Psyllid ID: psy5791
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 81 | ||||||
| 340713035 | 644 | PREDICTED: LOW QUALITY PROTEIN: mediator | 0.518 | 0.065 | 0.869 | 2e-18 | |
| 380011201 | 644 | PREDICTED: LOW QUALITY PROTEIN: mediator | 0.518 | 0.065 | 0.869 | 2e-18 | |
| 66507375 | 644 | PREDICTED: mediator of RNA polymerase II | 0.518 | 0.065 | 0.869 | 2e-18 | |
| 383847603 | 644 | PREDICTED: mediator of RNA polymerase II | 0.518 | 0.065 | 0.869 | 2e-18 | |
| 350419682 | 644 | PREDICTED: mediator of RNA polymerase II | 0.518 | 0.065 | 0.869 | 2e-18 | |
| 156551237 | 641 | PREDICTED: mediator of RNA polymerase II | 0.518 | 0.065 | 0.847 | 8e-18 | |
| 307212331 | 646 | Mediator of RNA polymerase II transcript | 0.518 | 0.065 | 0.826 | 3e-17 | |
| 91080451 | 639 | PREDICTED: similar to AGAP009141-PA [Tri | 0.567 | 0.071 | 0.782 | 7e-16 | |
| 193641165 | 642 | PREDICTED: mediator of RNA polymerase II | 0.518 | 0.065 | 0.739 | 4e-15 | |
| 242014384 | 651 | CRSP complex subunit, putative [Pediculu | 0.518 | 0.064 | 0.782 | 8e-15 |
| >gi|340713035|ref|XP_003395057.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 17-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Score = 96.7 bits (239), Expect = 2e-18, Method: Compositional matrix adjust.
Identities = 40/46 (86%), Positives = 44/46 (95%)
Query: 35 VHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEIL 80
VHHKNTHHPFPHPSSGP+GPSKRRC+AGPT ADRYELLE+TKS+ L
Sbjct: 380 VHHKNTHHPFPHPSSGPLGPSKRRCLAGPTAADRYELLEMTKSQTL 425
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380011201|ref|XP_003689699.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 17-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|66507375|ref|XP_394516.2| PREDICTED: mediator of RNA polymerase II transcription subunit 17 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383847603|ref|XP_003699442.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350419682|ref|XP_003492267.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|156551237|ref|XP_001605806.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307212331|gb|EFN88135.1| Mediator of RNA polymerase II transcription subunit 17 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|91080451|ref|XP_969541.1| PREDICTED: similar to AGAP009141-PA [Tribolium castaneum] gi|270005569|gb|EFA02017.1| hypothetical protein TcasGA2_TC007640 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|193641165|ref|XP_001946953.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|242014384|ref|XP_002427871.1| CRSP complex subunit, putative [Pediculus humanus corporis] gi|212512340|gb|EEB15133.1| CRSP complex subunit, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 81 | ||||||
| FB|FBgn0038578 | 642 | MED17 "Mediator complex subuni | 0.567 | 0.071 | 0.608 | 4.4e-19 | |
| ZFIN|ZDB-GENE-040302-1 | 643 | med17 "mediator complex subuni | 0.654 | 0.082 | 0.355 | 6.7e-06 | |
| MGI|MGI:2182585 | 649 | Med17 "mediator complex subuni | 0.691 | 0.086 | 0.343 | 1.4e-05 | |
| RGD|1311120 | 649 | Med17 "mediator complex subuni | 0.691 | 0.086 | 0.343 | 1.4e-05 | |
| UNIPROTKB|E2RSF3 | 651 | MED17 "Uncharacterized protein | 0.654 | 0.081 | 0.355 | 1.4e-05 | |
| UNIPROTKB|F1NY10 | 643 | MED17 "Mediator of RNA polymer | 0.506 | 0.063 | 0.409 | 2.2e-05 | |
| UNIPROTKB|Q5ZID1 | 643 | MED17 "Mediator of RNA polymer | 0.506 | 0.063 | 0.409 | 2.2e-05 | |
| UNIPROTKB|Q5BIR6 | 651 | MED17 "Mediator of RNA polymer | 0.654 | 0.081 | 0.338 | 2.2e-05 | |
| UNIPROTKB|F1STK7 | 651 | MED17 "Uncharacterized protein | 0.654 | 0.081 | 0.338 | 2.2e-05 | |
| UNIPROTKB|Q9NVC6 | 651 | MED17 "Mediator of RNA polymer | 0.654 | 0.081 | 0.355 | 4.5e-05 |
| FB|FBgn0038578 MED17 "Mediator complex subunit 17" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 175 (66.7 bits), Expect = 4.4e-19, Sum P(2) = 4.4e-19
Identities = 28/46 (60%), Positives = 39/46 (84%)
Query: 35 VHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEIL 80
VH+KN+HHPFPHP+S P+GP+K+R +AGP ADR LL++TKS+ +
Sbjct: 374 VHYKNSHHPFPHPASAPLGPTKKRMLAGPMAADRETLLDMTKSQTI 419
|
|
| ZFIN|ZDB-GENE-040302-1 med17 "mediator complex subunit 17" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2182585 Med17 "mediator complex subunit 17" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1311120 Med17 "mediator complex subunit 17" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RSF3 MED17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NY10 MED17 "Mediator of RNA polymerase II transcription subunit 17" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZID1 MED17 "Mediator of RNA polymerase II transcription subunit 17" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5BIR6 MED17 "Mediator of RNA polymerase II transcription subunit 17" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STK7 MED17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NVC6 MED17 "Mediator of RNA polymerase II transcription subunit 17" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 81 | |||
| KOG4512|consensus | 625 | 99.43 | ||
| KOG4512|consensus | 625 | 98.95 | ||
| PF10156 | 467 | Med17: Subunit 17 of Mediator complex; InterPro: I | 92.96 |
| >KOG4512|consensus | Back alignment and domain information |
|---|
Probab=99.43 E-value=5.2e-14 Score=117.48 Aligned_cols=54 Identities=24% Similarity=0.236 Sum_probs=48.4
Q ss_pred eecCcchhhhhhcCCCCCCCCCCCCCCCCCccccccCCCccChHHHHHhhhhccC
Q psy5791 26 YQLSDNTFMVHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEIL 80 (81)
Q Consensus 26 y~~p~~lrE~H~qn~s~~~PhPasaP~G~kK~R~lAGP~a~dr~ei~~m~kte~L 80 (81)
|..-+-+||||++++|+++|||+|||||+||++ ++||+|+|+++|++|+.++|+
T Consensus 349 h~lHll~refh~~ss~~m~phpaSapfg~K~~~-l~gpma~d~n~l~~~~~s~g~ 402 (625)
T KOG4512|consen 349 HMLHLLRREFHDFSSSIMKPHPASAPFGAKSCK-LEGPMAEDQNRLKKTLFSFGK 402 (625)
T ss_pred HHHHHHHHHHHhhccccCCCCCccccccchhhh-ccCcchhhHHHHHHHHHHHHH
Confidence 344456899999999999999999999977777 999999999999999999875
|
|
| >KOG4512|consensus | Back alignment and domain information |
|---|
| >PF10156 Med17: Subunit 17 of Mediator complex; InterPro: IPR019313 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00