T0396

Human/Server Targets
387 389 391 393
395 396 397 399
401 403 405 407
409 411 413 415
417 419 421 423
425 427 429 431
434 437 440 443
446 449 451 454
457 460 462 464
465 466 467 468
469 471 473 474
476 480 482 484
487 489 492 493
495 496 498 499
500

T0396

pB119L African Swine Fever Virus

Target type: Human/Server

Target sequence:

>T0396 pB119L, African Swine Fever Virus, 105 residues
GSMLHWGPKYWRSLHLYAIFFSDAPSWKEKYEAIQWILNFIESLPCTRCQHHAFSYLTKNPLTLNNSEDFQYWTFAFHNNVNNRLNKKIISWSEYKNIYEQSILK

Structure:
Method: X-ray, res=Å, R/Rfree=Null/Null
Determined by:
PDB ID:

396 cartoon
Cartoon diagram of 396: chain A

PyMOL of T0396 unreleased PDB

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

Four-helical up-and-down bundle fold, FAD-dependent thiol oxidase superfamily.

CASP category:

Comparative modeling:easy.

Closest templates:

1jr8, 2hj3, 1oqc.

Target sequence - PDB file inconsistencies:

T0396    PDB unreleased    T0396.pdb    PyMOL    PyMOL of domains    

T0396    1 GSMLHWGPKYWRSLHLYAIFFSDAPSWKEKYEAIQWILNFIESLPCTRCQHHAFSYLTKNPLTLNNSEDFQYWTFAFHNNVNNRLNKKIISWSEYKNIYEQSILK 105
           ~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~
xxxxA    3 --MLHWGPKYWRSLHLYAIFFSDAPSWKEKYEAIQWILNFIESLPCTRCQHHAFSYLTKNPLTLNNSEDFQYWTFAFHNNVNNRLNKKIISWSEYKNIYEQSIL- 104

Single domain protein: target 3-104 ; pdb 3-104

Sequence classification:

Erv1/Alr family (Evr1_Alr) in Pfam.

Server predictions:

