Psyllid ID: psy3863

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----

MDVRLNEDSVSAFVSIMRGCDNMCTYCIVPFTRGRERSRPMQSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCAIRENAEGKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGPDSYKDLPRLLALTYSNQTAINVLLSLDETYADITPKAVSTDGRRSIYVDGRWSIYVDGRWRRKLGQQMVDGRSMSMDDGGGASMSSRQCGRFQSTLIDGHRLCVTQLYLTNQDYPIPRKIRNSSLF

cccccccccccEEEEEccccccccccEEcccccccccccccHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEcHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHccccEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHcccEEEEcccccccccccccccccccHHHHHHHccccccccEEcccccc

ccccccccccEEEEEEEccccccEEEEEEEccccccccccHHHHHHHHHHHHHHcEEEEHccccccccHHHHHHHHHHccccccccHHHHcEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHccccEEEEEcccHHHHccccccccccccEEEEEEEEEEEEEEccccccccHHHHHHHHHHHHHcccccHHccccccccccEcccccEEEEEEEEEccccccccccccccccc

mdvrlnedSVSAFVSIMRgcdnmctycivpftrgrersrpmQSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSsgyskvnhpreaDVILVMTCAIRENAEGKVWDRLRFYRSMKQIHKkhrtfplkigVLGCMAERLKKSLLEKEQALdlvagpdsykdlPRLLALTYSNQTAINVLLSLdetyaditpkavstdgrrsiyvdgrwsiyvdgrwrrklgqqmvdgrsmsmddgggasmssrqcgrfqstlidghrLCVTQLYltnqdypiprkirnsslf

MDVRLNEDSVSAFVSIMRGCDNMCTYCIVPftrgrersrpmQSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSsgyskvnhpreADVILVMTCAIRenaegkvwdrLRFYRSMKqihkkhrtfplkigVLGCMAERLKKSLLEKEQALDLVAGPDSYKDLPRLLALTYSNQTAINVLLSLDETYADitpkavstdgrrsiyvdgrwsiyvdgrwrrKLGQQMVDGRSMSMDDGGGASMSSRQCGRFQSTLIDGHRLCVTQlyltnqdypiprkirnsslf

MDVRLNEDSVSAFVSIMRGCDNMCTYCIVPFTRGRERSRPMQSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCAIRENAEGKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGPDSYKDLPRLLALTYSNQTAINVLLSLDETYADITPKAVSTDGRRSIYVDGRWSIYVDGRWRRKLGQQMVdgrsmsmddgggasmssrQCGRFQSTLIDGHRLCVTQLYLTNQDYPIPRKIRNSSLF

*********VSAFVSIMRGCDNMCTYCIVPFTRGR******QSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCAIRENAEGKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGPDSYKDLPRLLALTYSNQTAINVLLSLDETYADITPKAVSTDGRRSIYVDGRWSIYVDGRWRRKLG************************GRFQSTLIDGHRLCVTQLYLTNQDYPI**********

MDVR***DSVSAFVSIMRGCDNMCTYCIVPFTRGRERSRPMQSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCAIRENAEGKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGPDSYKDLPRLLALTYSNQTAINVLLSLDETYADITPKAVSTDGRRSIYVDGRWSIYVDGRWRRKLGQQMVDGRSMSMDDGGGASMSSRQCGRFQSTLIDGHRLCVTQLYLTNQDYPIPRKIRNSSL*

********SVSAFVSIMRGCDNMCTYCIVPFTRGRERSRPMQSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCAIRENAEGKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGPDSYKDLPRLLALTYSNQTAINVLLSLDETYADITPKAVSTDGRRSIYVDGRWSIYVDGRWRRKLGQQMVDGRSM*************QCGRFQSTLIDGHRLCVTQLYLTNQDYPIPRKIRNSSLF

*****NEDSVSAFVSIMRGCDNMCTYCIVPFTRGRERSRPMQSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCAIRENAEGKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGPDSYKDLPRLLALTYSNQTAINVLLSLDETYADITPKAVSTDGRRSIYVDGRWSIYVDGRWRRKLGQQMVDGRSMSMDDGGGASMSSRQCGRFQSTLIDGHRLCVTQLYLTNQDYPIPRKI******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		285	2.2.26 [Sep-21-2011]
Q96SZ6		601	CDK5 regulatory subunit-a	yes	N/A	0.564	0.267	0.537	7e-47
Q8BTW8		588	CDK5 regulatory subunit-a	yes	N/A	0.533	0.258	0.575	3e-46
Q9JLH6		586	CDK5 regulatory subunit-a	yes	N/A	0.533	0.259	0.575	3e-46
Q9VGZ1		583	CDK5RAP1-like protein OS=	yes	N/A	0.487	0.238	0.615	5e-46
Q2R1U4		600	CDK5RAP1-like protein OS=	yes	N/A	0.536	0.255	0.503	2e-38
Q8H0V1		640	CDK5RAP1-like protein OS=	yes	N/A	0.557	0.248	0.485	3e-38
Q54KV4		607	CDK5RAP1-like protein OS=	yes	N/A	0.575	0.270	0.5	2e-37
B3QVA0		451	(Dimethylallyl)adenosine	yes	N/A	0.477	0.301	0.503	2e-36
Q11U26		481	(Dimethylallyl)adenosine	yes	N/A	0.498	0.295	0.510	3e-36
B3ES11		486	(Dimethylallyl)adenosine	yes	N/A	0.515	0.302	0.506	5e-36

>sp\|Q96SZ6\|CK5P1_HUMAN CDK5 regulatory subunit-associated protein 1 OS=Homo sapiens GN=CDK5RAP1 PE=1 SV=2	Back alignment and function desciption

 Score =  187 bits (475), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 87/162 (53%), Positives = 119/162 (73%), Gaps = 1/162 (0%)

Query: 40  PMQSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCA 99
           P   ++DE+     KVY E +GCQMNVNDTE+ WSIL+ SGY + ++ +EADVIL++TC+
Sbjct: 87  PPYLMMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVILLVTCS 146

Query: 100 IRENAEGKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGP 159
           IRE AE  +W+RL   +++K    + R  PL+IG+LGCMAERLK+ +L +E+ +D++AGP
Sbjct: 147 IREKAEQTIWNRLHQLKALKTRRPRSRV-PLRIGILGCMAERLKEEILNREKMVDILAGP 205

Query: 160 DSYKDLPRLLALTYSNQTAINVLLSLDETYADITPKAVSTDG 201
           D+Y+DLPRLLA+  S Q A NVLLSLDETYAD+ P   S   
Sbjct: 206 DAYRDLPRLLAVAESGQQAANVLLSLDETYADVMPVQTSASA 247

Specifically inhibits CDK5 activation by CDK5R1.
Homo sapiens (taxid: 9606)

>sp\|Q8BTW8\|CK5P1_MOUSE CDK5 regulatory subunit-associated protein 1 OS=Mus musculus GN=Cdk5rap1 PE=2 SV=2	Back alignment and function description

>sp\|Q9JLH6\|CK5P1_RAT CDK5 regulatory subunit-associated protein 1 OS=Rattus norvegicus GN=Cdk5rap1 PE=1 SV=1	Back alignment and function description

