Psyllid ID: psy5791


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-
MSVNISVEAPVENIIQEISYDGQEIYQLSDNTFMVHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEILT
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHcccc
ccEEEEEEccccccEEEEEEcccEEEEEcHHHHHHHHHcccccccccccccccccHHHHccccccccHHHHHHHcHccccc
msvnisveapvENIIQEISYdgqeiyqlsdntfmvhhknthhpfphpssgpigpskrrciagptgadrYELLEltkseilt
msvnisveapveNIIQEISYDGQEIYQLSDNTFMVHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGAdryelleltkseilt
MSVNISVEAPVENIIQEISYDGQEIYQLSDNTFMVHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEILT
*********PVENIIQEISYDGQEIYQLSDNTFMVHH********************************************
**********************QEIYQLSDNTFMVHHKNTH**********************TGADRYELL*********
MSVNISVEAPVENIIQEISYDGQEIYQLSDNTFMVHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEILT
*SVNISVEAPVENIIQEISYDGQEIYQLSDNTFMVHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVNISVEAPVENIIQEISYDGQEIYQLSDNTFMVHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEILT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query81 2.2.26 [Sep-21-2011]
Q17JT4 645 Mediator of RNA polymeras N/A N/A 0.555 0.069 0.733 7e-16
Q7PVZ2 645 Mediator of RNA polymeras yes N/A 0.555 0.069 0.733 9e-16
Q9VEC1 642 Mediator of RNA polymeras yes N/A 0.567 0.071 0.608 4e-13
>sp|Q17JT4|MED17_AEDAE Mediator of RNA polymerase II transcription subunit 17 OS=Aedes aegypti GN=MED17 PE=3 SV=1 Back     alignment and function desciption
 Score = 82.4 bits (202), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (88%)

Query: 36  HHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEIL 80
           HHKNTHHPFPHP+S P+GPSK+R +AGP+  DRYELLE+TKS+ L
Sbjct: 379 HHKNTHHPFPHPASAPLGPSKKRMLAGPSAFDRYELLEMTKSQTL 423




Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Aedes aegypti (taxid: 7159)
>sp|Q7PVZ2|MED17_ANOGA Mediator of RNA polymerase II transcription subunit 17 OS=Anopheles gambiae GN=MED17 PE=3 SV=2 Back     alignment and function description
>sp|Q9VEC1|MED17_DROME Mediator of RNA polymerase II transcription subunit 17 OS=Drosophila melanogaster GN=MED17 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
340713035 644 PREDICTED: LOW QUALITY PROTEIN: mediator 0.518 0.065 0.869 2e-18
380011201 644 PREDICTED: LOW QUALITY PROTEIN: mediator 0.518 0.065 0.869 2e-18
66507375 644 PREDICTED: mediator of RNA polymerase II 0.518 0.065 0.869 2e-18
383847603 644 PREDICTED: mediator of RNA polymerase II 0.518 0.065 0.869 2e-18
350419682 644 PREDICTED: mediator of RNA polymerase II 0.518 0.065 0.869 2e-18
156551237 641 PREDICTED: mediator of RNA polymerase II 0.518 0.065 0.847 8e-18
307212331 646 Mediator of RNA polymerase II transcript 0.518 0.065 0.826 3e-17
91080451 639 PREDICTED: similar to AGAP009141-PA [Tri 0.567 0.071 0.782 7e-16
193641165 642 PREDICTED: mediator of RNA polymerase II 0.518 0.065 0.739 4e-15
242014384 651 CRSP complex subunit, putative [Pediculu 0.518 0.064 0.782 8e-15
>gi|340713035|ref|XP_003395057.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 17-like [Bombus terrestris] Back     alignment and taxonomy information
 Score = 96.7 bits (239), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/46 (86%), Positives = 44/46 (95%)

Query: 35  VHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEIL 80
           VHHKNTHHPFPHPSSGP+GPSKRRC+AGPT ADRYELLE+TKS+ L
Sbjct: 380 VHHKNTHHPFPHPSSGPLGPSKRRCLAGPTAADRYELLEMTKSQTL 425




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380011201|ref|XP_003689699.1| PREDICTED: LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 17-like [Apis florea] Back     alignment and taxonomy information
>gi|66507375|ref|XP_394516.2| PREDICTED: mediator of RNA polymerase II transcription subunit 17 [Apis mellifera] Back     alignment and taxonomy information
>gi|383847603|ref|XP_003699442.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350419682|ref|XP_003492267.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|156551237|ref|XP_001605806.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307212331|gb|EFN88135.1| Mediator of RNA polymerase II transcription subunit 17 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|91080451|ref|XP_969541.1| PREDICTED: similar to AGAP009141-PA [Tribolium castaneum] gi|270005569|gb|EFA02017.1| hypothetical protein TcasGA2_TC007640 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|193641165|ref|XP_001946953.1| PREDICTED: mediator of RNA polymerase II transcription subunit 17-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242014384|ref|XP_002427871.1| CRSP complex subunit, putative [Pediculus humanus corporis] gi|212512340|gb|EEB15133.1| CRSP complex subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query81
FB|FBgn0038578 642 MED17 "Mediator complex subuni 0.567 0.071 0.608 4.4e-19
ZFIN|ZDB-GENE-040302-1 643 med17 "mediator complex subuni 0.654 0.082 0.355 6.7e-06
MGI|MGI:2182585 649 Med17 "mediator complex subuni 0.691 0.086 0.343 1.4e-05
RGD|1311120 649 Med17 "mediator complex subuni 0.691 0.086 0.343 1.4e-05
UNIPROTKB|E2RSF3 651 MED17 "Uncharacterized protein 0.654 0.081 0.355 1.4e-05
UNIPROTKB|F1NY10 643 MED17 "Mediator of RNA polymer 0.506 0.063 0.409 2.2e-05
UNIPROTKB|Q5ZID1 643 MED17 "Mediator of RNA polymer 0.506 0.063 0.409 2.2e-05
UNIPROTKB|Q5BIR6 651 MED17 "Mediator of RNA polymer 0.654 0.081 0.338 2.2e-05
UNIPROTKB|F1STK7 651 MED17 "Uncharacterized protein 0.654 0.081 0.338 2.2e-05
UNIPROTKB|Q9NVC6 651 MED17 "Mediator of RNA polymer 0.654 0.081 0.355 4.5e-05
FB|FBgn0038578 MED17 "Mediator complex subunit 17" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 175 (66.7 bits), Expect = 4.4e-19, Sum P(2) = 4.4e-19
 Identities = 28/46 (60%), Positives = 39/46 (84%)

Query:    35 VHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEIL 80
             VH+KN+HHPFPHP+S P+GP+K+R +AGP  ADR  LL++TKS+ +
Sbjct:   374 VHYKNSHHPFPHPASAPLGPTKKRMLAGPMAADRETLLDMTKSQTI 419


GO:0016592 "mediator complex" evidence=ISS;IDA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=ISS;IMP
GO:0005634 "nucleus" evidence=ISS;IDA
GO:0001104 "RNA polymerase II transcription cofactor activity" evidence=ISS;IMP
GO:0006367 "transcription initiation from RNA polymerase II promoter" evidence=ISS
GO:0009987 "cellular process" evidence=IMP
GO:0045498 "sex comb development" evidence=IGI
GO:0003713 "transcription coactivator activity" evidence=IDA
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0033613 "activating transcription factor binding" evidence=IPI
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
ZFIN|ZDB-GENE-040302-1 med17 "mediator complex subunit 17" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2182585 Med17 "mediator complex subunit 17" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311120 Med17 "mediator complex subunit 17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSF3 MED17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY10 MED17 "Mediator of RNA polymerase II transcription subunit 17" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZID1 MED17 "Mediator of RNA polymerase II transcription subunit 17" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BIR6 MED17 "Mediator of RNA polymerase II transcription subunit 17" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1STK7 MED17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NVC6 MED17 "Mediator of RNA polymerase II transcription subunit 17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7PVZ2MED17_ANOGANo assigned EC number0.73330.55550.0697yesN/A
Q9VEC1MED17_DROMENo assigned EC number0.60860.56790.0716yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 81
KOG4512|consensus 625 99.43
KOG4512|consensus 625 98.95
PF10156 467 Med17: Subunit 17 of Mediator complex; InterPro: I 92.96
>KOG4512|consensus Back     alignment and domain information
Probab=99.43  E-value=5.2e-14  Score=117.48  Aligned_cols=54  Identities=24%  Similarity=0.236  Sum_probs=48.4

Q ss_pred             eecCcchhhhhhcCCCCCCCCCCCCCCCCCccccccCCCccChHHHHHhhhhccC
Q psy5791          26 YQLSDNTFMVHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEIL   80 (81)
Q Consensus        26 y~~p~~lrE~H~qn~s~~~PhPasaP~G~kK~R~lAGP~a~dr~ei~~m~kte~L   80 (81)
                      |..-+-+||||++++|+++|||+|||||+||++ ++||+|+|+++|++|+.++|+
T Consensus       349 h~lHll~refh~~ss~~m~phpaSapfg~K~~~-l~gpma~d~n~l~~~~~s~g~  402 (625)
T KOG4512|consen  349 HMLHLLRREFHDFSSSIMKPHPASAPFGAKSCK-LEGPMAEDQNRLKKTLFSFGK  402 (625)
T ss_pred             HHHHHHHHHHHhhccccCCCCCccccccchhhh-ccCcchhhHHHHHHHHHHHHH
Confidence            344456899999999999999999999977777 999999999999999999875



>KOG4512|consensus Back     alignment and domain information
>PF10156 Med17: Subunit 17 of Mediator complex; InterPro: IPR019313 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00