T0396:pdb 3-104:seq 3-104:CM_easy;   alignment

distribution of first scores
First models for T0396: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0396 T0396 T0396 T0396
First score First Z-score Best score Best Z-score
1 CpHModels 91.42 90.44 82.82 1.36 1.51 0.42 91.42 90.44 82.82 1.54 1.89 0.15 CpHModels 1
2 YASARA 90.20 86.77 84.76 1.10 0.91 0.80 90.20 86.77 84.89 1.14 0.85 0.67 YASARA 2
3 METATASSER 90.20 84.80 84.43 1.10 0.58 0.74 90.20 87.99 84.43 1.14 1.20 0.55 METATASSER 3
4 IBT_LT 90.20 82.52 86.53 1.10 0.21 1.15 90.20 82.52 86.53 1.14 -0.34 1.07 IBT_LT 4
5 mufold 89.46 88.32 84.12 0.94 1.16 0.68 89.46 88.32 86.10 0.89 1.29 0.97 mufold 5
6 TASSER 89.46 87.17 87.02 0.94 0.97 1.25 89.95 87.75 87.02 1.05 1.13 1.19 TASSER 6
7 MULTICOM 89.22 88.40 87.05 0.89 1.18 1.25 89.71 88.89 87.21 0.98 1.45 1.24 MULTICOM 7
8 Zhang−Server 88.97 87.83 84.26 0.84 1.08 0.71 89.22 87.83 85.82 0.81 1.15 0.90 Zhang−Server 8
9 Zhang 88.97 86.85 84.48 0.84 0.92 0.75 89.46 87.50 85.81 0.89 1.06 0.89 Zhang 9
10 forecast 88.97 84.72 83.59 0.84 0.57 0.57 88.97 85.21 83.59 0.73 0.42 0.34 forecast 10
11 pro−sp3−TASSER 88.72 87.09 84.80 0.79 0.96 0.81 88.72 87.09 86.29 0.65 0.94 1.01 pro−sp3−TASSER 11
12 ACOMPMOD 88.72 85.95 83.12 0.79 0.77 0.48 88.72 85.95 83.12 0.65 0.62 0.23 ACOMPMOD 12
13 MUSTER 88.48 80.64 84.45 0.74 -0.10 0.74 88.48 80.64 84.45 0.57 -0.87 0.56 MUSTER 13
14 LEE−SERVER 88.23 86.77 84.27 0.69 0.91 0.71 88.72 86.77 84.79 0.65 0.85 0.64 LEE−SERVER 14
15 FALCON 88.23 82.68 83.76 0.69 0.24 0.61 88.23 84.89 83.76 0.49 0.33 0.39 FALCON 15
16 GeneSilicoMetaServer 88.23 81.21 81.61 0.69 -0.01 0.19 88.48 84.07 81.83 0.57 0.09 -0.09 GeneSilicoMetaServer 16
17 pipe_int 88.23 79.58 83.36 0.69 -0.28 0.53 88.23 84.15 83.36 0.49 0.12 0.29 pipe_int 17
18 keasar−server 88.23 77.45 83.60 0.69 -0.63 0.58 88.48 84.15 84.03 0.57 0.12 0.45 keasar−server 18
19 SAMUDRALA 87.99 86.85 82.81 0.63 0.92 0.42 88.23 87.42 83.35 0.49 1.04 0.28 SAMUDRALA 19
20 FEIG 87.99 82.27 84.31 0.63 0.17 0.72 87.99 86.44 84.31 0.41 0.76 0.52 FEIG 20
21 LevittGroup 87.99 79.66 82.74 0.63 -0.26 0.41 88.48 79.90 83.33 0.57 -1.08 0.28 LevittGroup 21
22 FUGUE_KM 87.99 78.68 82.79 0.63 -0.42 0.42 87.99 78.68 82.79 0.41 -1.42 0.15 FUGUE_KM 22
23 FAMS−multi 87.75 85.95 82.41 0.58 0.77 0.34 88.23 86.44 82.41 0.49 0.76 0.05 FAMS−multi 23
24 CBSU 87.75 85.95 82.88 0.58 0.77 0.44 87.99 85.95 84.92 0.41 0.62 0.67 CBSU 24
25 PSI 87.75 85.62 81.38 0.58 0.72 0.14 87.99 85.62 82.79 0.41 0.53 0.15 PSI 25
26 GeneSilico 87.75 85.62 82.22 0.58 0.72 0.31 88.23 86.11 83.59 0.49 0.67 0.34 GeneSilico 26
27 AMU−Biology 87.75 81.70 85.10 0.58 0.07 0.87 87.75 82.68 85.10 0.33 -0.30 0.72 AMU−Biology 27
28 TsaiLab 87.50 86.52 84.43 0.53 0.87 0.74 87.75 86.52 84.43 0.33 0.78 0.55 TsaiLab 28
29 DelCLab 87.50 83.74 83.35 0.53 0.41 0.53 87.50 83.74 83.35 0.25 0.00 0.28 DelCLab 29
30 MUFOLD−Server 87.50 79.66 82.15 0.53 -0.26 0.29 87.99 80.31 84.10 0.41 -0.96 0.47 MUFOLD−Server 30
31 3DShotMQ 87.25 85.78 84.20 0.48 0.75 0.69 87.25 85.78 84.20 0.17 0.58 0.49 3DShotMQ 31
32 Abagyan 87.25 85.62 79.28 0.48 0.72 -0.27 87.25 85.62 79.28 0.17 0.53 -0.72 Abagyan 32
33 Elofsson 87.25 85.46 82.41 0.48 0.69 0.34 87.75 85.95 82.85 0.33 0.62 0.16 Elofsson 33
34 Pcons_multi 87.25 85.46 82.62 0.48 0.69 0.38 87.50 85.70 83.57 0.25 0.55 0.34 Pcons_multi 34
35 PRI−Yang−KiharA 87.25 84.97 80.82 0.48 0.61 0.03 87.25 84.97 80.82 0.17 0.35 -0.34 PRI−Yang−KiharA 35
36 3DShot1 87.01 85.21 83.08 0.43 0.65 0.47 87.01 85.21 83.08 0.09 0.42 0.22 3DShot1 36
37 Sternberg 87.01 85.21 82.43 0.43 0.65 0.35 87.01 85.21 82.43 0.09 0.42 0.06 Sternberg 37
38 HHpred4 87.01 85.21 82.43 0.43 0.65 0.35 87.01 85.21 82.43 0.09 0.42 0.06 HHpred4 38
39 BioSerf 87.01 85.21 81.64 0.43 0.65 0.19 87.01 85.21 81.64 0.09 0.42 -0.14 BioSerf 39
40 HHpred2 87.01 85.21 82.43 0.43 0.65 0.35 87.01 85.21 82.43 0.09 0.42 0.06 HHpred2 40
41 MULTICOM−REFINE 87.01 85.05 82.88 0.43 0.63 0.44 87.99 85.05 83.70 0.41 0.37 0.37 MULTICOM−REFINE 41
42 Pcons_local 87.01 84.89 81.86 0.43 0.60 0.24 87.01 84.89 81.86 0.09 0.33 -0.09 Pcons_local 42
43 nFOLD3 87.01 84.89 82.24 0.43 0.60 0.31 87.99 84.89 82.79 0.41 0.33 0.15 nFOLD3 43
44 LEE 87.01 84.07 82.94 0.43 0.46 0.45 87.50 84.97 83.24 0.25 0.35 0.26 LEE 44
45 MULTICOM−RANK 86.77 85.13 82.58 0.38 0.64 0.38 87.75 86.44 83.96 0.33 0.76 0.44 MULTICOM−RANK 45
46 BAKER−ROBETTA 86.77 84.80 85.54 0.38 0.58 0.96 86.77 84.80 85.54 0.01 0.30 0.83 BAKER−ROBETTA 46
47 3DShot2 86.77 84.80 82.59 0.38 0.58 0.38 86.77 84.80 82.59 0.01 0.30 0.10 3DShot2 47
48 Hao_Kihara 86.77 84.80 83.23 0.38 0.58 0.50 88.23 84.97 83.38 0.49 0.35 0.29 Hao_Kihara 48
49 RAPTOR 86.77 83.99 81.35 0.38 0.45 0.14 88.48 83.99 84.17 0.57 0.07 0.49 RAPTOR 49
50 Bates_BMM 86.77 82.68 85.00 0.38 0.24 0.85 87.25 84.15 85.27 0.17 0.12 0.76 Bates_BMM 50
51 FOLDpro 86.52 84.72 81.06 0.33 0.57 0.08 88.23 84.72 82.31 0.49 0.28 0.03 FOLDpro 51
52 MUProt 86.52 84.56 81.73 0.33 0.54 0.21 87.01 85.29 82.31 0.09 0.44 0.03 MUProt 52
53 Frankenstein 86.52 84.39 84.01 0.33 0.52 0.66 88.23 85.62 84.51 0.49 0.53 0.57 Frankenstein 53
54 MidwayFolding 86.52 84.39 84.80 0.33 0.52 0.81 87.99 85.54 84.80 0.41 0.51 0.64 MidwayFolding 54
55 GS−MetaServer2 86.52 84.07 80.88 0.33 0.46 0.04 88.48 84.07 82.16 0.57 0.09 -0.01 GS−MetaServer2 55
56 Phyre2 86.52 83.91 82.26 0.33 0.44 0.31 87.99 85.05 84.25 0.41 0.37 0.51 Phyre2 56
57 Jones−UCL 86.28 84.97 80.75 0.27 0.61 0.02 86.28 84.97 80.75 -0.15 0.35 -0.36 Jones−UCL 57
58 mGenTHREADER 86.28 84.15 82.28 0.27 0.48 0.32 86.28 84.15 82.28 -0.15 0.12 0.02 mGenTHREADER 58
59 MULTICOM−CLUSTER 86.28 84.15 81.55 0.27 0.48 0.17 87.75 85.38 83.00 0.33 0.46 0.20 MULTICOM−CLUSTER 59
60 SAM−T02−server 86.28 84.15 82.28 0.27 0.48 0.32 87.25 84.15 82.28 0.17 0.12 0.02 SAM−T02−server 60
61 Chicken_George 86.28 84.15 82.28 0.27 0.48 0.32 88.23 84.15 84.31 0.49 0.12 0.52 Chicken_George 61
62 HHpred5 86.28 84.15 83.14 0.27 0.48 0.49 86.28 84.15 83.14 -0.15 0.12 0.23 HHpred5 62
63 mti 86.28 83.82 81.90 0.27 0.42 0.24 86.77 84.80 81.90 0.01 0.30 -0.08 mti 63
64 EB_AMU_Physics 86.28 79.41 82.59 0.27 -0.30 0.38 86.28 79.41 82.59 -0.15 -1.22 0.10 EB_AMU_Physics 64
65 SAM−T08−server 86.28 76.80 81.58 0.27 -0.73 0.18 88.23 84.15 83.73 0.49 0.12 0.38 SAM−T08−server 65
66 fais@hgc 86.28 76.80 81.58 0.27 -0.73 0.18 88.97 87.83 86.29 0.73 1.15 1.01 fais@hgc 66
67 Zico 86.03 84.72 80.69 0.22 0.57 0.01 87.01 85.21 84.41 0.09 0.42 0.55 Zico 67
68 ZicoFullSTP 86.03 84.72 80.69 0.22 0.57 0.01 87.75 86.60 84.41 0.33 0.81 0.55 ZicoFullSTP 68
69 ZicoFullSTPFullData 86.03 84.72 80.69 0.22 0.57 0.01 87.01 85.21 83.35 0.09 0.42 0.28 ZicoFullSTPFullData 69
70 PS2−server 86.03 83.91 82.02 0.22 0.44 0.27 87.99 83.91 82.95 0.41 0.05 0.18 PS2−server 70
71 FAMSD 86.03 83.91 80.81 0.22 0.44 0.03 86.03 84.15 80.81 -0.23 0.12 -0.35 FAMSD 71
72 PS2−manual 86.03 83.91 82.02 0.22 0.44 0.27 87.99 83.91 82.95 0.41 0.05 0.18 PS2−manual 72
73 TJ_Jiang 86.03 83.42 80.45 0.22 0.36 -0.04 87.25 86.11 82.04 0.17 0.67 -0.04 TJ_Jiang 73
74 Poing 86.03 74.92 81.49 0.22 -1.04 0.16 87.99 84.39 83.69 0.41 0.18 0.37 Poing 74
75 fleil 85.78 84.15 81.96 0.17 0.48 0.25 88.23 85.38 83.03 0.49 0.46 0.20 fleil 75
76 GS−KudlatyPred 85.78 83.33 82.43 0.17 0.34 0.35 85.78 83.33 82.43 -0.32 -0.11 0.06 GS−KudlatyPred 76
77 Phyre_de_novo 85.78 81.21 80.01 0.17 -0.01 -0.13 87.99 85.05 83.65 0.41 0.37 0.36 Phyre_de_novo 77
78 Softberry 85.78 81.05 81.62 0.17 -0.03 0.19 85.78 81.05 81.62 -0.32 -0.76 -0.14 Softberry 78
79 SAM−T08−human 85.54 79.17 81.15 0.12 -0.34 0.10 87.01 81.45 84.62 0.09 -0.64 0.60 SAM−T08−human 79
80 Phragment 85.54 79.00 80.18 0.12 -0.37 -0.09 87.99 85.05 83.46 0.41 0.37 0.31 Phragment 80
81 panther_server 85.29 83.50 79.47 0.07 0.37 -0.23 88.72 83.50 80.44 0.65 -0.07 -0.44 panther_server 81
82 Bilab−UT 85.29 81.86 82.69 0.07 0.10 0.40 88.72 83.82 84.11 0.65 0.02 0.47 Bilab−UT 82
83 3Dpro 85.29 81.37 83.24 0.07 0.02 0.51 88.23 84.72 83.24 0.49 0.28 0.26 3Dpro 83
84 ABIpro 85.29 75.98 83.11 0.07 -0.87 0.48 87.01 80.64 85.32 0.09 -0.87 0.77 ABIpro 84
85 COMA 85.05 82.60 79.44 0.02 0.22 -0.24 86.28 83.01 82.41 -0.15 -0.20 0.05 COMA 85
86 COMA−M 84.80 83.33 79.12 -0.04 0.34 -0.30 85.78 84.15 80.86 -0.32 0.12 -0.33 COMA−M 86
87 McGuffin 84.80 79.90 85.23 -0.04 -0.22 0.90 90.20 87.58 86.54 1.14 1.08 1.07 McGuffin 87
88 Jiang_Zhu 84.80 79.90 85.23 -0.04 -0.22 0.90 88.23 86.44 86.54 0.49 0.76 1.07 Jiang_Zhu 88
89 huber−torda−server 84.56 82.27 79.06 -0.09 0.17 -0.31 87.99 82.27 82.79 0.41 -0.41 0.15 huber−torda−server 89
90 Pushchino 84.56 82.27 79.06 -0.09 0.17 -0.31 84.56 82.27 79.06 -0.72 -0.41 -0.78 Pushchino 90
91 FFASsuboptimal 84.56 82.27 79.06 -0.09 0.17 -0.31 84.56 82.27 79.74 -0.72 -0.41 -0.61 FFASsuboptimal 91
92 SHORTLE 84.56 81.45 83.99 -0.09 0.03 0.65 84.56 81.45 83.99 -0.72 -0.64 0.44 SHORTLE 92
93 Pcons_dot_net 84.07 82.44 75.65 -0.19 0.20 -0.98 87.01 84.89 81.86 0.09 0.33 -0.09 Pcons_dot_net 93
94 circle 84.07 81.78 77.78 -0.19 0.09 -0.56 86.28 83.91 81.41 -0.15 0.05 -0.20 circle 94
95 FFASflextemplate 83.82 81.21 78.12 -0.24 -0.01 -0.50 84.07 81.78 78.12 -0.88 -0.55 -1.01 FFASflextemplate 95
96 3D−JIGSAW_V3 83.82 81.05 82.69 -0.24 -0.03 0.40 86.03 81.94 83.38 -0.23 -0.51 0.29 3D−JIGSAW_V3 96
97 fais−server 83.82 80.56 81.41 -0.24 -0.11 0.15 88.48 84.07 84.10 0.57 0.09 0.47 fais−server 97
98 mariner1 83.82 79.08 74.16 -0.24 -0.36 -1.27 87.75 85.95 82.31 0.33 0.62 0.03 mariner1 98
99 fams−ace2 83.33 80.56 81.26 -0.35 -0.11 0.12 87.99 83.91 82.39 0.41 0.05 0.05 fams−ace2 99
100 3D−JIGSAW_AEP 82.60 80.47 83.16 -0.50 -0.13 0.49 86.03 83.74 84.31 -0.23 0.00 0.52 3D−JIGSAW_AEP 100
101 FFASstandard 82.60 79.66 79.74 -0.50 -0.26 -0.18 87.99 85.29 82.85 0.41 0.44 0.16 FFASstandard 101
102 rehtnap 82.35 78.11 72.47 -0.55 -0.52 -1.60 85.54 82.27 78.46 -0.39 -0.41 -0.93 rehtnap 102
103 Kolinski 82.11 79.66 78.54 -0.60 -0.26 -0.42 82.11 79.66 78.54 -1.52 -1.15 -0.91 Kolinski 103
104 POEMQA 82.11 77.21 84.32 -0.60 -0.67 0.72 82.11 77.21 84.32 -1.52 -1.84 0.52 POEMQA 104
105 Ozkan−Shell 81.37 74.67 78.58 -0.76 -1.08 -0.41 81.37 77.53 79.58 -1.76 -1.75 -0.65 Ozkan−Shell 105
106 MULTICOM−CMFR 80.15 77.21 70.78 -1.02 -0.67 -1.94 81.13 79.82 70.94 -1.84 -1.10 -2.79 MULTICOM−CMFR 106
107 DBAKER 79.90 76.14 81.17 -1.07 -0.84 0.10 89.71 87.58 85.00 0.98 1.08 0.69 DBAKER 107
108 JIVE08 78.68 73.94 77.19 -1.33 -1.20 -0.68 84.56 83.25 77.45 -0.72 -0.14 -1.18 JIVE08 108
109 StruPPi 77.94 75.33 74.86 -1.48 -0.97 -1.14 77.94 75.33 74.86 -2.89 -2.37 -1.82 StruPPi 109
110 SAM−T06−server 77.45 70.10 79.66 -1.58 -1.84 -0.20 86.28 84.15 82.28 -0.15 0.12 0.02 SAM−T06−server 110
111 OLGAFS 77.21 61.19 62.99 -1.63 -3.30 -3.46 81.62 81.29 74.79 -1.68 -0.69 -1.84 OLGAFS 111
112 Fiser−M4T 76.72 76.72 61.90 -1.74 -0.75 -3.67 76.72 76.72 61.90 -3.29 -1.97 -5.03 Fiser−M4T 112
113 Distill 76.72 67.56 66.88 -1.74 -2.25 -2.70 76.72 69.94 66.88 -3.29 -3.88 -3.80 Distill 113
114 POEM 76.47 73.04 80.23 -1.79 -1.35 -0.08 77.94 74.02 84.32 -2.89 -2.73 0.52 POEM 114
115 SMEG−CCP 72.30 66.58 58.01 -2.67 -2.41 -4.44 72.30 66.58 58.01 -4.74 -4.83 -6.00 SMEG−CCP 115
116 xianmingpan 70.34 61.19 68.45 -3.08 -3.30 -2.39 75.00 70.75 68.97 -3.86 -3.66 -3.28 xianmingpan 116
117 A−TASSER 68.87 61.52 72.57 -3.39 -3.25 -1.58 87.99 86.68 79.97 0.41 0.83 -0.55 A−TASSER 117
118 ProtAnG 64.22 56.86 63.05 -4.37 -4.01 -3.45 64.22 56.86 63.05 -7.40 -7.56 -4.75 ProtAnG 118
119 MUFOLD−MD 61.03 56.94 60.11 -5.04 -4.00 -4.03 61.03 56.94 60.11 -8.44 -7.54 -5.48 MUFOLD−MD 119
120 FALCON_CONSENSUS 51.72 44.69 61.36 -7.00 -6.02 -3.78 56.37 44.69 62.19 -9.97 -10.99 -4.96 FALCON_CONSENSUS 120
121 DistillSN 45.34 38.97 24.28 -8.35 -6.96 -11.04 45.34 38.97 24.28 -13.60 -12.60 -14.36 DistillSN 121
122 Zhou−SPARKS 42.65 34.15 55.10 -8.91 -7.75 -5.01 42.65 34.15 55.10 -14.48 -13.96 -6.72 Zhou−SPARKS 122
123 TWPPLAB 40.20 33.66 37.72 -9.43 -7.83 -8.41 40.20 33.66 37.72 -15.29 -14.10 -11.03 TWPPLAB 123
124 RBO−Proteus 38.23 28.92 57.05 -9.84 -8.61 -4.62 39.46 37.17 57.05 -15.53 -13.11 -6.23 RBO−Proteus 124
125 FLOUDAS 33.09 31.29 43.77 -10.92 -8.22 -7.23 55.88 46.41 51.93 -10.14 -10.51 -7.50 FLOUDAS 125
126 keasar 30.64 26.39 48.30 -11.44 -9.03 -6.34 83.82 80.39 79.15 -0.96 -0.94 -0.76 keasar 126
127 MeilerLabRene 28.68 23.69 44.06 -11.85 -9.47 -7.17 50.73 36.36 51.44 -11.83 -13.34 -7.63 MeilerLabRene 127
128 BHAGEERATH 25.49 23.12 41.20 -12.52 -9.57 -7.73 27.21 25.73 42.22 -19.55 -16.33 -9.91 BHAGEERATH 128
129 RANDOM 24.90 20.72 24.90 -12.65 -9.96 -10.92 24.90 20.72 24.90 -20.31 -17.74 -14.20 RANDOM 129
130 dill_ucsf 24.27 19.53 14.65 -12.78 -10.16 -12.93 24.27 19.53 14.65 -20.52 -18.07 -16.74 dill_ucsf 130
131 LOOPP_Server 24.02 23.86 11.99 -12.83 -9.45 -13.45 84.56 82.44 77.19 -0.72 -0.36 -1.24 LOOPP_Server 131
132 mahmood−torda−server 21.57 17.48 20.08 -13.35 -10.50 -11.87 21.81 18.38 21.13 -21.33 -18.40 -15.14 mahmood−torda−server 132
133 schenk−torda−server 21.08 15.93 7.82 -13.45 -10.75 -14.27 23.77 21.24 14.84 -20.68 -17.59 -16.70 schenk−torda−server 133
134 FEIG_REFINE                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 FEIG_REFINE 134
135 FrankensteinLong                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 FrankensteinLong 135
136 HCA                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 HCA 136
137 Handl−Lovell                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 Handl−Lovell 137
138 KudlatyPredHuman                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 KudlatyPredHuman 138
139 Linnolt−UH−CMB                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 Linnolt−UH−CMB 139
140 NIM2                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 NIM2 140
141 Nano_team                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 Nano_team 141
142 NirBenTal                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 NirBenTal 142
143 PHAISTOS                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 PHAISTOS 143
144 POISE                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 POISE 144
145 PZ−UAM                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 PZ−UAM 145
146 ProteinShop                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 ProteinShop 146
147 RPFM                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 RPFM 147
148 SAINT1                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 SAINT1 148
149 Sasaki−Cetin−Sasai                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 Sasaki−Cetin−Sasai 149
150 Scheraga                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 Scheraga 150
151 ShakAbInitio                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 ShakAbInitio 151
152 UCDavisGenome                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 UCDavisGenome 152
153 Wolfson−FOBIA                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 Wolfson−FOBIA 153
154 Wolynes                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 Wolynes 154
155 YASARARefine                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 YASARARefine 155
156 dill_ucsf_extended                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 dill_ucsf_extended 156
157 igor                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 igor 157
158 jacobson                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 jacobson 158
159 mumssp                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 mumssp 159
160 psiphifoldings                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 psiphifoldings 160
161 ricardo                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 ricardo 161
162 rivilo                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 rivilo 162
163 sessions                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 sessions 163
164 taylor                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 taylor 164
165 test_http_server_01                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 test_http_server_01 165
166 tripos_08                   -12.65 -9.96 -10.92                   -20.31 -17.74 -14.20 tripos_08 166