>sp\|Q9VGZ1\|CK5P1_DROME CDK5RAP1-like protein OS=Drosophila melanogaster GN=CG6345 PE=2 SV=1	Back alignment and function description

>sp\|Q2R1U4\|CK5P1_ORYSJ CDK5RAP1-like protein OS=Oryza sativa subsp. japonica GN=Os11g0592800 PE=2 SV=1	Back alignment and function description

>sp\|Q8H0V1\|CK5P1_ARATH CDK5RAP1-like protein OS=Arabidopsis thaliana GN=At4g36390 PE=2 SV=1	Back alignment and function description

>sp\|Q54KV4\|CK5P1_DICDI CDK5RAP1-like protein OS=Dictyostelium discoideum GN=cdk5rap1 PE=3 SV=1	Back alignment and function description

>sp\|B3QVA0\|MIAB_CHLT3 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=miaB PE=3 SV=1	Back alignment and function description

>sp\|Q11U26\|MIAB_CYTH3 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=miaB PE=3 SV=1	Back alignment and function description

>sp\|B3ES11\|MIAB_AMOA5 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB OS=Amoebophilus asiaticus (strain 5a2) GN=miaB PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		285
427785585		585	Putative cdk5 activator-binding protein	0.522	0.254	0.617	8e-51
346469091		588	hypothetical protein [Amblyomma maculatu	0.557	0.270	0.566	1e-49
157132304		573	radical sam proteins [Aedes aegypti] gi\|	0.522	0.260	0.619	3e-49
118792628		538	AGAP012104-PA [Anopheles gambiae str. PE	0.557	0.295	0.587	3e-48
340722639		602	PREDICTED: CDK5RAP1-like protein-like [B	0.536	0.254	0.598	3e-48
390367810		656	PREDICTED: CDK5 regulatory subunit-assoc	0.536	0.233	0.584	4e-48
241560240		547	CDK5 regulatory subunit-associated prote	0.614	0.319	0.531	6e-48
380022835		599	PREDICTED: CDK5RAP1-like protein-like [A	0.505	0.240	0.621	8e-48
350424183		602	PREDICTED: CDK5RAP1-like protein-like [B	0.536	0.254	0.585	3e-47
194740916		577	GF17521 [Drosophila ananassae] gi\|190625	0.508	0.251	0.597	6e-47

>gi\|427785585\|gb\|JAA58244.1\| Putative cdk5 activator-binding protein [Rhipicephalus pulchellus]	Back alignment and taxonomy information

 Score =  206 bits (525), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 92/149 (61%), Positives = 118/149 (79%)

Query: 46  DEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCAIRENAE 105
           DEV+A   KV+FE +GCQMNVNDTEV WS+LK +G+ + N   EADV+L+MTCAIRE AE
Sbjct: 76  DEVQAKGKKVHFETYGCQMNVNDTEVAWSLLKDAGFVRTNSASEADVVLIMTCAIREGAE 135

Query: 106 GKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGPDSYKDL 165
           GK+W R+   + +K++       PL+IG+LGCMAERLK+ L+EKE+A+D+VAGPDSY+DL
Sbjct: 136 GKIWSRINQLKHLKKLRHADWRGPLQIGILGCMAERLKEKLIEKEKAVDIVAGPDSYRDL 195

Query: 166 PRLLALTYSNQTAINVLLSLDETYADITP 194
           PRLLAL +S Q  +NV LSLDETYAD+ P
Sbjct: 196 PRLLALAHSGQVGVNVQLSLDETYADVVP 224

Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|346469091\|gb\|AEO34390.1\| hypothetical protein [Amblyomma maculatum]	Back alignment and taxonomy information

>gi\|157132304\|ref\|XP_001655989.1\| radical sam proteins [Aedes aegypti] gi\|108881684\|gb\|EAT45909.1\| AAEL002837-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|118792628\|ref\|XP_320425.3\| AGAP012104-PA [Anopheles gambiae str. PEST] gi\|116116988\|gb\|EAA00300.4\| AGAP012104-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

>gi\|340722639\|ref\|XP_003399711.1\| PREDICTED: CDK5RAP1-like protein-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|390367810\|ref\|XP_801957.3\| PREDICTED: CDK5 regulatory subunit-associated protein 1-like isoform 4 [Strongylocentrotus purpuratus]	Back alignment and taxonomy information

>gi\|241560240\|ref\|XP_002400838.1\| CDK5 regulatory subunit-associated protein, putative [Ixodes scapularis] gi\|215499787\|gb\|EEC09281.1\| CDK5 regulatory subunit-associated protein, putative [Ixodes scapularis]	Back alignment and taxonomy information

>gi\|380022835\|ref\|XP_003695241.1\| PREDICTED: CDK5RAP1-like protein-like [Apis florea]	Back alignment and taxonomy information

>gi\|350424183\|ref\|XP_003493714.1\| PREDICTED: CDK5RAP1-like protein-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|194740916\|ref\|XP_001952936.1\| GF17521 [Drosophila ananassae] gi\|190625995\|gb\|EDV41519.1\| GF17521 [Drosophila ananassae]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		285
UNIPROTKB\|Q675N4		426	CDK5RAP1 "CDK5 regulatory subu	0.554	0.370	0.547	3.9e-44
UNIPROTKB\|Q96SZ6		601	CDK5RAP1 "CDK5 regulatory subu	0.554	0.262	0.547	3.9e-44
UNIPROTKB\|F1NZV3		522	CDK5RAP1 "Uncharacterized prot	0.515	0.281	0.56	8.1e-44
UNIPROTKB\|Q08DN3		589	CDK5RAP1 "CDK5 regulatory subu	0.554	0.268	0.540	2.2e-43
RGD\|708387		586	Cdk5rap1 "CDK5 regulatory subu	0.533	0.259	0.575	2.8e-43
MGI\|MGI:1914221		588	Cdk5rap1 "CDK5 regulatory subu	0.533	0.258	0.575	2.8e-43
UNIPROTKB\|E2QYD7		583	CDK5RAP1 "Uncharacterized prot	0.554	0.271	0.534	3.5e-43
UNIPROTKB\|F1S500		589	CDK5RAP1 "Uncharacterized prot	0.550	0.266	0.543	3.5e-43
FB\|FBgn0037816		583	CG6345 [Drosophila melanogaste	0.508	0.248	0.590	4.5e-43
ZFIN\|ZDB-GENE-070424-90		577	zgc:162738 "zgc:162738" [Danio	0.540	0.266	0.544	4e-42

UNIPROTKB\|Q675N4 CDK5RAP1 "CDK5 regulatory subunit associated protein 1 transcript variant 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

 Score = 465 (168.7 bits), Expect = 3.9e-44, P = 3.9e-44
 Identities = 87/159 (54%), Positives = 119/159 (74%)

Query:    40 PMQSILDEVRALSDKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCA 99
             P   ++DE+     KVY E +GCQMNVNDTE+ WSIL+ SGY + ++ +EADVIL++TC+
Sbjct:    87 PPYLMMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVILLVTCS 146

Query:   100 IRENAEGKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGP 159
             IRE AE  +W+RL   +++K    + R  PL+IG+LGCMAERLK+ +L +E+ +D++AGP
Sbjct:   147 IREKAEQTIWNRLHQLKALKTRRPRSRV-PLRIGILGCMAERLKEEILNREKMVDILAGP 205

