+ LD S N++ S   P+   M SL +L L +N+L  LP    CK L  L  G N+I
Sbjct: 217 MKNLRMLDCSRNQMESIP-PVLAQMESLEQLYLRHNKLRYLPELPCCKTLKELHCGNNQI 275

Query: 62  NNMENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLFHL 121
             +E ++   L  LSLL L++NK+  +   +  L  L  LDL++N+++ +PC L +L  L
Sbjct: 276 EVLEAEHLKHLNALSLLELRDNKVKSLPEEITLLQGLERLDLTNNDISSLPCGLGTLPKL 335

Query: 122 KSLFLGGNPIKTVRNDIL-QDSKRIISHIKTSRLDYHCQNVDGGGMSSQEST-------S 173
           KSL L GNP++ +R D+L + +  ++ ++++       Q    GG+  +  T       +
Sbjct: 336 KSLSLEGNPLRAIRRDLLTKGTGELLKYLRS-----RVQEPPNGGLKEEPKTAMTFPSQA 390

Query: 174 EINIDKYKLDRTKTLTLCKVINIPESVY 201
           +IN+   K  +T   +  +   IP+ V+
Sbjct: 391 KINVHAIKTLKTLDYSEKQDATIPDDVF 418





Danio rerio (taxid: 7955)
>sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=2 SV=2 Back     alignment and function description
>sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 Back     alignment and function description
>sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 Back     alignment and function description
>sp|Q5R6B1|LRRT1_PONAB Leucine-rich repeat transmembrane neuronal protein 1 OS=Pongo abelii GN=LRRTM1 PE=2 SV=1 Back     alignment and function description
>sp|Q86UE6|LRRT1_HUMAN Leucine-rich repeat transmembrane neuronal protein 1 OS=Homo sapiens GN=LRRTM1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
242005578 595 leucine-rich repeat-containing protein, 0.855 0.378 0.327 2e-21
170029739 612 leucine-rich repeat-containing protein 4 0.779 0.334 0.318 2e-17
158286480 626 AGAP006993-PA [Anopheles gambiae str. PE 0.813 0.341 0.303 2e-17
82240198 601 RecName: Full=Leucine-rich repeat-contai 0.737 0.322 0.307 4e-17
41282208 601 leucine-rich repeat-containing protein 4 0.733 0.321 0.314 4e-17
405971281 606 Leucine-rich repeat-containing protein 4 0.821 0.356 0.277 7e-17
443730785 610 hypothetical protein CAPTEDRAFT_182426 [ 0.775 0.334 0.302 4e-16
270015218 621 hypothetical protein TcasGA2_TC008530 [T 0.745 0.315 0.305 4e-16
326428302 535 leucine rich repeat containing protein 4 0.718 0.353 0.314 4e-16
427794931 601 Putative mitotic protein, partial [Rhipi 0.794 0.347 0.315 4e-16
>gi|242005578|ref|XP_002423641.1| leucine-rich repeat-containing protein, putative [Pediculus humanus corporis] gi|212506801|gb|EEB10903.1| leucine-rich repeat-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  108 bits (271), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 128/235 (54%), Gaps = 10/235 (4%)

Query: 5   LKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKINNM 64
           L+ L+LS+NK+ S  LP   DM+ L  + L +N+LT LP    C  L  + LGFN I  +
Sbjct: 219 LRDLNLSNNKITSSGLPDLFDMKKLEMIQLQHNKLTSLPCLRGCSELKEIHLGFNMIEEI 278

Query: 65  ENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLFHLKSL 124
             +   TL+ L ++NL+NN + E+   +   +NL  LDLS+N+L ++P  LS L HL+ L
Sbjct: 279 TVEELSTLSHLKVINLRNNHLKELPKEISCFLNLVRLDLSNNDLMELPNTLSILPHLEIL 338

Query: 125 FLGGNPIKTVRNDILQ-DSKRIISHIKTSRLDYHCQNVDGGGMSSQESTSEINIDKYKLD 183
            + GN ++++R DI+   + R+++H+K   L       +    S      E   D+Y + 
Sbjct: 339 LVEGNSLRSIRKDIIHGGTHRLLNHLK---LTMPLAEAEKYLQSQYPCEKEEFPDRYAMR 395

Query: 184 RTKTLTLC--KVINIPESVYMRGMSSQECTIEINIDKYKLDR--TKTLTLCKVIN 234
            +K L L    + N+ ++V+   ++   CTI +++ K KL    + T  LCK +N
Sbjct: 396 CSKALNLSNKSLCNVSKAVFEEALAVP-CTI-VDLSKNKLLEIPSGTWLLCKTLN 448




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170029739|ref|XP_001842749.1| leucine-rich repeat-containing protein 40 [Culex quinquefasciatus] gi|167864068|gb|EDS27451.1| leucine-rich repeat-containing protein 40 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158286480|ref|XP_308777.4| AGAP006993-PA [Anopheles gambiae str. PEST] gi|157020488|gb|EAA04662.4| AGAP006993-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|82240198|sp|Q7SXW3.1|LRC40_DANRE RecName: Full=Leucine-rich repeat-containing protein 40 gi|32766407|gb|AAH55223.1| Leucine rich repeat containing 40 [Danio rerio] Back     alignment and taxonomy information
>gi|41282208|ref|NP_956156.2| leucine-rich repeat-containing protein 40 [Danio rerio] gi|37595350|gb|AAQ94561.1| hypothetical protein FLJ20331 [Danio rerio] Back     alignment and taxonomy information
>gi|405971281|gb|EKC36127.1| Leucine-rich repeat-containing protein 40 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|443730785|gb|ELU16143.1| hypothetical protein CAPTEDRAFT_182426 [Capitella teleta] Back     alignment and taxonomy information
>gi|270015218|gb|EFA11666.1| hypothetical protein TcasGA2_TC008530 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|326428302|gb|EGD73872.1| leucine rich repeat containing protein 40 [Salpingoeca sp. ATCC 50818] Back     alignment and taxonomy information
>gi|427794931|gb|JAA62917.1| Putative mitotic protein, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query263
ZFIN|ZDB-GENE-030131-6062 601 lrrc40 "leucine rich repeat co 0.927 0.405 0.233 1.4e-12
MGI|MGI:1914394 602 Lrrc40 "leucine rich repeat co 0.950 0.415 0.213 1.1e-07
FB|FBgn0038504 641 Sur-8 "Sur-8" [Drosophila mela 0.403 0.165 0.353 1.3e-07
ZFIN|ZDB-GENE-060503-289 575 lrrc47 "leucine rich repeat co 0.631 0.288 0.290 4.3e-07
WB|WBGene00002632 699 let-413 [Caenorhabditis elegan 0.741 0.278 0.260 2.2e-06
UNIPROTKB|O61967 699 let-413 "Protein lap1" [Caenor 0.741 0.278 0.260 2.2e-06
UNIPROTKB|E1BX56 521 LRRTM1 "Uncharacterized protei 0.882 0.445 0.238 2.6e-06
FB|FBgn0028487 693 f-cup "flyers-cup" [Drosophila 0.657 0.249 0.268 2.6e-06
TAIR|locus:2120825383 PIRL8 "AT4G26050" [Arabidopsis 0.688 0.472 0.302 2.6e-06
ZFIN|ZDB-GENE-040718-372238 lrrc57 "leucine rich repeat co 0.566 0.626 0.268 3.2e-06
ZFIN|ZDB-GENE-030131-6062 lrrc40 "leucine rich repeat containing 40" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 1.4e-12, P = 1.4e-12
 Identities = 62/265 (23%), Positives = 115/265 (43%)

Query:     2 LSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKI 61
             + +L+ LD S N++ S   P+   M SL +L L +N+L  LP    CK L  L  G N+I
Sbjct:   217 MKNLRMLDCSRNQMESIP-PVLAQMESLEQLYLRHNKLRYLPELPCCKTLKELHCGNNQI 275

Query:    62 NNMENDYFXXXXXXXXXXXXXXXISEVSSNVGDLINLAILDLSDNELTDVPCEXXXXXXX 121
               +E ++                +  +   +  L  L  LDL++N+++ +PC        
Sbjct:   276 EVLEAEHLKHLNALSLLELRDNKVKSLPEEITLLQGLERLDLTNNDISSLPCGLGTLPKL 335

Query:   122 XXXXXGGNPIKTVRNDIL-QDSKRIISHIKTSRLDYHCQNVDGGGMSSQEST-----SEI 175
                   GNP++ +R D+L + +  ++ +++ SR+    Q    GG+  +  T     S+ 
Sbjct:   336 KSLSLEGNPLRAIRRDLLTKGTGELLKYLR-SRV----QEPPNGGLKEEPKTAMTFPSQA 390

Query:   176 NIDKYKLDRTKTLTLCKV--INIPESVYMRGMSSQECTIEINIDKYKLDRTKTLTLCKVI 233
              I+ + +   KTL   +     IP+ V+            +N  K +L    T    +++
Sbjct:   391 KINVHAIKTLKTLDYSEKQDATIPDDVF--DAVDGNPVANVNFSKNQL----TAVPHRIV 444

Query:   234 NIPESVY-MNRPFALTYNYVGDFFH 257
             ++ +S+  +N  F        DF H
Sbjct:   445 DLKDSLADINLGFNKLTTIPADFCH 469




GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
MGI|MGI:1914394 Lrrc40 "leucine rich repeat containing 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0038504 Sur-8 "Sur-8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-289 lrrc47 "leucine rich repeat containing 47" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00002632 let-413 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O61967 let-413 "Protein lap1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E1BX56 LRRTM1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0028487 f-cup "flyers-cup" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2120825 PIRL8 "AT4G26050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-372 lrrc57 "leucine rich repeat containing 57" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
 Score = 58.4 bits (141), Expect = 8e-10
 Identities = 57/192 (29%), Positives = 100/192 (52%), Gaps = 3/192 (1%)

Query: 1   MLSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLP-VCTDCKNLTHLLLGFN 59
           + S+LK LDLS NK+ S   PL  ++ +L  L+LS+N L+ LP + ++  NL +L L  N
Sbjct: 138 LKSNLKELDLSDNKIESLPSPLR-NLPNLKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGN 196

Query: 60  KINNMENDYFLTLTKLSLLNLKNNKISEVSSNVGDLINLAILDLSDNELTDVPCELSSLF 119
           KI+++  +  L L+ L  L+L NN I E+ S++ +L NL+ L+LS+N+L D+P  + +L 
Sbjct: 197 KISDLPPEIEL-LSALEELDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLS 255

Query: 120 HLKSLFLGGNPIKTVRNDILQDSKRIISHIKTSRLDYHCQNVDGGGMSSQESTSEINIDK 179
           +L++L L  N I ++ +     + R +     S  +          +        + +  
Sbjct: 256 NLETLDLSNNQISSISSLGSLTNLRELDLSGNSLSNALPLIALLLLLLELLLNLLLTLKA 315

Query: 180 YKLDRTKTLTLC 191
            +L     L   
Sbjct: 316 LELKLNSILLNN 327


Length = 394

>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 263
KOG4194|consensus 873 99.86
KOG0472|consensus 565 99.83
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.83
KOG4194|consensus 873 99.82
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.8
KOG0444|consensus 1255 99.78
KOG0444|consensus 1255 99.77
KOG0472|consensus 565 99.72
KOG0617|consensus264 99.71
KOG0617|consensus264 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
KOG0618|consensus 1081 99.59
KOG4237|consensus 498 99.54
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.52
KOG0618|consensus 1081 99.52
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.5
KOG4237|consensus 498 99.46
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.43
KOG0532|consensus 722 99.34
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.34
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.33
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.31
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.3
KOG0532|consensus 722 99.24
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.22
KOG1259|consensus490 99.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
KOG1259|consensus490 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.86
KOG0531|consensus 414 98.83
KOG3207|consensus 505 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
KOG1909|consensus382 98.77
KOG3207|consensus 505 98.74
KOG0531|consensus414 98.69
KOG4579|consensus177 98.66
PLN03150623 hypothetical protein; Provisional 98.61
KOG1859|consensus 1096 98.58
PLN03150623 hypothetical protein; Provisional 98.54
KOG1909|consensus382 98.52
KOG1644|consensus233 98.45
KOG1859|consensus 1096 98.42
KOG4658|consensus 889 98.34
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.29
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.26
KOG4658|consensus 889 98.23
KOG4579|consensus177 98.22
KOG1644|consensus233 98.1
KOG2982|consensus418 97.91
KOG3665|consensus 699 97.86
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.67
KOG2120|consensus419 97.64
KOG3665|consensus 699 97.63
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.61
KOG2120|consensus419 97.48
KOG2982|consensus 418 97.46
PRK15386 426 type III secretion protein GogB; Provisional 97.41
PRK15386 426 type III secretion protein GogB; Provisional 97.34
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.29
KOG2739|consensus260 97.2
KOG2123|consensus 388 97.16
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.12
KOG2123|consensus 388 96.74
KOG2739|consensus260 96.02
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.67
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.54
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.01
smart0037026 LRR Leucine-rich repeats, outliers. 95.01
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.17
smart0037026 LRR Leucine-rich repeats, outliers. 94.17
KOG4308|consensus 478 93.16
KOG0473|consensus326 92.81
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.5
KOG4341|consensus483 86.74
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 85.68
KOG4308|consensus478 83.53
KOG0473|consensus326 82.08
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.7
>KOG4194|consensus Back     alignment and domain information
Probab=99.86  E-value=1.2e-22  Score=175.38  Aligned_cols=223  Identities=21%  Similarity=0.224  Sum_probs=142.0

Q ss_pred             CCCEEEeecCccCCCCccccCCCCCCcEEEecCCCCCCCc--------------------------CCCCCCCCcEEEec
Q psy3787           4 HLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLP--------------------------VCTDCKNLTHLLLG   57 (263)
Q Consensus         4 ~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~l~~l~--------------------------~~~~~~~L~~L~l~   57 (263)
                      +++.|+|++|+++......|..+.+|..|.|+.|.++.+|                          .|..+++|+.+.+.
T Consensus       174 ni~~L~La~N~It~l~~~~F~~lnsL~tlkLsrNrittLp~r~Fk~L~~L~~LdLnrN~irive~ltFqgL~Sl~nlklq  253 (873)
T KOG4194|consen  174 NIKKLNLASNRITTLETGHFDSLNSLLTLKLSRNRITTLPQRSFKRLPKLESLDLNRNRIRIVEGLTFQGLPSLQNLKLQ  253 (873)
T ss_pred             CceEEeeccccccccccccccccchheeeecccCcccccCHHHhhhcchhhhhhccccceeeehhhhhcCchhhhhhhhh
Confidence            4555555555555543334555555555555555555444                          24444555555555


Q ss_pred             CCCCCCCchhhhhCCCCccEEEeecCcCccccc-cccCCCCcCEEEccCCcCCCc-cccccCCCcccEEEecCCCCCCcc
Q psy3787          58 FNKINNMENDYFLTLTKLSLLNLKNNKISEVSS-NVGDLINLAILDLSDNELTDV-PCELSSLFHLKSLFLGGNPIKTVR  135 (263)
Q Consensus        58 ~n~~~~~~~~~~~~l~~L~~L~l~~~~l~~lp~-~~~~l~~L~~L~l~~n~l~~l-~~~~~~l~~L~~L~l~~n~l~~~~  135 (263)
                      +|.+.....++|.++.++++|++..|++..+-+ ++..+++|++|+++.|.|.++ +..|.-+++|+.|+++.|+|+.++
T Consensus       254 rN~I~kL~DG~Fy~l~kme~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~rih~d~WsftqkL~~LdLs~N~i~~l~  333 (873)
T KOG4194|consen  254 RNDISKLDDGAFYGLEKMEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQRIHIDSWSFTQKLKELDLSSNRITRLD  333 (873)
T ss_pred             hcCcccccCcceeeecccceeecccchhhhhhcccccccchhhhhccchhhhheeecchhhhcccceeEeccccccccCC
Confidence            555555555666677777777777777776643 457788889999999988877 556888889999999999999998


Q ss_pred             hHHHHhHHHHhhhhhCCCCcccccccCCCCCCCcCCcccccc-cccccCCcceeccc--cccccChhHHhhcCCccceeE
Q psy3787         136 NDILQDSKRIISHIKTSRLDYHCQNVDGGGMSSQESTSEINI-DKYKLDRTKTLTLC--KVINIPESVYMRGMSSQECTI  212 (263)
Q Consensus       136 ~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~L~~L~l~--~~~~l~~~~~~~~~~~~~L~~  212 (263)
                      ++.+... +.|+.|.++.+.+                ..+.. .+.++++|+.||++  .+...-++......++++|+.
T Consensus       334 ~~sf~~L-~~Le~LnLs~Nsi----------------~~l~e~af~~lssL~~LdLr~N~ls~~IEDaa~~f~gl~~Lrk  396 (873)
T KOG4194|consen  334 EGSFRVL-SQLEELNLSHNSI----------------DHLAEGAFVGLSSLHKLDLRSNELSWCIEDAAVAFNGLPSLRK  396 (873)
T ss_pred             hhHHHHH-HHhhhhcccccch----------------HHHHhhHHHHhhhhhhhcCcCCeEEEEEecchhhhccchhhhh
Confidence            8877664 5667777766663                22221 25566677777776  443322233333334556776


Q ss_pred             EEeccCCcccccCccccccccccccccccCCc
Q psy3787         213 EINIDKYKLDRTKTLTLCKVINIPESVYMNRP  244 (263)
Q Consensus       213 ~L~ls~n~l~~ip~~~~~~~~~l~~~~~~~~~  244 (263)
                       |++.||+|..||..++.++.++..+.+.+|+
T Consensus       397 -L~l~gNqlk~I~krAfsgl~~LE~LdL~~Na  427 (873)
T KOG4194|consen  397 -LRLTGNQLKSIPKRAFSGLEALEHLDLGDNA  427 (873)
T ss_pred             -eeecCceeeecchhhhccCcccceecCCCCc
Confidence             7777777777776666666666666666665



>KOG0472|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-04
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-04
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure

Iteration: 1

Score = 43.5 bits (101), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 35/114 (30%), Positives = 52/114 (45%), Gaps = 3/114 (2%) Query: 2 LSHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLP--VCTDCKNLTHLLLGFN 59 L+ L L+L +N+L + S +F D+ L L L+ NQL LP V L L LG N Sbjct: 58 LTKLTWLNLDYNQLQTLSAGVFDDLTELGTLGLANNQLASLPLGVFDHLTQLDKLYLGGN 117 Query: 60 KINNMENDYFXXXXXXXXXXXXXXXISEVSSNVGD-LINLAILDLSDNELTDVP 112 ++ ++ + F + + + D L NL L LS N+L VP Sbjct: 118 QLKSLPSGVFDRLTKLKELRLNTNQLQSIPAGAFDKLTNLQTLSLSTNQLQSVP 171
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query263
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 9e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-27
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-26
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-21
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-23
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-22
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-23
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-22
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-20
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-13
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-22
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-22
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-21
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-15
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-17
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-19
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-20
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-18
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-18
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-17
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-17
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-15
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-16
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-14
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-13
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-13
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-13
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-04
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
 Score =  108 bits (271), Expect = 6e-28
 Identities = 36/139 (25%), Positives = 67/139 (48%), Gaps = 4/139 (2%)

Query: 2   LSHLKTLDLSHNKLVSDSLP--LFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFN 59
           L+ +  ++L  N L S  +    F  M+ L+ + ++   +T +P      +LT L L  N
Sbjct: 144 LNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGL-PPSLTELHLDGN 202

Query: 60  KINNMENDYFLTLTKLSLLNLKNNKISEVSSNV-GDLINLAILDLSDNELTDVPCELSSL 118
           KI  ++      L  L+ L L  N IS V +    +  +L  L L++N+L  VP  L+  
Sbjct: 203 KITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADH 262

Query: 119 FHLKSLFLGGNPIKTVRND 137
            +++ ++L  N I  + ++
Sbjct: 263 KYIQVVYLHNNNISAIGSN 281


>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.87
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.87
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.86
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.85
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.85
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.83
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.83
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.81
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.8
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.78
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.78
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.73
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.71
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.71
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.65
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.47
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.47
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.45
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.22
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.22
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.17
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.17
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.15
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.15
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.02
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.25
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.09
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.05
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.86
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.69
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.51
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.25
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.24
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.87
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.8
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.92  E-value=6.2e-24  Score=179.81  Aligned_cols=211  Identities=17%  Similarity=0.182  Sum_probs=174.6

Q ss_pred             CCCCCEEEeecCccCCCCccc-cCCCCCCcEEEecCCCCCCCcC-CCCCCCCcEEEecCCCCCCCchhhhhCCCCccEEE
Q psy3787           2 LSHLKTLDLSHNKLVSDSLPL-FIDMRSLTELNLSYNQLTMLPV-CTDCKNLTHLLLGFNKINNMENDYFLTLTKLSLLN   79 (263)
Q Consensus         2 l~~L~~L~l~~n~~~~~~~~~-~~~l~~L~~L~l~~n~l~~l~~-~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~   79 (263)
                      .++++.|++++|.+..  +|. +.++++|++|++++|.++.+|. +..+++|++|++++|.+..++. .+..+++|++|+
T Consensus        80 ~~~l~~L~L~~n~l~~--lp~~l~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp~-~l~~l~~L~~L~  156 (328)
T 4fcg_A           80 QPGRVALELRSVPLPQ--FPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPA-SIASLNRLRELS  156 (328)
T ss_dssp             STTCCEEEEESSCCSS--CCSCGGGGTTCSEEEEESSCCCCCCSCGGGGTTCSEEEEESCCCCCCCG-GGGGCTTCCEEE
T ss_pred             ccceeEEEccCCCchh--cChhhhhCCCCCEEECCCCCccchhHHHhccCCCCEEECCCCccccCcH-HHhcCcCCCEEE
Confidence            3679999999999986  776 8889999999999999998884 8899999999999999997654 588999999999


Q ss_pred             eecCcC-ccccccccC---------CCCcCEEEccCCcCCCccccccCCCcccEEEecCCCCCCcchHHHHhHHHHhhhh
Q psy3787          80 LKNNKI-SEVSSNVGD---------LINLAILDLSDNELTDVPCELSSLFHLKSLFLGGNPIKTVRNDILQDSKRIISHI  149 (263)
Q Consensus        80 l~~~~l-~~lp~~~~~---------l~~L~~L~l~~n~l~~l~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~l~~l  149 (263)
                      +++|++ ..+|..+..         +++|++|++++|.++.+|..++.+++|+.|++++|.+++++..+...  ..++.+
T Consensus       157 L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l--~~L~~L  234 (328)
T 4fcg_A          157 IRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHL--PKLEEL  234 (328)
T ss_dssp             EEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCCCCCCGGGGGC--TTCCEE
T ss_pred             CCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCCCcCchhhccC--CCCCEE
Confidence            999755 477876654         99999999999999999989999999999999999999998764333  467788


Q ss_pred             hCCCCcccccccCCCCCCCcCCcccccccccccCCcceeccc---cccccChhHHhhcCCccceeEEEeccCCccc-ccC
Q psy3787         150 KTSRLDYHCQNVDGGGMSSQESTSEINIDKYKLDRTKTLTLC---KVINIPESVYMRGMSSQECTIEINIDKYKLD-RTK  225 (263)
Q Consensus       150 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~---~~~~l~~~~~~~~~~~~~L~~~L~ls~n~l~-~ip  225 (263)
                      +++.+.+               .+.+|..+..+++|++|+++   ..+.+|.++..+.    +|+. |++++|.+. .+|
T Consensus       235 ~Ls~n~~---------------~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~----~L~~-L~L~~n~~~~~iP  294 (328)
T 4fcg_A          235 DLRGCTA---------------LRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLT----QLEK-LDLRGCVNLSRLP  294 (328)
T ss_dssp             ECTTCTT---------------CCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCT----TCCE-EECTTCTTCCCCC
T ss_pred             ECcCCcc---------------hhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCC----CCCE-EeCCCCCchhhcc
Confidence            8877664               56677789999999999999   4578888876655    5999 999998866 677


Q ss_pred             ccccccccccccc
Q psy3787         226 TLTLCKVINIPES  238 (263)
Q Consensus       226 ~~~~~~~~~l~~~  238 (263)
                      .. ..++.++..+
T Consensus       295 ~~-l~~L~~L~~l  306 (328)
T 4fcg_A          295 SL-IAQLPANCII  306 (328)
T ss_dssp             GG-GGGSCTTCEE
T ss_pred             HH-HhhccCceEE
Confidence            53 3333443333



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 263
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 60.0 bits (144), Expect = 5e-11
 Identities = 43/152 (28%), Positives = 72/152 (47%), Gaps = 24/152 (15%)

Query: 3   SHLKTLDLSHNKLVSDSLPLFIDMRSLTELNLSYNQLTMLPVCTDCKNLTHLLLGFNKIN 62
           ++L  L L+ N+L    +     + +LT+L+L+ NQ++ L   +    LT L LG N+I+
Sbjct: 219 TNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQIS 276

Query: 63  NMENDYFLT--------------------LTKLSLLNLKNNKISEVSSNVGDLINLAILD 102
           N+     LT                    L  L+ L L  N IS++S  V  L  L  L 
Sbjct: 277 NISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP-VSSLTKLQRLF 335

Query: 103 LSDNELTDVPCELSSLFHLKSLFLGGNPIKTV 134
            ++N+++DV   L++L ++  L  G N I  +
Sbjct: 336 FANNKVSDVS-SLANLTNINWLSAGHNQISDL 366


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query263
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.21
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.11
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.05
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.99
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.28
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.94
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.86
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.83
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.03
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.85  E-value=4.5e-21  Score=155.54  Aligned_cols=191  Identities=24%  Similarity=0.271  Sum_probs=140.1

Q ss_pred             CCCCEEEeecCccCCCCccc-cCCCCCCcEEEecCCCCCCCc--CCCCCCCCcEEEecCCCCCCCchhhhhCCCCccEEE
Q psy3787           3 SHLKTLDLSHNKLVSDSLPL-FIDMRSLTELNLSYNQLTMLP--VCTDCKNLTHLLLGFNKINNMENDYFLTLTKLSLLN   79 (263)
Q Consensus         3 ~~L~~L~l~~n~~~~~~~~~-~~~l~~L~~L~l~~n~l~~l~--~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~   79 (263)
                      ..+.+.+.++++++.  +|+ +.  +++++|++++|.++.++  .|..+++|++|++++|.++.++.  +..+++|++|+
T Consensus        10 ~~~~~v~C~~~~L~~--iP~~lp--~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~--~~~l~~L~~L~   83 (266)
T d1p9ag_          10 ASHLEVNCDKRNLTA--LPPDLP--KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQV--DGTLPVLGTLD   83 (266)
T ss_dssp             TTCCEEECTTSCCSS--CCSCCC--TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEEC--CSCCTTCCEEE
T ss_pred             CCCeEEEccCCCCCe--eCcCcC--cCCCEEECcCCcCCCcCHHHhhcccccccccccccccccccc--ccccccccccc
Confidence            455667888888876  664 42  57888888888888766  47788888888888888887654  45688888888


Q ss_pred             eecCcCccccccccCCCCcCEEEccCCcCCCccc-cccCCCcccEEEecCCCCCCcchHHHHhHHHHhhhhhCCCCcccc
Q psy3787          80 LKNNKISEVSSNVGDLINLAILDLSDNELTDVPC-ELSSLFHLKSLFLGGNPIKTVRNDILQDSKRIISHIKTSRLDYHC  158 (263)
Q Consensus        80 l~~~~l~~lp~~~~~l~~L~~L~l~~n~l~~l~~-~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~l~~l~~~~~~~~~  158 (263)
                      +++|+++..+..+..+++|+.++++++.+..++. .+..+.+++.+++++|.++.++...+... ..+..++++.+.+  
T Consensus        84 Ls~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l-~~l~~l~l~~N~l--  160 (266)
T d1p9ag_          84 LSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPT-PKLEKLSLANNNL--  160 (266)
T ss_dssp             CCSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTC-TTCCEEECTTSCC--
T ss_pred             cccccccccccccccccccccccccccccceeeccccccccccccccccccccceecccccccc-ccchhcccccccc--
Confidence            8888888877777888888888888888877643 46778888888888888888876654432 3455566655552  


Q ss_pred             cccCCCCCCCcCCcccccccccccCCcceeccc--cccccChhHHhhcCCccceeEEEeccCCc
Q psy3787         159 QNVDGGGMSSQESTSEINIDKYKLDRTKTLTLC--KVINIPESVYMRGMSSQECTIEINIDKYK  220 (263)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~--~~~~l~~~~~~~~~~~~~L~~~L~ls~n~  220 (263)
                                   ....+..+..+++|++|+++  +++.+|++++....    |+. |++++|+
T Consensus       161 -------------~~~~~~~~~~l~~L~~L~Ls~N~L~~lp~~~~~~~~----L~~-L~L~~Np  206 (266)
T d1p9ag_         161 -------------TELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHL----LPF-AFLHGNP  206 (266)
T ss_dssp             -------------SCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCC----CSE-EECCSCC
T ss_pred             -------------cccCccccccccccceeecccCCCcccChhHCCCCC----CCE-EEecCCC
Confidence                         22223346677888888888  77888877776554    888 8888884



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure