T0498

Human/Server Targets
387 389 391 393
395 396 397 399
401 403 405 407
409 411 413 415
417 419 421 423
425 427 429 431
434 437 440 443
446 449 451 454
457 460 462 464
465 466 467 468
469 471 473 474
476 480 482 484
487 489 492 493
495 496 498 499
500

T0498

artificial protein L1c expressed in Escherichia coli

Target type: Human/Server

Target sequence:

>T0498 L1c, E coli, 56 residues
TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE

Structure:
Method: NMR
Determined by: Bryan & Orban
PDB ID: 2jws
(not the target, but close)

jumping through 498 NMR models
Jumping through 20 NMR models of

all 20 498 NMR models
All 20 superimposed NMR models of

PyMOL of 2jws

Domains:  PyMOL of domains

Single domain protein with poorly structured termini. Structurally variable regions were removed from NMR models for evaluation of predictions.

Structure classification:

Left-handed three-helical bundle: Immunoglobulin-binding domain of protein A

2jws_1 cartoon
Cartoon diagram of 498: model 1 residues 6-54

CASP category:

Comparative modeling:hard:a very difficult target as the sequence is highly similar to Immunoglobulin-binding domains of proteins G and L: 1pgx , but the fold is different.

Closest templates:

Good resolution X-ray structures of protein A, e.g. 2j5y

Target sequence - PDB file inconsistencies:

T0498    2jws.pdb    T0498.pdb    PyMOL    PyMOL of domains    

T0498    1 TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE 56
           ******||||||||||||||||||:||||||||||||||||||||||||:||||**
2jwsA    1 TTYKLILNLKQAKEEAIKELVDAGIAEKYIKLIANAKTVEGVWTLKDEILTFTVTE 56

Residue change log: change 25 I to T; change 50 L to K; remove 1-TTYKLI-6, 55-TE-56 by 3.5Å SD cutoff;

Single domain protein: target 7-54 ; pdb 7-54

Sequence classification:

N/A for artifical designed protein.

Comments:

This artificial protein sequence is very similar to T0499 (just 3 amino acids differ), but was designed to have a drastically different fold 1).

T0498 TTYKLILNLKQAKEEAIKELVDAGTAEKYIKLIANAKTVEGVWTLKDEIKTFTVTE

T0499 TTYKLILNLKQAKEEAIKEAVDAGTAEKYFKLIANAKTVEGVWTYKDEIKTFTVTE

1pgx  TTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

1zxg  MYYLVVNKQQNAFYEVLNMPNLNEDQRNAFIQSLKDDPSQSANVLAEAQKLNDVQA

1zxh  MYYLVVNKGQNAFYETLTKAVDAETARNAFIQSLKDDGVQGVWTYDDATKTFTVQA

Server predictions:

T0498:pdb 7-54:seq 7-54:CM_hard;   alignment

distribution of first scores
First models for T0498: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0498 T0498 T0498 T0498
First score First Z-score Best score Best Z-score
1 FEIG 85.42 78.47 81.39 4.23 3.82 4.05 85.42 78.47 81.39 3.60 3.29 3.40 FEIG 1
2 HHpred5 84.90 84.20 84.76 4.18 4.33 4.31 84.90 84.20 84.76 3.56 3.75 3.62 HHpred5 2
3 DBAKER 83.85 82.47 80.34 4.08 4.18 3.97 83.85 82.47 82.63 3.48 3.61 3.48 DBAKER 3
4 HHpred4 83.85 81.08 80.54 4.08 4.05 3.99 83.85 81.08 80.54 3.48 3.50 3.34 HHpred4 4
5 IBT_LT 83.33 83.33 81.14 4.04 4.25 4.03 83.33 83.33 81.14 3.43 3.68 3.38 IBT_LT 5
6 Softberry 82.29 81.60 78.44 3.94 4.10 3.83 82.29 81.60 78.44 3.35 3.54 3.20 Softberry 6
7 FOLDpro 76.56 74.48 69.76 3.41 3.47 3.18 82.81 82.12 80.39 3.39 3.58 3.33 FOLDpro 7
8 MidwayFolding 73.44 67.53 62.96 3.12 2.86 2.67 73.44 67.53 62.96 2.62 2.41 2.19 MidwayFolding 8
9 Bilab−UT 43.75 35.76 44.46 0.37 0.05 1.29 43.75 36.28 44.46 0.19 -0.09 0.98 Bilab−UT 9
10 MeilerLabRene 42.71 37.15 44.50 0.27 0.18 1.29 57.81 56.42 59.59 1.34 1.52 1.97 MeilerLabRene 10
11 RANDOM 42.10 35.33 42.10 0.22 0.01 1.11 42.10 35.33 42.10 0.05 -0.16 0.82 RANDOM 11
12 schenk−torda−server 41.15 36.28 42.74 0.13 0.10 1.16 43.23 36.63 42.74 0.14 -0.06 0.86 schenk−torda−server 12
13 POEM 39.06 32.99 26.88 -0.07 -0.19 -0.03 39.06 34.55 28.07 -0.20 -0.23 -0.10 POEM 13
14 FALCON_CONSENSUS 38.02 35.24 24.82 -0.16 0.01 -0.19 38.54 35.24 25.26 -0.24 -0.17 -0.28 FALCON_CONSENSUS 14
15 Distill 38.02 34.55 23.78 -0.16 -0.05 -0.26 38.54 34.55 24.70 -0.24 -0.23 -0.32 Distill 15
16 POEMQA 38.02 33.68 26.67 -0.16 -0.13 -0.05 38.54 34.38 28.07 -0.24 -0.24 -0.10 POEMQA 16
17 ABIpro 37.50 33.33 26.16 -0.21 -0.16 -0.09 37.50 33.33 26.16 -0.33 -0.32 -0.22 ABIpro 17
18 Zhang−Server 37.50 33.16 22.75 -0.21 -0.18 -0.34 37.50 33.16 23.36 -0.33 -0.34 -0.40 Zhang−Server 18
19 LOOPP_Server 37.50 32.99 23.87 -0.21 -0.19 -0.26 37.50 35.07 26.50 -0.33 -0.19 -0.20 LOOPP_Server 19
20 mufold 37.50 32.81 22.25 -0.21 -0.21 -0.38 37.50 32.81 23.40 -0.33 -0.37 -0.40 mufold 20
21 Zico 37.50 32.47 23.43 -0.21 -0.24 -0.29 37.50 32.47 24.11 -0.33 -0.39 -0.36 Zico 21
22 ZicoFullSTP 37.50 32.47 23.43 -0.21 -0.24 -0.29 37.50 32.47 23.80 -0.33 -0.39 -0.38 ZicoFullSTP 22
23 ZicoFullSTPFullData 37.50 32.47 23.43 -0.21 -0.24 -0.29 37.50 32.47 23.80 -0.33 -0.39 -0.38 ZicoFullSTPFullData 23
24 CpHModels 37.50 32.29 28.53 -0.21 -0.25 0.09 37.50 32.29 28.53 -0.33 -0.41 -0.07 CpHModels 24
25 MULTICOM−RANK 37.50 32.12 23.47 -0.21 -0.27 -0.29 37.50 32.12 23.47 -0.33 -0.42 -0.40 MULTICOM−RANK 25
26 MULTICOM−CLUSTER 37.50 32.12 23.37 -0.21 -0.27 -0.30 37.50 32.47 23.67 -0.33 -0.39 -0.38 MULTICOM−CLUSTER 26
27 SAMUDRALA 37.50 32.12 23.34 -0.21 -0.27 -0.30 37.50 32.12 23.43 -0.33 -0.42 -0.40 SAMUDRALA 27
28 LEE 37.50 32.12 23.29 -0.21 -0.27 -0.30 37.50 32.47 23.65 -0.33 -0.39 -0.39 LEE 28
29 MUProt 37.50 32.12 23.64 -0.21 -0.27 -0.28 37.50 32.12 23.64 -0.33 -0.42 -0.39 MUProt 29
30 3DShotMQ 37.50 32.12 23.40 -0.21 -0.27 -0.29 37.50 32.12 23.40 -0.33 -0.42 -0.40 3DShotMQ 30
31 Wolfson−FOBIA 37.50 32.12 23.78 -0.21 -0.27 -0.26 37.50 32.12 23.78 -0.33 -0.42 -0.38 Wolfson−FOBIA 31
32 TJ_Jiang 37.50 31.77 22.95 -0.21 -0.30 -0.33 37.50 32.12 24.28 -0.33 -0.42 -0.34 TJ_Jiang 32
33 huber−torda−server 37.50 31.60 22.37 -0.21 -0.31 -0.37 38.54 34.03 23.39 -0.24 -0.27 -0.40 huber−torda−server 33
34 3Dpro 37.50 31.60 24.09 -0.21 -0.31 -0.24 37.50 32.47 24.09 -0.33 -0.39 -0.36 3Dpro 34
35 3DShot2 37.50 31.60 22.38 -0.21 -0.31 -0.37 37.50 31.60 22.38 -0.33 -0.46 -0.47 3DShot2 35
36 MUFOLD−MD 37.50 31.60 26.17 -0.21 -0.31 -0.09 37.50 34.20 26.17 -0.33 -0.26 -0.22 MUFOLD−MD 36
37 Sternberg 37.50 31.25 23.35 -0.21 -0.35 -0.30 37.50 31.25 23.35 -0.33 -0.49 -0.41 Sternberg 37
38 Phyre_de_novo 37.50 31.25 23.35 -0.21 -0.35 -0.30 37.50 33.51 23.35 -0.33 -0.31 -0.41 Phyre_de_novo 38
39 AMU−Biology 37.50 30.90 22.91 -0.21 -0.38 -0.33 37.50 31.94 24.13 -0.33 -0.44 -0.35 AMU−Biology 39
40 Zhang 37.50 30.21 23.80 -0.21 -0.44 -0.26 37.50 34.03 24.16 -0.33 -0.27 -0.35 Zhang 40
41 mahmood−torda−server 36.98 35.42 40.92 -0.26 0.02 1.02 41.15 35.42 40.92 -0.03 -0.16 0.75 mahmood−torda−server 41
42 HHpred2 36.98 35.24 21.70 -0.26 0.01 -0.42 36.98 35.24 21.70 -0.37 -0.17 -0.51 HHpred2 42
43 TASSER 36.98 35.07 22.66 -0.26 -0.01 -0.35 38.54 35.07 23.39 -0.24 -0.19 -0.40 TASSER 43
44 ACOMPMOD 36.98 34.20 23.52 -0.26 -0.09 -0.28 40.62 34.20 31.90 -0.07 -0.26 0.15 ACOMPMOD 44
45 DelCLab 36.98 34.03 22.28 -0.26 -0.10 -0.38 36.98 35.59 22.63 -0.37 -0.14 -0.45 DelCLab 45
46 LevittGroup 36.98 32.29 22.41 -0.26 -0.25 -0.37 37.50 32.99 22.77 -0.33 -0.35 -0.44 LevittGroup 46
47 FAMSD 36.98 32.29 22.43 -0.26 -0.25 -0.37 36.98 35.42 23.42 -0.37 -0.16 -0.40 FAMSD 47
48 MULTICOM 36.98 32.29 23.18 -0.26 -0.25 -0.31 37.50 32.47 23.39 -0.33 -0.39 -0.40 MULTICOM 48
49 mariner1 36.98 32.12 23.78 -0.26 -0.27 -0.26 36.98 34.72 25.99 -0.37 -0.21 -0.23 mariner1 49
50 SAM−T08−server 36.98 31.94 23.15 -0.26 -0.28 -0.31 36.98 32.81 23.55 -0.37 -0.37 -0.39 SAM−T08−server 50
51 Elofsson 36.98 31.94 23.39 -0.26 -0.28 -0.29 37.50 34.90 23.82 -0.33 -0.20 -0.37 Elofsson 51
52 xianmingpan 36.98 31.94 21.58 -0.26 -0.28 -0.43 36.98 31.94 21.58 -0.37 -0.44 -0.52 xianmingpan 52
53 Pcons_dot_net 36.98 31.94 22.94 -0.26 -0.28 -0.33 37.50 33.16 24.40 -0.33 -0.34 -0.34 Pcons_dot_net 53
54 BioSerf 36.98 31.94 22.87 -0.26 -0.28 -0.33 36.98 31.94 22.87 -0.37 -0.44 -0.44 BioSerf 54
55 forecast 36.98 31.94 22.89 -0.26 -0.28 -0.33 36.98 33.68 23.12 -0.37 -0.30 -0.42 forecast 55
56 keasar−server 36.98 31.77 23.99 -0.26 -0.30 -0.25 36.98 33.16 24.09 -0.37 -0.34 -0.36 keasar−server 56
57 PSI 36.98 31.77 21.77 -0.26 -0.30 -0.42 36.98 35.59 23.97 -0.37 -0.14 -0.36 PSI 57
58 FAMS−multi 36.98 31.60 22.27 -0.26 -0.31 -0.38 36.98 31.77 22.27 -0.37 -0.45 -0.48 FAMS−multi 58
59 fams−ace2 36.98 31.42 23.90 -0.26 -0.33 -0.26 38.02 33.51 23.90 -0.28 -0.31 -0.37 fams−ace2 59
60 BAKER−ROBETTA 36.98 31.42 24.84 -0.26 -0.33 -0.19 36.98 31.42 24.85 -0.37 -0.48 -0.31 BAKER−ROBETTA 60
61 SAM−T08−human 36.98 31.25 23.91 -0.26 -0.35 -0.26 37.50 31.60 23.91 -0.33 -0.46 -0.37 SAM−T08−human 61
62 Fiser−M4T 36.98 31.25 21.84 -0.26 -0.35 -0.41 36.98 31.25 21.84 -0.37 -0.49 -0.50 Fiser−M4T 62
63 pipe_int 36.98 30.38 22.44 -0.26 -0.42 -0.37 36.98 34.03 23.55 -0.37 -0.27 -0.39 pipe_int 63
64 pro−sp3−TASSER 36.98 30.38 22.44 -0.26 -0.42 -0.37 38.54 32.99 23.66 -0.24 -0.35 -0.38 pro−sp3−TASSER 64
65 FFASstandard 36.98 30.21 23.96 -0.26 -0.44 -0.25 36.98 33.33 25.44 -0.37 -0.32 -0.27 FFASstandard 65
66 Abagyan 36.98 30.21 22.47 -0.26 -0.44 -0.36 37.50 32.29 23.03 -0.33 -0.41 -0.43 Abagyan 66
67 Frankenstein 36.98 29.69 22.99 -0.26 -0.48 -0.32 37.50 32.12 24.01 -0.33 -0.42 -0.36 Frankenstein 67
68 FrankensteinLong 36.98 29.69 23.05 -0.26 -0.48 -0.32 37.50 32.12 24.13 -0.33 -0.42 -0.35 FrankensteinLong 68
69 MULTICOM−CMFR 36.98 29.34 23.48 -0.26 -0.51 -0.29 38.54 34.20 24.69 -0.24 -0.26 -0.32 MULTICOM−CMFR 69
70 MULTICOM−REFINE 36.98 29.34 23.48 -0.26 -0.51 -0.29 37.50 32.47 23.57 -0.33 -0.39 -0.39 MULTICOM−REFINE 70
71 GeneSilico 36.98 29.34 23.48 -0.26 -0.51 -0.29 38.54 35.07 23.57 -0.24 -0.19 -0.39 GeneSilico 71
72 GS−KudlatyPred 36.46 35.07 23.06 -0.31 -0.01 -0.32 36.46 35.07 23.06 -0.41 -0.19 -0.42 GS−KudlatyPred 72
73 Bates_BMM 36.46 35.07 22.73 -0.31 -0.01 -0.34 36.98 35.07 23.48 -0.37 -0.19 -0.40 Bates_BMM 73
74 RBO−Proteus 36.46 34.38 21.99 -0.31 -0.07 -0.40 36.46 34.38 22.52 -0.41 -0.24 -0.46 RBO−Proteus 74
75 FUGUE_KM 36.46 33.85 23.15 -0.31 -0.12 -0.31 37.50 33.85 30.03 -0.33 -0.28 0.03 FUGUE_KM 75
76 StruPPi 36.46 32.81 22.18 -0.31 -0.21 -0.38 37.50 32.81 26.02 -0.33 -0.37 -0.23 StruPPi 76
77 EB_AMU_Physics 36.46 32.47 24.16 -0.31 -0.24 -0.24 36.98 35.59 24.16 -0.37 -0.14 -0.35 EB_AMU_Physics 77
78 Pcons_multi 36.46 32.12 23.33 -0.31 -0.27 -0.30 37.50 32.99 23.87 -0.33 -0.35 -0.37 Pcons_multi 78
79 3DShot1 36.46 31.94 22.62 -0.31 -0.28 -0.35 36.46 31.94 22.62 -0.41 -0.44 -0.45 3DShot1 79
80 fleil 36.46 31.94 22.89 -0.31 -0.28 -0.33 36.46 31.94 23.07 -0.41 -0.44 -0.42 fleil 80
81 RAPTOR 36.46 31.77 22.99 -0.31 -0.30 -0.32 36.98 35.59 24.05 -0.37 -0.14 -0.36 RAPTOR 81
82 METATASSER 36.46 31.60 21.46 -0.31 -0.31 -0.44 38.54 33.33 21.89 -0.24 -0.32 -0.50 METATASSER 82
83 Hao_Kihara 36.46 31.60 21.78 -0.31 -0.31 -0.41 37.50 35.59 24.03 -0.33 -0.14 -0.36 Hao_Kihara 83
84 Kolinski 36.46 31.42 23.92 -0.31 -0.33 -0.25 36.46 31.60 23.92 -0.41 -0.46 -0.37 Kolinski 84
85 OLGAFS 36.46 31.42 22.11 -0.31 -0.33 -0.39 36.46 32.12 22.94 -0.41 -0.42 -0.43 OLGAFS 85
86 FFASflextemplate 36.46 31.42 23.04 -0.31 -0.33 -0.32 36.46 34.90 23.35 -0.41 -0.20 -0.41 FFASflextemplate 86
87 FFASsuboptimal 36.46 31.42 23.04 -0.31 -0.33 -0.32 36.46 33.68 24.04 -0.41 -0.30 -0.36 FFASsuboptimal 87
88 tripos_08 36.46 31.42 24.77 -0.31 -0.33 -0.19 36.98 34.38 24.77 -0.37 -0.24 -0.31 tripos_08 88
89 MUFOLD−Server 36.46 31.25 22.06 -0.31 -0.35 -0.39 36.98 31.25 22.44 -0.37 -0.49 -0.46 MUFOLD−Server 89
90 McGuffin 36.46 31.25 22.06 -0.31 -0.35 -0.39 37.50 32.12 23.91 -0.33 -0.42 -0.37 McGuffin 90
91 NIM2 36.46 31.08 22.70 -0.31 -0.36 -0.35 36.46 31.08 22.70 -0.41 -0.50 -0.45 NIM2 91
92 Chicken_George 36.46 31.08 22.57 -0.31 -0.36 -0.36 79.69 73.78 74.80 3.13 2.91 2.96 Chicken_George 92
93 GeneSilicoMetaServer 36.46 30.73 23.02 -0.31 -0.39 -0.32 37.50 31.25 23.98 -0.33 -0.49 -0.36 GeneSilicoMetaServer 93
94 GS−MetaServer2 36.46 30.38 22.12 -0.31 -0.42 -0.39 36.46 35.42 23.95 -0.41 -0.16 -0.37 GS−MetaServer2 94
95 MUSTER 36.46 30.38 23.51 -0.31 -0.42 -0.29 38.02 34.90 26.16 -0.28 -0.20 -0.22 MUSTER 95
96 FALCON 36.46 30.21 22.76 -0.31 -0.44 -0.34 39.58 31.77 26.00 -0.16 -0.45 -0.23 FALCON 96
97 circle 36.46 27.60 23.80 -0.31 -0.67 -0.26 38.02 33.33 24.50 -0.28 -0.32 -0.33 circle 97
98 Poing 35.94 33.51 20.79 -0.35 -0.15 -0.49 37.50 33.51 23.21 -0.33 -0.31 -0.41 Poing 98
99 Phyre2 35.94 33.51 20.79 -0.35 -0.15 -0.49 37.50 33.51 23.21 -0.33 -0.31 -0.41 Phyre2 99
100 Phragment 35.94 33.51 20.79 -0.35 -0.15 -0.49 37.50 33.51 23.21 -0.33 -0.31 -0.41 Phragment 100
101 rehtnap 35.94 32.99 25.29 -0.35 -0.19 -0.15 38.02 33.16 25.29 -0.28 -0.34 -0.28 rehtnap 101
102 mGenTHREADER 35.94 32.81 23.55 -0.35 -0.21 -0.28 35.94 32.81 23.55 -0.46 -0.37 -0.39 mGenTHREADER 102
103 keasar 35.94 32.81 22.06 -0.35 -0.21 -0.39 36.98 33.51 24.85 -0.37 -0.31 -0.31 keasar 103
104 SAM−T02−server 35.94 32.81 23.55 -0.35 -0.21 -0.28 36.98 34.03 23.55 -0.37 -0.27 -0.39 SAM−T02−server 104
105 Jiang_Zhu 35.94 32.81 22.60 -0.35 -0.21 -0.35 35.94 32.81 22.60 -0.46 -0.37 -0.45 Jiang_Zhu 105
106 3D−JIGSAW_AEP 35.94 31.94 21.79 -0.35 -0.28 -0.41 36.46 31.94 21.80 -0.41 -0.44 -0.51 3D−JIGSAW_AEP 106
107 SMEG−CCP 35.94 31.77 20.49 -0.35 -0.30 -0.51 35.94 31.77 20.49 -0.46 -0.45 -0.59 SMEG−CCP 107
108 SAM−T06−server 35.94 31.77 21.82 -0.35 -0.30 -0.41 36.98 32.81 23.55 -0.37 -0.37 -0.39 SAM−T06−server 108
109 3D−JIGSAW_V3 35.94 31.25 21.33 -0.35 -0.35 -0.45 36.46 31.25 21.49 -0.41 -0.49 -0.53 3D−JIGSAW_V3 109
110 PS2−server 35.94 30.90 23.91 -0.35 -0.38 -0.26 38.02 34.38 23.91 -0.28 -0.24 -0.37 PS2−server 110
111 COMA−M 35.94 30.90 23.86 -0.35 -0.38 -0.26 35.94 33.33 23.96 -0.46 -0.32 -0.37 COMA−M 111
112 mumssp 35.94 30.90 22.76 -0.35 -0.38 -0.34 35.94 30.90 22.76 -0.46 -0.52 -0.44 mumssp 112
113 PS2−manual 35.94 30.90 23.91 -0.35 -0.38 -0.26 38.02 34.38 23.91 -0.28 -0.24 -0.37 PS2−manual 113
114 COMA 35.94 30.56 24.04 -0.35 -0.41 -0.25 80.21 78.12 76.33 3.18 3.26 3.07 COMA 114
115 nFOLD3 35.94 30.21 21.18 -0.35 -0.44 -0.46 36.98 34.03 22.91 -0.37 -0.27 -0.43 nFOLD3 115
116 YASARA 35.94 30.21 21.70 -0.35 -0.44 -0.42 36.98 31.94 23.33 -0.37 -0.44 -0.41 YASARA 116
117 JIVE08 35.42 33.85 19.07 -0.40 -0.12 -0.62 36.46 33.85 21.44 -0.41 -0.28 -0.53 JIVE08 117
118 PRI−Yang−KiharA 35.42 32.81 22.96 -0.40 -0.21 -0.33 35.42 32.81 22.96 -0.50 -0.37 -0.43 PRI−Yang−KiharA 118
119 TWPPLAB 35.42 32.81 21.84 -0.40 -0.21 -0.41 35.42 32.81 21.84 -0.50 -0.37 -0.50 TWPPLAB 119
120 Ozkan−Shell 35.42 31.25 20.97 -0.40 -0.35 -0.48 36.46 33.33 20.97 -0.41 -0.32 -0.56 Ozkan−Shell 120
121 FLOUDAS 35.42 30.90 25.73 -0.40 -0.38 -0.12 35.42 32.64 27.72 -0.50 -0.38 -0.12 FLOUDAS 121
122 Pushchino 35.42 30.38 21.29 -0.40 -0.42 -0.45 35.42 30.38 21.29 -0.50 -0.56 -0.54 Pushchino 122
123 A−TASSER 34.90 32.47 18.80 -0.45 -0.24 -0.64 35.94 35.07 22.96 -0.46 -0.19 -0.43 A−TASSER 123
124 Jones−UCL 34.90 31.42 22.22 -0.45 -0.33 -0.38 36.98 31.60 22.46 -0.37 -0.46 -0.46 Jones−UCL 124
125 DistillSN 34.90 30.04 22.93 -0.45 -0.45 -0.33 42.71 34.38 26.29 0.10 -0.24 -0.21 DistillSN 125
126 RPFM 32.81 25.52 23.91 -0.64 -0.85 -0.26 57.81 40.10 52.08 1.34 0.22 1.48 RPFM 126
127 Pcons_local 30.73 23.79 13.42 -0.84 -1.00 -1.04 30.73 23.79 15.89 -0.88 -1.09 -0.89 Pcons_local 127
128 BHAGEERATH                   0.22 0.01 1.11                   0.05 -0.16 0.82 BHAGEERATH 128
129 CBSU                   0.22 0.01 1.11                   0.05 -0.16 0.82 CBSU 129
130 FEIG_REFINE                   0.22 0.01 1.11                   0.05 -0.16 0.82 FEIG_REFINE 130
131 HCA                   0.22 0.01 1.11                   0.05 -0.16 0.82 HCA 131
132 Handl−Lovell                   0.22 0.01 1.11                   0.05 -0.16 0.82 Handl−Lovell 132
133 KudlatyPredHuman                   0.22 0.01 1.11                   0.05 -0.16 0.82 KudlatyPredHuman 133
134 LEE−SERVER                   0.22 0.01 1.11                   0.05 -0.16 0.82 LEE−SERVER 134
135 Linnolt−UH−CMB                   0.22 0.01 1.11                   0.05 -0.16 0.82 Linnolt−UH−CMB 135
136 Nano_team                   0.22 0.01 1.11                   0.05 -0.16 0.82 Nano_team 136
137 NirBenTal                   0.22 0.01 1.11                   0.05 -0.16 0.82 NirBenTal 137
138 PHAISTOS                   0.22 0.01 1.11                   0.05 -0.16 0.82 PHAISTOS 138
139 POISE                   0.22 0.01 1.11                   0.05 -0.16 0.82 POISE 139
140 PZ−UAM                   0.22 0.01 1.11                   0.05 -0.16 0.82 PZ−UAM 140
141 ProtAnG                   0.22 0.01 1.11                   0.05 -0.16 0.82 ProtAnG 141
142 ProteinShop                   0.22 0.01 1.11                   0.05 -0.16 0.82 ProteinShop 142
143 SAINT1                   0.22 0.01 1.11                   0.05 -0.16 0.82 SAINT1 143
144 SHORTLE                   0.22 0.01 1.11                   0.05 -0.16 0.82 SHORTLE 144
145 Sasaki−Cetin−Sasai                   0.22 0.01 1.11                   0.05 -0.16 0.82 Sasaki−Cetin−Sasai 145
146 Scheraga                   0.22 0.01 1.11                   0.05 -0.16 0.82 Scheraga 146
147 ShakAbInitio                   0.22 0.01 1.11                   0.05 -0.16 0.82 ShakAbInitio 147
148 TsaiLab                   0.22 0.01 1.11                   0.05 -0.16 0.82 TsaiLab 148
149 UCDavisGenome                   0.22 0.01 1.11                   0.05 -0.16 0.82 UCDavisGenome 149
150 Wolynes                   0.22 0.01 1.11                   0.05 -0.16 0.82 Wolynes 150
151 YASARARefine                   0.22 0.01 1.11                   0.05 -0.16 0.82 YASARARefine 151
152 Zhou−SPARKS                   0.22 0.01 1.11                   0.05 -0.16 0.82 Zhou−SPARKS 152
153 dill_ucsf                   0.22 0.01 1.11                   0.05 -0.16 0.82 dill_ucsf 153
154 dill_ucsf_extended                   0.22 0.01 1.11                   0.05 -0.16 0.82 dill_ucsf_extended 154
155 fais−server                   0.22 0.01 1.11                   0.05 -0.16 0.82 fais−server 155
156 fais@hgc                   0.22 0.01 1.11                   0.05 -0.16 0.82 fais@hgc 156
157 igor                   0.22 0.01 1.11                   0.05 -0.16 0.82 igor 157
158 jacobson                   0.22 0.01 1.11                   0.05 -0.16 0.82 jacobson 158
159 mti                   0.22 0.01 1.11                   0.05 -0.16 0.82 mti 159
160 panther_server                   0.22 0.01 1.11                   -0.37 -0.16 0.82 panther_server 160
161 psiphifoldings                   0.22 0.01 1.11                   0.05 -0.16 0.82 psiphifoldings 161
162 ricardo                   0.22 0.01 1.11                   0.05 -0.16 0.82 ricardo 162
163 rivilo                   0.22 0.01 1.11                   0.05 -0.16 0.82 rivilo 163
164 sessions                   0.22 0.01 1.11                   0.05 -0.16 0.82 sessions 164
165 taylor                   0.22 0.01 1.11                   0.05 -0.16 0.82 taylor 165
166 test_http_server_01                   0.22 0.01 1.11                   0.05 -0.16 0.82 test_http_server_01 166

1) He Y, Chen Y, Alexander P, Bryan PN, Orban J. (2008) "NMR structures of two designed proteins with high sequence identity but different fold and function." Proc Natl Acad Sci U S A. Sep 16. [Epub ahead of print], PMID: 18796611