Query:   160 DSYKDLPRLLALTYSNQTAINVLLSLDETYADITPKAVS 198
             D+Y+DLPRLLA+  S Q A NVLLSLDETYAD+ P   S
Sbjct:   206 DAYRDLPRLLAVAESGQQAANVLLSLDETYADVMPVQTS 244

GO:0009451 "RNA modification" evidence=IEA

GO:0016740 "transferase activity" evidence=IEA

GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA

UNIPROTKB\|Q96SZ6 CDK5RAP1 "CDK5 regulatory subunit-associated protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NZV3 CDK5RAP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q08DN3 CDK5RAP1 "CDK5 regulatory subunit associated protein 1" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|708387 Cdk5rap1 "CDK5 regulatory subunit associated protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1914221 Cdk5rap1 "CDK5 regulatory subunit associated protein 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QYD7 CDK5RAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S500 CDK5RAP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

FB\|FBgn0037816 CG6345 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-070424-90 zgc:162738 "zgc:162738" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
B3ES11	MIAB_AMOA5	2, ., -, ., -, ., -	0.5065	0.5157	0.3024	yes	N/A
A6LEM6	MIAB_PARD8	2, ., -, ., -, ., -	0.5035	0.4736	0.2954	yes	N/A
Q8BTW8	CK5P1_MOUSE	No assigned EC number	0.5751	0.5333	0.2585	yes	N/A
Q96SZ6	CK5P1_HUMAN	No assigned EC number	0.5370	0.5649	0.2678	yes	N/A
Q9VGZ1	CK5P1_DROME	No assigned EC number	0.6153	0.4877	0.2384	yes	N/A
B3QVA0	MIAB_CHLT3	2, ., -, ., -, ., -	0.5035	0.4771	0.3015	yes	N/A
B2RKG6	MIAB_PORG3	2, ., -, ., -, ., -	0.5177	0.4842	0.2967	yes	N/A
Q7MAW4	MIAB_PORGI	2, ., -, ., -, ., -	0.5106	0.4842	0.2980	yes	N/A
Q2R1U4	CK5P1_ORYSJ	No assigned EC number	0.5031	0.5368	0.255	yes	N/A
Q9JLH6	CK5P1_RAT	No assigned EC number	0.5751	0.5333	0.2593	yes	N/A
Q11U26	MIAB_CYTH3	2, ., -, ., -, ., -	0.5100	0.4982	0.2952	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		285
PRK14329		467	PRK14329, PRK14329, (dimethylallyl)adenosine tRNA	6e-58
pfam00919		98	pfam00919, UPF0004, Uncharacterized protein family	1e-38
PRK14332		449	PRK14332, PRK14332, (dimethylallyl)adenosine tRNA	1e-32
TIGR00089		429	TIGR00089, TIGR00089, radical SAM methylthiotransf	7e-30
PRK14340		445	PRK14340, PRK14340, (dimethylallyl)adenosine tRNA	1e-28
COG0621		437	COG0621, MiaB, 2-methylthioadenine synthetase [Tra	1e-28
PRK14329		467	PRK14329, PRK14329, (dimethylallyl)adenosine tRNA	6e-28
PRK14331		437	PRK14331, PRK14331, (dimethylallyl)adenosine tRNA	1e-26
PRK14325		444	PRK14325, PRK14325, (dimethylallyl)adenosine tRNA	3e-26
PRK14330		434	PRK14330, PRK14330, (dimethylallyl)adenosine tRNA	4e-25
PRK14327		509	PRK14327, PRK14327, (dimethylallyl)adenosine tRNA	4e-23
PRK14328		439	PRK14328, PRK14328, (dimethylallyl)adenosine tRNA	6e-23
PRK14340		445	PRK14340, PRK14340, (dimethylallyl)adenosine tRNA	1e-22
TIGR01574		438	TIGR01574, miaB-methiolase, tRNA-N(6)-(isopentenyl	2e-22
PRK14333		448	PRK14333, PRK14333, (dimethylallyl)adenosine tRNA	4e-20
TIGR00089		429	TIGR00089, TIGR00089, radical SAM methylthiotransf	6e-20
PRK14335		455	PRK14335, PRK14335, (dimethylallyl)adenosine tRNA	1e-19
PRK14328		439	PRK14328, PRK14328, (dimethylallyl)adenosine tRNA	2e-19
PRK14326		502	PRK14326, PRK14326, (dimethylallyl)adenosine tRNA	2e-19
COG0621		437	COG0621, MiaB, 2-methylthioadenine synthetase [Tra	3e-19
PRK14325		444	PRK14325, PRK14325, (dimethylallyl)adenosine tRNA	6e-19
TIGR01574		438	TIGR01574, miaB-methiolase, tRNA-N(6)-(isopentenyl	1e-18
PRK14337		446	PRK14337, PRK14337, (dimethylallyl)adenosine tRNA	2e-18
PRK14331		437	PRK14331, PRK14331, (dimethylallyl)adenosine tRNA	1e-17
PRK14327		509	PRK14327, PRK14327, (dimethylallyl)adenosine tRNA	2e-17
PRK14330		434	PRK14330, PRK14330, (dimethylallyl)adenosine tRNA	2e-16
PRK14332		449	PRK14332, PRK14332, (dimethylallyl)adenosine tRNA	2e-15
TIGR01579		414	TIGR01579, MiaB-like-C, MiaB-like tRNA modifying e	8e-15
PRK14334		440	PRK14334, PRK14334, (dimethylallyl)adenosine tRNA	9e-15
PRK14335		455	PRK14335, PRK14335, (dimethylallyl)adenosine tRNA	2e-14
PRK14336		418	PRK14336, PRK14336, (dimethylallyl)adenosine tRNA	2e-14
PRK14338		459	PRK14338, PRK14338, (dimethylallyl)adenosine tRNA	8e-14
PRK14339		420	PRK14339, PRK14339, (dimethylallyl)adenosine tRNA	4e-13
PRK14336		418	PRK14336, PRK14336, (dimethylallyl)adenosine tRNA	5e-13
PRK14334		440	PRK14334, PRK14334, (dimethylallyl)adenosine tRNA	6e-13
PRK14326		502	PRK14326, PRK14326, (dimethylallyl)adenosine tRNA	7e-13
PRK14338		459	PRK14338, PRK14338, (dimethylallyl)adenosine tRNA	7e-13
smart00729		216	smart00729, Elp3, Elongator protein 3, MiaB family	2e-12
PRK14337		446	PRK14337, PRK14337, (dimethylallyl)adenosine tRNA	4e-12
TIGR01578		420	TIGR01578, MiaB-like-B, MiaB-like tRNA modifying e	2e-10
TIGR01125		430	TIGR01125, TIGR01125, ribosomal protein S12 methyl	6e-10
TIGR01579		414	TIGR01579, MiaB-like-C, MiaB-like tRNA modifying e	1e-09
TIGR01125		430	TIGR01125, TIGR01125, ribosomal protein S12 methyl	2e-09
PRK14333		448	PRK14333, PRK14333, (dimethylallyl)adenosine tRNA	3e-09
PRK14339		420	PRK14339, PRK14339, (dimethylallyl)adenosine tRNA	4e-08
PRK14862		440	PRK14862, rimO, ribosomal protein S12 methylthiotr	2e-07
TIGR01578		420	TIGR01578, MiaB-like-B, MiaB-like tRNA modifying e	2e-05
TIGR04014		434	TIGR04014, B12_SAM_MJ_0865, B12-binding domain/rad	2e-05
pfam04055		165	pfam04055, Radical_SAM, Radical SAM superfamily	4e-05
PRK01254		707	PRK01254, PRK01254, hypothetical protein; Provisio	4e-04
COG1032		490	COG1032, COG1032, Fe-S oxidoreductase [Energy prod	5e-04
TIGR04295		422	TIGR04295, B12_rSAM_oligo, B12-binding domain/radi	0.003

>gnl\|CDD\|237676 PRK14329, PRK14329, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

 Score =  191 bits (488), Expect = 6e-58
 Identities = 75/148 (50%), Positives = 105/148 (70%), Gaps = 5/148 (3%)

Query: 54  KVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCAIRENAEGKVWDRLR 113
           K++ E +GCQMN  D+E+V SIL+ +GY+   +  EAD++LV TC+IR+NAE KV  RL 
Sbjct: 25  KLFIESYGCQMNFADSEIVASILQMAGYNTTENLEEADLVLVNTCSIRDNAEQKVRKRLE 84

Query: 114 FYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGPDSYKDLPRLLALTY 173
            + ++K+ + K     L +GVLGCMAERLK  LLE+E+ +DLV GPD+Y DLP L+A   
Sbjct: 85  KFNALKKKNPK-----LIVGVLGCMAERLKDKLLEEEKIVDLVVGPDAYLDLPNLIAEVE 139

Query: 174 SNQTAINVLLSLDETYADITPKAVSTDG 201
             + AINV+LS +ETYADI+P  +  +G
Sbjct: 140 EGRKAINVILSKEETYADISPVRLGGNG 167

Length = 467

>gnl\|CDD\|216191 pfam00919, UPF0004, Uncharacterized protein family UPF0004	Back alignment and domain information

>gnl\|CDD\|172808 PRK14332, PRK14332, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|232820 TIGR00089, TIGR00089, radical SAM methylthiotransferase, MiaB/RimO family	Back alignment and domain information

>gnl\|CDD\|237679 PRK14340, PRK14340, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|223694 COG0621, MiaB, 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|237676 PRK14329, PRK14329, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184628 PRK14331, PRK14331, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237673 PRK14325, PRK14325, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184627 PRK14330, PRK14330, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184624 PRK14327, PRK14327, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237675 PRK14328, PRK14328, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237679 PRK14340, PRK14340, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233476 TIGR01574, miaB-methiolase, tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB	Back alignment and domain information

>gnl\|CDD\|237677 PRK14333, PRK14333, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|232820 TIGR00089, TIGR00089, radical SAM methylthiotransferase, MiaB/RimO family	Back alignment and domain information

>gnl\|CDD\|237678 PRK14335, PRK14335, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237675 PRK14328, PRK14328, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237674 PRK14326, PRK14326, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|223694 COG0621, MiaB, 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|237673 PRK14325, PRK14325, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233476 TIGR01574, miaB-methiolase, tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB	Back alignment and domain information

>gnl\|CDD\|172813 PRK14337, PRK14337, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184628 PRK14331, PRK14331, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184624 PRK14327, PRK14327, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184627 PRK14330, PRK14330, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|172808 PRK14332, PRK14332, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233480 TIGR01579, MiaB-like-C, MiaB-like tRNA modifying enzyme	Back alignment and domain information

>gnl\|CDD\|184630 PRK14334, PRK14334, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237678 PRK14335, PRK14335, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184632 PRK14336, PRK14336, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184633 PRK14338, PRK14338, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184634 PRK14339, PRK14339, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184632 PRK14336, PRK14336, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184630 PRK14334, PRK14334, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237674 PRK14326, PRK14326, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184633 PRK14338, PRK14338, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|214792 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM	Back alignment and domain information

>gnl\|CDD\|172813 PRK14337, PRK14337, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233479 TIGR01578, MiaB-like-B, MiaB-like tRNA modifying enzyme, archaeal-type	Back alignment and domain information

>gnl\|CDD\|233279 TIGR01125, TIGR01125, ribosomal protein S12 methylthiotransferase RimO	Back alignment and domain information

>gnl\|CDD\|233480 TIGR01579, MiaB-like-C, MiaB-like tRNA modifying enzyme	Back alignment and domain information

>gnl\|CDD\|233279 TIGR01125, TIGR01125, ribosomal protein S12 methylthiotransferase RimO	Back alignment and domain information

>gnl\|CDD\|237677 PRK14333, PRK14333, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|184634 PRK14339, PRK14339, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|237838 PRK14862, rimO, ribosomal protein S12 methylthiotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|233479 TIGR01578, MiaB-like-B, MiaB-like tRNA modifying enzyme, archaeal-type	Back alignment and domain information

>gnl\|CDD\|234441 TIGR04014, B12_SAM_MJ_0865, B12-binding domain/radical SAM domain protein, MJ_0865 family	Back alignment and domain information

>gnl\|CDD\|217866 pfam04055, Radical_SAM, Radical SAM superfamily	Back alignment and domain information

>gnl\|CDD\|234928 PRK01254, PRK01254, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223963 COG1032, COG1032, Fe-S oxidoreductase [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|213908 TIGR04295, B12_rSAM_oligo, B12-binding domain/radical SAM domain protein, rhizo-twelve system	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		285
KOG4355\|consensus		547		100.0
COG0621		437	MiaB 2-methylthioadenine synthetase [Translation,	100.0
PRK14327		509	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14340		445	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14328		439	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
KOG2492\|consensus		552		100.0
TIGR01574		438	miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-3	100.0
PRK14332		449	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14335		455	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14333		448	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14329		467	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14337		446	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14326		502	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14336		418	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14338		459	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14331		437	(dimethylallyl)adenosine tRNA methylthiotransferas	100.0
PRK14862		440	rimO ribosomal protein S12 methylthiotransferase;	100.0
PRK14325		444	(dimethylallyl)adenosine tRNA methylthiotransferas	99.98
TIGR01578		420	MiaB-like-B MiaB-like tRNA modifying enzyme, archa	99.98
PRK14330		434	(dimethylallyl)adenosine tRNA methylthiotransferas	99.97
PRK14334		440	(dimethylallyl)adenosine tRNA methylthiotransferas	99.97
PF00919		98	UPF0004: Uncharacterized protein family UPF0004; I	99.97
TIGR01125		430	MiaB-like tRNA modifying enzyme YliG, TIGR01125. T	99.97
TIGR00089		429	RNA modification enzyme, MiaB family. This subfami	99.97
PRK14339		420	(dimethylallyl)adenosine tRNA methylthiotransferas	99.97
TIGR01579		414	MiaB-like-C MiaB-like tRNA modifying enzyme. This	99.97
COG0621		437	MiaB 2-methylthioadenine synthetase [Translation,	99.75
KOG2492\|consensus		552		99.41
PRK14332		449	(dimethylallyl)adenosine tRNA methylthiotransferas	99.34
PRK14336		418	(dimethylallyl)adenosine tRNA methylthiotransferas	99.34
PRK14339		420	(dimethylallyl)adenosine tRNA methylthiotransferas	99.34
PRK14337		446	(dimethylallyl)adenosine tRNA methylthiotransferas	99.32
PRK14327		509	(dimethylallyl)adenosine tRNA methylthiotransferas	99.31
PRK14340		445	(dimethylallyl)adenosine tRNA methylthiotransferas	99.26
PRK14326		502	(dimethylallyl)adenosine tRNA methylthiotransferas	99.25
PRK14328		439	(dimethylallyl)adenosine tRNA methylthiotransferas	99.25
PRK14330		434	(dimethylallyl)adenosine tRNA methylthiotransferas	99.25
TIGR01578		420	MiaB-like-B MiaB-like tRNA modifying enzyme, archa	99.24
PRK14329		467	(dimethylallyl)adenosine tRNA methylthiotransferas	99.23
TIGR01574		438	miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-3	99.22
PRK14862		440	rimO ribosomal protein S12 methylthiotransferase;	99.21
PRK14333		448	(dimethylallyl)adenosine tRNA methylthiotransferas	99.19
PRK14331		437	(dimethylallyl)adenosine tRNA methylthiotransferas	99.19
PRK14335		455	(dimethylallyl)adenosine tRNA methylthiotransferas	99.18
TIGR01579		414	MiaB-like-C MiaB-like tRNA modifying enzyme. This	99.18
TIGR00089		429	RNA modification enzyme, MiaB family. This subfami	99.16
PRK14338		459	(dimethylallyl)adenosine tRNA methylthiotransferas	99.14
PRK14325		444	(dimethylallyl)adenosine tRNA methylthiotransferas	99.09
TIGR01125		430	MiaB-like tRNA modifying enzyme YliG, TIGR01125. T	99.07
PRK14334		440	(dimethylallyl)adenosine tRNA methylthiotransferas	98.97
PRK00955		620	hypothetical protein; Provisional	98.88
PRK01254		707	hypothetical protein; Provisional	98.77
PRK05481		289	lipoyl synthase; Provisional	98.72
TIGR00510		302	lipA lipoate synthase. The family shows strong seq	98.49
PRK12928		290	lipoyl synthase; Provisional	98.33
KOG4355\|consensus		547		98.11
TIGR02026		497	BchE magnesium-protoporphyrin IX monomethyl ester	97.93
TIGR03471		472	HpnJ hopanoid biosynthesis associated radical SAM	97.84
TIGR02026		497	BchE magnesium-protoporphyrin IX monomethyl ester	97.78
TIGR03471		472	HpnJ hopanoid biosynthesis associated radical SAM	97.77
TIGR03550		322	F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflav	97.71
PRK06245		336	cofG FO synthase subunit 1; Reviewed	97.57
COG1032		490	Fe-S oxidoreductase [Energy production and convers	97.28
PF04055		166	Radical_SAM: Radical SAM superfamily; InterPro: IP	97.26
PLN02428		349	lipoic acid synthase	97.17
COG1031		560	Uncharacterized Fe-S oxidoreductase [Energy produc	97.08
PRK07094		323	biotin synthase; Provisional	97.04
PRK14456		368	ribosomal RNA large subunit methyltransferase N; P	96.76
PRK06256		336	biotin synthase; Validated	96.72
PRK14466		345	ribosomal RNA large subunit methyltransferase N; P	96.65
smart00729		216	Elp3 Elongator protein 3, MiaB family, Radical SAM	96.64
PRK14455		356	ribosomal RNA large subunit methyltransferase N; P	96.63
TIGR00433		296	bioB biotin synthetase. Catalyzes the last step of	96.58
TIGR00423		309	radical SAM domain protein, CofH subfamily. This p	96.47
PRK14454		342	ribosomal RNA large subunit methyltransferase N; P	96.36
TIGR02495		191	NrdG2 anaerobic ribonucleoside-triphosphate reduct	96.31
PRK06267		350	hypothetical protein; Provisional	96.19
TIGR00640		132	acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal	96.17
PRK14467		348	ribosomal RNA large subunit methyltransferase N; P	96.16
PRK14457		345	ribosomal RNA large subunit methyltransferase N; P	96.14
PRK14453		347	chloramphenicol/florfenicol resistance protein; Pr	96.1
TIGR03551		343	F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav	95.98
PRK14459		373	ribosomal RNA large subunit methyltransferase N; P	95.97
PRK11194		372	ribosomal RNA large subunit methyltransferase N; P	95.94
PRK08508		279	biotin synthase; Provisional	95.88
TIGR00048		355	radical SAM enzyme, Cfr family. A Staphylococcus s	95.78
PRK14463		349	ribosomal RNA large subunit methyltransferase N; P	95.75
PRK14468		343	ribosomal RNA large subunit methyltransferase N; P	95.67
PRK14469		343	ribosomal RNA large subunit methyltransferase N; P	95.61
PRK09240		371	thiH thiamine biosynthesis protein ThiH; Reviewed	95.54
cd01335		204	Radical_SAM Radical SAM superfamily. Enzymes of th	95.45
TIGR03700		351	mena_SCO4494 putative menaquinone biosynthesis pro	95.17
PRK14462		356	ribosomal RNA large subunit methyltransferase N; P	95.14
TIGR03699		340	mena_SCO4550 menaquinone biosynthesis protein, SCO	95.04
PRK08445		348	hypothetical protein; Provisional	94.95
PRK14465		342	ribosomal RNA large subunit methyltransferase N; P	94.84
PRK14460		354	ribosomal RNA large subunit methyltransferase N; P	94.81
TIGR03365		238	Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosyn	94.72
PRK14470		336	ribosomal RNA large subunit methyltransferase N; P	94.66
PRK00955		620	hypothetical protein; Provisional	94.55
COG0602		212	NrdG Organic radical activating enzymes [Posttrans	94.45
TIGR02826		147	RNR_activ_nrdG3 anaerobic ribonucleoside-triphosph	94.04
PRK14464		344	ribosomal RNA large subunit methyltransferase N; P	93.98
PRK05481		289	lipoyl synthase; Provisional	93.6
PF02310		121	B12-binding: B12 binding domain; InterPro: IPR0061	93.51
PRK14461		371	ribosomal RNA large subunit methyltransferase N; P	93.46
PRK01254		707	hypothetical protein; Provisional	93.4
PRK08599		377	coproporphyrinogen III oxidase; Provisional	93.39
TIGR02351		366	thiH thiazole biosynthesis protein ThiH. Members t	93.23
TIGR03821		321	AblA_like_1 lysine-2,3-aminomutase-related protein	93.17
cd02068		127	radical_SAM_B12_BD B12 binding domain_like associa	93.0
TIGR00238		331	KamA family protein. Note that the E. coli homolog	92.93
PRK07360		371	FO synthase subunit 2; Reviewed	92.46
TIGR00510		302	lipA lipoate synthase. The family shows strong seq	92.33
TIGR02493		235	PFLA pyruvate formate-lyase 1-activating enzyme. A	91.98
PRK15108		345	biotin synthase; Provisional	91.93
PRK09613		469	thiH thiamine biosynthesis protein ThiH; Reviewed	91.92
COG0820		349	Predicted Fe-S-cluster redox enzyme [General funct	91.79
KOG3799\|consensus		169		91.74
TIGR01210		313	conserved hypothetical protein TIGR01210. This fam	91.7
PRK02261		137	methylaspartate mutase subunit S; Provisional	91.49
TIGR01501		134	MthylAspMutase methylaspartate mutase, S subunit.	91.46
PRK11145		246	pflA pyruvate formate lyase-activating enzyme 1; P	91.37
PRK13361		329	molybdenum cofactor biosynthesis protein A; Provis	90.69
cd02071		122	MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin	90.66
PRK00164		331	moaA molybdenum cofactor biosynthesis protein A; R	90.52
cd02072		128	Glm_B12_BD B12 binding domain of glutamate mutase	90.21
TIGR02668		302	moaA_archaeal probable molybdenum cofactor biosynt	89.74
PLN02389		379	biotin synthase	89.56
PRK05926		370	hypothetical protein; Provisional	89.09
PRK12928		290	lipoyl synthase; Provisional	88.62
PRK09426		714	methylmalonyl-CoA mutase; Reviewed	87.97
PRK05799		374	coproporphyrinogen III oxidase; Provisional	87.71
TIGR03822		321	AblA_like_2 lysine-2,3-aminomutase-related protein	87.27
PTZ00413		398	lipoate synthase; Provisional	85.7
TIGR02666		334	moaA molybdenum cofactor biosynthesis protein A, b	85.33
PRK13762		322	tRNA-modifying enzyme; Provisional	85.29
PRK09234		843	fbiC FO synthase; Reviewed	84.46
COG2185		143	Sbm Methylmalonyl-CoA mutase, C-terminal domain/su	84.15
PRK05927		350	hypothetical protein; Provisional	83.33
TIGR02109		358	PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E.	82.84
PRK09234		843	fbiC FO synthase; Reviewed	82.15
TIGR01290		442	nifB nitrogenase cofactor biosynthesis protein Nif	81.87
TIGR03470		318	HpnH hopanoid biosynthesis associated radical SAM	81.86
PRK05301		378	pyrroloquinoline quinone biosynthesis protein PqqE	81.81
PLN02951		373	Molybderin biosynthesis protein CNX2	81.64
COG1032		490	Fe-S oxidoreductase [Energy production and convers	81.42
COG2896		322	MoaA Molybdenum cofactor biosynthesis enzyme [Coen	80.61
PF13353		139	Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A	80.49
PRK11121		154	nrdG anaerobic ribonucleotide reductase-activating	80.28
cd02067		119	B12-binding B12 binding domain (B12-BD). This doma	80.14
PRK08629		433	coproporphyrinogen III oxidase; Provisional	80.07

>KOG4355\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.4e-50  Score=381.14  Aligned_cols=228  Identities=20%  Similarity=0.265  Sum_probs=191.3

Q ss_pred             ccCccccCCCCCChhhhhhHHhh-----cC-ceeeEEEeccccCcchhHHHHHHHhhCCeeecCCCCCCcEEEEeccccc
Q psy3863          28 IVPFTRGRERSRPMQSILDEVRA-----LS-DKVYFEVFGCQMNVNDTEVVWSILKSSGYSKVNHPREADVILVMTCAIR  101 (285)
Q Consensus        28 iip~~rG~~~Sr~~~~IV~e~~~-----~g-~kv~i~TyGC~~N~~dsell~~lL~~~G~~~v~~~e~ADviiiNTCtVr  101 (285)
                      ++|.++-|..|+|.+.-- +-+.     -| +++||.||||.+|.+|+|+|++.|++.||.+++ +++||+|++|||||+
T Consensus        25 v~pk~~kr~~~k~~q~ee-~~~ps~s~ipgtqki~iktwgcshnnsdseymagqlaaygy~lte-~eeadlwllnsctvk  102 (547)
T KOG4355|consen   25 VNPKTNKRISSKPDQIEE-SNRPSSSKIPGTQKIYIKTWGCSHNNSDSEYMAGQLAAYGYALTE-PEEADLWLLNSCTVK  102 (547)
T ss_pred             cccccccccccCchhhhh-cCCCccccCCCccEEEEEeecccCCCchhHHHhhhHHhhhhccCC-cccccEEEecccccC
Confidence            567777776666644322 2211     12 679999999999999999999999999999998 999999999999999


Q ss_pred             cchHHHHHHHHHHHHHhhhhhccCCCCCcEEEEEccchhhhhHHHHhhCCCccEEECCCCcCCHHHHHHhhccCCeeeee
Q psy3863         102 ENAEGKVWDRLRFYRSMKQIHKKHRTFPLKIGVLGCMAERLKKSLLEKEQALDLVAGPDSYKDLPRLLALTYSNQTAINV  181 (285)
Q Consensus       102 ~~Ae~k~~~~I~~l~~~kr~~~~~~~p~~~IvVtGC~aq~~~~~l~~~~~~Vd~VvG~~~~~~l~e~v~~~~~~~~~~~~  181 (285)
                      +++|+.+++.|.+.+..          ++.++++||++|..++.  +.+.++ .|+|.+|+++++|++|++++|+.+..+
T Consensus       103 npsed~frn~i~~g~~~----------~k~~viagcvpqg~p~~--dyl~gl-svigvqqidrvvevveetlkghsvrll  169 (547)
T KOG4355|consen  103 NPSEDAFRNLITRGRSG----------KKPLVIAGCVPQGSPDL--DYLEGL-SVIGVQQIDRVVEVVEETLKGHSVRLL  169 (547)
T ss_pred             CchHHHHHHHHHhhhcC----------CCceEEEecCCCCCcch--hhhcCc-eEeehhhhhHHHHHHHHHhccceEeee
Confidence            99999999999988632          45899999999998873  566678 499999999999999999999988755


Q ss_pred             eccccccccccCCCccCCCCeeEEEE-cCc---c--c--cccCCcccccChHHHHhhhhcccC-----------CcchHh
Q psy3863         182 LLSLDETYADITPKAVSTDGRRSIYV-DGR---W--S--IYVDGRWRRKLGQQMVDGRSMSMD-----------DGGGAS  242 (285)
Q Consensus       182 ~~~~~~~~~~~~P~~~~~~~~~a~~i-~Gc---c--C--~~aRG~~rS~~~~~iv~~~~~~~~-----------d~g~~~  242 (285)
                      ......+ ++ +|+.++++..+++.| +||   |  |  +||||.+.|||++++|++|+++|+           ||||||
T Consensus       170 ~rr~~ga-ld-lpkvrknplieIi~intgclgaCtyckTkharg~l~sy~~dslvervrt~f~egv~eIwltsedTgayg  247 (547)
T KOG4355|consen  170 TRRTLGA-LD-LPKVRKNPLIEIISINTGCLGACTYCKTKHARGLLASYPKDSLVERVRTSFEEGVCEIWLTSEDTGAYG  247 (547)
T ss_pred             ecccccc-cC-chhhccCCceEEEEeccccccccccccccccccccccCCHHHHHHHHHHHHhcCcEEEEecccccchhh
Confidence            4332223 55 799999999999999 998   5  7  799999999999999999999884           999999


Q ss_pred             H--------hHHHhcccccccccccceeEEEecccCCCCccccc
Q psy3863         243 M--------SSRQCGRFQSTLIDGHRLCVTQLYLTNQDYPIPRK  278 (285)
Q Consensus       243 ~--------ll~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~  278 (285)
                      +        |||++.   .+||++   ||||+||||||||++.+
T Consensus       248 rdig~slp~ll~klv---~~iPe~---cmlr~gmTnpP~ilehl  285 (547)
T KOG4355|consen  248 RDIGKSLPKLLWKLV---EVIPES---CMLRAGMTNPPYILEHL  285 (547)
T ss_pred             hhhhhhhHHHHHHHH---Hhcchh---hhhhhcCCCCchHHHHH
Confidence            5        556654   468988   99999999999998753

>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14328 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>KOG2492\|consensus	Back alignment and domain information

>TIGR01574 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB	Back alignment and domain information

>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14335 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14329 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14337 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14326 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14336 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14338 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14862 rimO ribosomal protein S12 methylthiotransferase; Provisional	Back alignment and domain information

>PRK14325 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type	Back alignment and domain information

>PRK14330 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14334 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PF00919 UPF0004: Uncharacterized protein family UPF0004; InterPro: IPR013848 The methylthiotransferase (MTTase) or miaB-like family is named after the (dimethylallyl)adenosine tRNA MTTase miaB protein, which catalyses a C-H to C-S bond conversion in the methylthiolation of tRNA	Back alignment and domain information

>TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125	Back alignment and domain information

>TIGR00089 RNA modification enzyme, MiaB family	Back alignment and domain information

>PRK14339 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme	Back alignment and domain information

>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2492\|consensus	Back alignment and domain information

>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14336 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14339 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14337 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14326 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14328 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14330 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type	Back alignment and domain information

>PRK14329 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01574 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB	Back alignment and domain information

>PRK14862 rimO ribosomal protein S12 methylthiotransferase; Provisional	Back alignment and domain information

>PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14335 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme	Back alignment and domain information

>TIGR00089 RNA modification enzyme, MiaB family	Back alignment and domain information

>PRK14338 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14325 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125	Back alignment and domain information

>PRK14334 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK00955 hypothetical protein; Provisional	Back alignment and domain information

>PRK01254 hypothetical protein; Provisional	Back alignment and domain information

>PRK05481 lipoyl synthase; Provisional	Back alignment and domain information

>TIGR00510 lipA lipoate synthase	Back alignment and domain information

>PRK12928 lipoyl synthase; Provisional	Back alignment and domain information

>KOG4355\|consensus	Back alignment and domain information

>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase	Back alignment and domain information

>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ	Back alignment and domain information

>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase	Back alignment and domain information

>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ	Back alignment and domain information

>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit	Back alignment and domain information

>PRK06245 cofG FO synthase subunit 1; Reviewed	Back alignment and domain information

>COG1032 Fe-S oxidoreductase [Energy production and conversion]	Back alignment and domain information

>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation	Back alignment and domain information

>PLN02428 lipoic acid synthase	Back alignment and domain information

>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion]	Back alignment and domain information

>PRK07094 biotin synthase; Provisional	Back alignment and domain information

>PRK14456 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK06256 biotin synthase; Validated	Back alignment and domain information

>PRK14466 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM	Back alignment and domain information

>PRK14455 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR00433 bioB biotin synthetase	Back alignment and domain information

>TIGR00423 radical SAM domain protein, CofH subfamily	Back alignment and domain information

>PRK14454 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein	Back alignment and domain information

>PRK06267 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain	Back alignment and domain information

>PRK14467 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14457 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14453 chloramphenicol/florfenicol resistance protein; Provisional	Back alignment and domain information

>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit	Back alignment and domain information

>PRK14459 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK11194 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK08508 biotin synthase; Provisional	Back alignment and domain information

>TIGR00048 radical SAM enzyme, Cfr family	Back alignment and domain information

>PRK14463 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14468 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14469 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed	Back alignment and domain information

>cd01335 Radical_SAM Radical SAM superfamily	Back alignment and domain information

>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family	Back alignment and domain information

>PRK14462 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family	Back alignment and domain information

>PRK08445 hypothetical protein; Provisional	Back alignment and domain information

>PRK14465 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14460 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE	Back alignment and domain information

>PRK14470 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK00955 hypothetical protein; Provisional	Back alignment and domain information

>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein	Back alignment and domain information

>PRK14464 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK05481 lipoyl synthase; Provisional	Back alignment and domain information

>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin)	Back alignment and domain information

>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK01254 hypothetical protein; Provisional	Back alignment and domain information

>PRK08599 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR02351 thiH thiazole biosynthesis protein ThiH	Back alignment and domain information

>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein	Back alignment and domain information

>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain	Back alignment and domain information

>TIGR00238 KamA family protein	Back alignment and domain information

>PRK07360 FO synthase subunit 2; Reviewed	Back alignment and domain information

>TIGR00510 lipA lipoate synthase	Back alignment and domain information

>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme	Back alignment and domain information

>PRK15108 biotin synthase; Provisional	Back alignment and domain information

>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed	Back alignment and domain information

>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only]	Back alignment and domain information

>KOG3799\|consensus	Back alignment and domain information

>TIGR01210 conserved hypothetical protein TIGR01210	Back alignment and domain information

>PRK02261 methylaspartate mutase subunit S; Provisional	Back alignment and domain information

>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit	Back alignment and domain information

>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional	Back alignment and domain information

>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional	Back alignment and domain information

>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain	Back alignment and domain information

>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed	Back alignment and domain information

>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm)	Back alignment and domain information

>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal	Back alignment and domain information

>PLN02389 biotin synthase	Back alignment and domain information

>PRK05926 hypothetical protein; Provisional	Back alignment and domain information

>PRK12928 lipoyl synthase; Provisional	Back alignment and domain information

>PRK09426 methylmalonyl-CoA mutase; Reviewed	Back alignment and domain information

>PRK05799 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein	Back alignment and domain information

>PTZ00413 lipoate synthase; Provisional	Back alignment and domain information

>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial	Back alignment and domain information

>PRK13762 tRNA-modifying enzyme; Provisional	Back alignment and domain information

>PRK09234 fbiC FO synthase; Reviewed	Back alignment and domain information

>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism]	Back alignment and domain information

>PRK05927 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E	Back alignment and domain information

>PRK09234 fbiC FO synthase; Reviewed	Back alignment and domain information

>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB	Back alignment and domain information

>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH	Back alignment and domain information

>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional	Back alignment and domain information

>PLN02951 Molybderin biosynthesis protein CNX2	Back alignment and domain information

>COG1032 Fe-S oxidoreductase [Energy production and conversion]	Back alignment and domain information

>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>PF13353 Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A 3CB8_A 3T7V_A 2YX0_A 3CAN_A	Back alignment and domain information

>PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional	Back alignment and domain information

>cd02067 B12-binding B12 binding domain (B12-BD)	Back alignment and domain information

>PRK08629 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		285
2qgq_A		304	Crystal Structure Of Tm_1862 From Thermotoga Mariti		5e-04

>pdb|2QGQ|A Chain A, Crystal Structure Of Tm_1862 From Thermotoga Maritima. Northeast Structural Genomics Consortium Target Vr77 Length = 304

Back alignment and structure

Iteration: 1
 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)
Query: 7  EDSVSAFVSIMRGCDNMCTYCIVPFTRGRERSRPMQSILDEVRAL 51
          E+   A+V I  GCD  CT+C +P  +G  RSR ++ I  EV  L
Sbjct: 1  EERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDL 45

PyMOL of 2qgq

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		285
2qgq_A		304	Protein TM_1862; alpha-beta protein, structural ge	6e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-09
1qzv_F		154	Plant photosystem I: subunit PSAF; photosynthesis,	1e-04

>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8} Length = 304	Back alignment and structure

 Score = 66.8 bits (164), Expect = 6e-13
 Identities = 19/48 (39%), Positives = 27/48 (56%)

Query: 7  EDSVSAFVSIMRGCDNMCTYCIVPFTRGRERSRPMQSILDEVRALSDK 54
          E+   A+V I  GCD  CT+C +P  +G  RSR ++ I  EV  L  +
Sbjct: 1  EERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKE 48

PyMOL of 2qgq

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		285
2qgq_A		304	Protein TM_1862; alpha-beta protein, structural ge	98.98
2qgq_A		304	Protein TM_1862; alpha-beta protein, structural ge	96.9
3t7v_A		350	Methylornithine synthase PYLB; TIM-barrel fold, mu	96.55
3iix_A		348	Biotin synthetase, putative; adoMet radical, SAM r	96.45
1r30_A		369	Biotin synthase; SAM radical protein, TIM barrel,	96.22
3c8f_A		245	Pyruvate formate-lyase 1-activating enzyme; adoMet	96.01
2yx0_A		342	Radical SAM enzyme; predicted tRNA modification en	95.71
3rfa_A		404	Ribosomal RNA large subunit methyltransferase N; r	95.42
2z2u_A		311	UPF0026 protein MJ0257; metal binding protein; 2.4	94.27
1olt_A		457	Oxygen-independent coproporphyrinogen III oxidase;	94.15
1tv8_A		340	MOAA, molybdenum cofactor biosynthesis protein A;	93.41
2a5h_A		416	L-lysine 2,3-aminomutase; radical SAM, four-iron-f	92.08
2yxb_A		161	Coenzyme B12-dependent mutase; alpha/beta, structu	91.51
1ccw_A		137	Protein (glutamate mutase); coenzyme B12, radical	84.35

>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8}	Back alignment and structure

Probab=98.98  E-value=5.8e-10  Score=102.78  Aligned_cols=74  Identities=27%  Similarity=0.532  Sum_probs=42.3

Q ss_pred             CCeEEEEEccccCCCCCcccccCccccCCCCCChhhhhhHHhh---cCce-eeEE-----Eecccc--CcchhHHHHHHH
Q psy3863           8 DSVSAFVSIMRGCDNMCTYCIVPFTRGRERSRPMQSILDEVRA---LSDK-VYFE-----VFGCQM--NVNDTEVVWSIL   76 (285)
Q Consensus         8 ~~~~a~v~i~~GC~~~CsyCiip~~rG~~~Sr~~~~IV~e~~~---~g~k-v~i~-----TyGC~~--N~~dsell~~lL   76 (285)
                      .+.++||+|++||+++|+||++|+.||+.+|+++++|+++++.   .|.+ +.+.     .||-+.  .....++++.+.
T Consensus         2 ~~~~~~v~is~GC~~~C~fC~~~~~~g~~r~r~~e~i~~ei~~l~~~G~~ei~l~g~~~~~yG~~~~~~~~l~~Ll~~l~   81 (304)
T 2qgq_A            2 ERPYAYVKISDGCDRGCTFCSIPSFKGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQALPDLLRRLN   81 (304)
T ss_dssp             CCSEEEEESBCCC-------------CCCCBCCHHHHHHHHHHHHHTTCCEEEEECTTGGGTTHHHHSSCCHHHHHHHHH
T ss_pred             CCEEEEEEECCCCCCcCccCCccccCCCceeeCHHHHHHHHHHHHHCCCcEEEEEeEcccccCCCCCcHHHHHHHHHHHH
Confidence            4679999999999999999999999999999999999999876   3543 4432     355332  234566666655


Q ss_pred             hhCCe
Q psy3863          77 KSSGY   81 (285)
Q Consensus        77 ~~~G~   81 (285)
                      +..|+
T Consensus        82 ~~~gi   86 (304)
T 2qgq_A           82 SLNGE   86 (304)
T ss_dssp             TSSSS
T ss_pred             hcCCC
Confidence            44454

PyMOL of 2qgq

>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8}	Back alignment and structure

>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri}	Back alignment and structure

>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A*	Back alignment and structure

>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1	Back alignment and structure

>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A*	Back alignment and structure

>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii}	Back alignment and structure

>3rfa_A Ribosomal RNA large subunit methyltransferase N; radical SAM, S-adenosylmethionine, iron sulfur cluster, oxidoreductase; HET: SAM; 2.05A {Escherichia coli} PDB: 3rf9_A*	Back alignment and structure

>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii}	Back alignment and structure

>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2	Back alignment and structure

>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A*	Back alignment and structure

>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale}	Back alignment and structure

>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix}	Back alignment and structure

>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		285
d1r30a_		312	Biotin synthase {Escherichia coli [TaxId: 562]}	95.59
d7reqa2		168	Methylmalonyl-CoA mutase alpha subunit, C-terminal	95.11
d7reqb2		163	Methylmalonyl-CoA mutase beta subunit, C-terminal	86.85
d1tv8a_		327	Molybdenum cofactor biosynthesis protein A MoaA {S	85.22

>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Biotin synthase
domain: Biotin synthase
species: Escherichia coli [TaxId: 562]

Probab=95.59  E-value=0.014  Score=50.37  Aligned_cols=61  Identities=15%  Similarity=0.241  Sum_probs=38.5

Q ss_pred             ccccCCCCCcccccCccc----cCCCCCChhhhhhHHhh---cCceeeEEEeccccC-cchhHHHHHHH
Q psy3863          16 IMRGCDNMCTYCIVPFTR----GRERSRPMQSILDEVRA---LSDKVYFEVFGCQMN-VNDTEVVWSIL   76 (285)
Q Consensus        16 i~~GC~~~CsyCiip~~r----G~~~Sr~~~~IV~e~~~---~g~kv~i~TyGC~~N-~~dsell~~lL   76 (285)
                      .+.||+++|+||......    .+.+..++++|+++++.   .|.+..+...|+... ....+.+.++.
T Consensus        46 ~TngC~~~C~fC~~~~~~~~~~~~~~~~~~e~i~~~~~~~~~~G~~~~~~~~g~~~~~~~~~~~~~~~i  114 (312)
T d1r30a_          46 KTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMPYLEQMV  114 (312)
T ss_dssp             ECSCBSSCCSSCSCBTTSCTTCCCCCCCCHHHHHHHHHHHHHTTCSEEEEEECCSSCCTTTHHHHHHHH
T ss_pred             eCCCCCCcCCcCCCCccCCCCCccccccchHHHHHHHHHHHHcCCEEEEEccCCCCCchhhHHHHHHHH
Confidence            388999999999765422    22455689999988765   465555555565432 22334444444

PyMOL of d1r30a_

>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}	Back information, alignment and structure

>d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}	Back information, alignment and structure

>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure