T0440

Human/Server Targets
387 389 391 393
395 396 397 399
401 403 405 407
409 411 413 415
417 419 421 423
425 427 429 431
434 437 440 443
446 449 451 454
457 460 462 464
465 466 467 468
469 471 473 474
476 480 482 484
487 489 492 493
495 496 498 499
500

T0440

putative histidinol phosphatase HisK from Listeria monocytogenes

Target type: Human/Server

Target sequence:

>T0440 Q4EIC3_LISMO, Listeria monocytogenes, 275 residues
MKRDGHTHTEFCPHGTHDDVEEMVLKAIELDFDEYSIVEHAPLSSEFMKNTAGDKEAVTTASMAMSDLPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFTRDFLNEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGVKQSIEADLGLFKPRRMGHISLCQKFQQFFGEDTSDFSEEVMEKFRVILALVKKRDYELDFNTAGLFKPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQK

Structure:
Method: X-ray, res=2.1Å, R/Rfree=0.19/0.21
Determined by: NESG
PDB ID: 3dcp

3dcp_A cartoon
Cartoon diagram of 440: 3dcp chain A. Metals in the active site are shown as "dots".

PyMOL of 3dcp

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

7-stranded β/α barrel fold. This superfamily is homologous to metallo-dependent hydrolases from 8-stranded β/α barrel fold.

CASP category:

Comparative modeling:medium.

Closest templates:

2yxo.

Target sequence - PDB file inconsistencies:

T0440    3dcp.pdb    T0440.pdb    PyMOL    PyMOL of domains    

T0440    1 MKRDGHTHTEFCPHGTHDDVEEMVLKAIELDFDEYSIVEHAPLSSEFMKNTAGDKEAVTTASMAMSDLPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFTRDFLNEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGVKQSIEADLGLFKPRRMGHISLCQKFQQFFGEDTSDFSEEVMEKFRVILALVKKRDYELDFNTAGLFKPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQK-- 275
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~
3dcpA    1 MKRDGHTHTEFCPHGTHDDVEEMVLKAIELDFDEYSIVEHAPLSSEFMKNTAGDKEAVTTASMAMSDLPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFTRDFLNEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGVKQSIEADLGLFKPRRMGHISLCQKFQQFFGEDTSDFSEEVMEKFRVILALVKKRDYELDFNTAGLFKPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQKLE 277

Residue change log: change 1, 23, 48, 63, 65, 75, 179, 204, MSE to MET; remove 276-LE-277 as it is not present in target sequence;

Single domain protein: target 1-275 ; pdb 1-275

Sequence classification:

PHP domain in Pfam.

Server predictions:

T0440:pdb 1-275:seq 1-275:CM_medium;   alignment

distribution of first scores
First models for T0440: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0440 T0440 T0440 T0440
First score First Z-score Best score Best Z-score
1 ZicoFullSTPFullData 75.64 65.76 72.28 0.89 0.75 1.01 75.64 67.61 72.84 0.94 0.92 1.02 ZicoFullSTPFullData 1
2 GeneSilico 75.45 69.27 72.23 0.86 1.17 1.00 76.27 72.27 72.26 1.04 1.62 0.95 GeneSilico 2
3 A−TASSER 75.45 66.36 68.76 0.86 0.82 0.58 75.45 66.36 68.76 0.91 0.73 0.47 A−TASSER 3
4 HHpred5 75.36 68.15 73.02 0.85 1.03 1.09 75.36 68.15 73.02 0.90 1.00 1.05 HHpred5 4
5 ZicoFullSTP 75.36 67.61 72.84 0.85 0.97 1.07 75.64 67.61 72.84 0.94 0.92 1.02 ZicoFullSTP 5
6 IBT_LT 75.18 66.76 72.40 0.83 0.87 1.02 75.18 66.76 72.40 0.87 0.79 0.97 IBT_LT 6
7 SAM−T08−human 74.91 66.24 70.98 0.80 0.81 0.85 75.09 67.30 71.76 0.85 0.87 0.88 SAM−T08−human 7
8 HHpred2 74.91 65.09 72.38 0.80 0.67 1.02 74.91 65.09 72.38 0.83 0.54 0.96 HHpred2 8
9 Zhang 74.82 63.97 72.35 0.79 0.54 1.01 75.09 65.70 72.71 0.85 0.63 1.01 Zhang 9
10 MULTICOM 74.73 64.79 72.93 0.78 0.64 1.08 74.73 65.12 72.93 0.80 0.54 1.04 MULTICOM 10
11 HHpred4 74.64 63.36 71.12 0.77 0.47 0.87 74.64 63.36 71.12 0.78 0.27 0.79 HHpred4 11
12 3DShot1 74.55 68.48 68.10 0.76 1.07 0.50 74.55 68.48 68.10 0.77 1.05 0.38 3DShot1 12
13 Zhang−Server 74.45 67.36 71.85 0.75 0.94 0.95 75.73 67.67 72.40 0.95 0.93 0.97 Zhang−Server 13
14 Zico 74.45 67.12 71.57 0.75 0.91 0.92 75.64 67.61 72.84 0.94 0.92 1.02 Zico 14
15 3Dpro 74.45 65.24 70.86 0.75 0.69 0.83 74.45 65.24 70.86 0.75 0.56 0.76 3Dpro 15
16 3DShotMQ 74.45 61.97 68.90 0.75 0.30 0.60 74.45 61.97 68.90 0.75 0.06 0.49 3DShotMQ 16
17 pro−sp3−TASSER 74.36 66.18 70.27 0.74 0.80 0.76 75.27 66.18 71.82 0.88 0.70 0.89 pro−sp3−TASSER 17
18 fams−ace2 74.36 64.85 70.35 0.74 0.64 0.77 74.36 67.82 70.35 0.74 0.95 0.69 fams−ace2 18
19 LEE 73.73 65.67 70.47 0.67 0.74 0.79 74.82 65.67 71.82 0.81 0.62 0.89 LEE 19
20 nFOLD3 73.73 64.18 69.12 0.67 0.57 0.63 73.73 64.18 69.12 0.64 0.40 0.52 nFOLD3 20
21 METATASSER 73.73 62.45 70.86 0.67 0.36 0.83 73.73 65.36 70.86 0.64 0.58 0.76 METATASSER 21
22 LevittGroup 73.36 67.06 69.97 0.63 0.91 0.73 73.36 67.06 69.97 0.59 0.84 0.64 LevittGroup 22
23 Softberry 73.36 66.27 68.06 0.63 0.81 0.50 73.36 66.27 68.06 0.59 0.72 0.38 Softberry 23
24 TASSER 73.18 62.15 71.93 0.61 0.33 0.96 73.73 64.42 71.93 0.64 0.44 0.90 TASSER 24
25 Elofsson 73.09 64.97 69.68 0.60 0.66 0.69 74.00 66.00 70.51 0.69 0.67 0.71 Elofsson 25
26 Sternberg 73.09 64.30 69.02 0.60 0.58 0.61 73.09 64.30 69.02 0.54 0.42 0.51 Sternberg 26
27 mufold 73.00 66.21 68.58 0.58 0.81 0.56 74.36 67.48 71.30 0.74 0.90 0.82 mufold 27
28 ABIpro 72.91 66.42 68.62 0.57 0.83 0.57 75.64 68.15 73.02 0.94 1.00 1.05 ABIpro 28
29 Pcons_local 72.82 57.36 66.77 0.56 -0.24 0.34 72.82 64.48 66.77 0.50 0.44 0.20 Pcons_local 29
30 PRI−Yang−KiharA 72.64 61.91 68.45 0.54 0.30 0.55 72.64 61.91 68.45 0.47 0.06 0.43 PRI−Yang−KiharA 30
31 Poing 72.55 63.48 67.59 0.53 0.48 0.44 72.55 63.48 67.59 0.46 0.29 0.31 Poing 31
32 Phyre2 72.55 63.48 67.60 0.53 0.48 0.44 72.55 63.48 67.60 0.46 0.29 0.32 Phyre2 32
33 Phragment 72.55 63.48 67.60 0.53 0.48 0.44 72.55 63.48 67.60 0.46 0.29 0.32 Phragment 33
34 AMU−Biology 72.45 66.33 69.32 0.52 0.82 0.65 73.00 66.33 69.32 0.53 0.72 0.55 AMU−Biology 34
35 SAMUDRALA 71.82 64.30 65.67 0.45 0.58 0.21 71.82 67.42 65.92 0.35 0.89 0.09 SAMUDRALA 35
36 COMA 71.64 64.55 68.90 0.43 0.61 0.60 72.45 66.52 68.90 0.45 0.75 0.49 COMA 36
37 PS2−manual 71.64 63.55 68.07 0.43 0.49 0.50 72.09 63.97 68.07 0.39 0.37 0.38 PS2−manual 37
38 BAKER−ROBETTA 71.55 65.06 66.58 0.42 0.67 0.32 73.82 66.42 69.53 0.66 0.74 0.58 BAKER−ROBETTA 38
39 PS2−server 71.55 63.97 68.04 0.42 0.54 0.50 71.55 63.97 68.04 0.31 0.37 0.38 PS2−server 39
40 Jones−UCL 71.55 62.27 66.84 0.42 0.34 0.35 71.55 62.27 66.84 0.31 0.11 0.21 Jones−UCL 40
41 forecast 71.45 61.03 67.85 0.41 0.19 0.47 72.09 63.42 68.19 0.39 0.28 0.40 forecast 41
42 CpHModels 71.36 63.24 66.54 0.40 0.45 0.32 71.36 63.24 66.54 0.28 0.26 0.17 CpHModels 42
43 MULTICOM−REFINE 71.27 63.70 65.62 0.39 0.51 0.21 72.82 64.52 67.72 0.50 0.45 0.33 MULTICOM−REFINE 43
44 FAMS−multi 71.18 66.64 68.27 0.38 0.86 0.52 72.64 66.64 69.17 0.47 0.77 0.53 FAMS−multi 44
45 DBAKER 71.18 63.12 66.14 0.38 0.44 0.27 72.45 64.82 69.30 0.45 0.50 0.55 DBAKER 45
46 Fiser−M4T 71.18 62.94 65.58 0.38 0.42 0.20 71.18 62.94 65.58 0.25 0.21 0.04 Fiser−M4T 46
47 COMA−M 71.18 61.79 68.39 0.38 0.28 0.54 72.82 66.55 68.48 0.50 0.76 0.44 COMA−M 47
48 POEM 71.00 67.30 65.67 0.36 0.93 0.21 71.00 67.30 65.67 0.22 0.87 0.05 POEM 48
49 FEIG 71.00 66.21 65.50 0.36 0.81 0.19 73.64 68.12 68.91 0.63 1.00 0.49 FEIG 49
50 3D−JIGSAW_V3 70.91 67.39 62.96 0.35 0.95 -0.11 70.91 67.39 62.96 0.21 0.89 -0.31 3D−JIGSAW_V3 50
51 FFASsuboptimal 70.91 61.45 68.10 0.35 0.24 0.50 70.91 61.45 68.10 0.21 -0.01 0.38 FFASsuboptimal 51
52 Chicken_George 70.82 64.70 69.55 0.34 0.63 0.68 74.00 70.30 70.37 0.69 1.33 0.69 Chicken_George 52
53 GS−KudlatyPred 70.82 63.79 65.32 0.34 0.52 0.17 70.82 63.79 65.32 0.19 0.34 0.01 GS−KudlatyPred 53
54 MUProt 70.73 63.64 65.29 0.33 0.50 0.17 73.64 65.64 68.62 0.63 0.62 0.45 MUProt 54
55 Phyre_de_novo 70.55 64.42 68.49 0.30 0.59 0.55 72.55 64.42 68.49 0.46 0.44 0.44 Phyre_de_novo 55
56 Hao_Kihara 70.55 62.76 67.32 0.30 0.40 0.41 71.45 64.06 67.32 0.29 0.38 0.28 Hao_Kihara 56
57 circle 70.55 62.48 67.11 0.30 0.36 0.39 70.55 62.73 67.11 0.15 0.18 0.25 circle 57
58 FAMSD 70.45 64.58 66.26 0.29 0.61 0.28 72.18 67.21 66.97 0.40 0.86 0.23 FAMSD 58
59 MULTICOM−CMFR 70.36 62.24 65.13 0.28 0.34 0.15 73.45 65.76 67.99 0.60 0.64 0.37 MULTICOM−CMFR 59
60 NirBenTal 70.36 61.52 68.34 0.28 0.25 0.53 70.36 61.52 68.34 0.12 -0.00 0.42 NirBenTal 60
61 MUSTER 70.27 60.03 67.67 0.27 0.07 0.45 71.27 63.39 67.67 0.26 0.28 0.33 MUSTER 61
62 MULTICOM−RANK 70.18 62.61 68.24 0.26 0.38 0.52 72.73 67.03 68.83 0.49 0.83 0.48 MULTICOM−RANK 62
63 FALCON_CONSENSUS 70.18 59.94 67.22 0.26 0.06 0.40 70.18 60.85 67.22 0.09 -0.11 0.26 FALCON_CONSENSUS 63
64 FALCON 70.18 59.94 67.22 0.26 0.06 0.40 70.18 60.85 67.22 0.09 -0.11 0.26 FALCON 64
65 3D−JIGSAW_AEP 70.09 64.39 60.03 0.25 0.59 -0.46 70.18 64.79 60.25 0.09 0.49 -0.68 3D−JIGSAW_AEP 65
66 MULTICOM−CLUSTER 69.91 63.73 64.63 0.23 0.51 0.09 71.09 64.15 66.54 0.23 0.39 0.17 MULTICOM−CLUSTER 66
67 mGenTHREADER 69.55 59.36 61.54 0.19 -0.00 -0.28 69.55 59.36 61.54 -0.00 -0.33 -0.50 mGenTHREADER 67
68 McGuffin 69.55 58.03 64.77 0.19 -0.16 0.10 75.73 68.15 73.02 0.95 1.00 1.05 McGuffin 68
69 Jiang_Zhu 69.55 58.03 64.77 0.19 -0.16 0.10 69.55 58.03 64.77 -0.00 -0.53 -0.07 Jiang_Zhu 69
70 GS−MetaServer2 69.45 57.09 64.47 0.18 -0.27 0.07 69.45 57.09 64.47 -0.02 -0.67 -0.11 GS−MetaServer2 70
71 FUGUE_KM 69.27 60.42 61.26 0.16 0.12 -0.32 69.27 60.42 61.26 -0.05 -0.17 -0.54 FUGUE_KM 71
72 Bates_BMM 69.27 60.18 64.78 0.16 0.09 0.11 69.36 60.18 64.78 -0.03 -0.21 -0.07 Bates_BMM 72
73 pipe_int 69.27 58.09 64.85 0.16 -0.16 0.11 69.27 58.09 64.85 -0.05 -0.52 -0.06 pipe_int 73
74 BioSerf 69.18 55.79 68.65 0.15 -0.43 0.57 69.18 55.79 68.65 -0.06 -0.87 0.46 BioSerf 74
75 Bilab−UT 68.73 63.58 66.44 0.10 0.49 0.30 71.09 63.61 67.11 0.23 0.31 0.25 Bilab−UT 75
76 GeneSilicoMetaServer 68.64 54.70 62.78 0.09 -0.56 -0.13 69.45 61.70 64.47 -0.02 0.02 -0.11 GeneSilicoMetaServer 76
77 OLGAFS 68.18 63.52 58.47 0.03 0.49 -0.65 68.18 63.52 58.47 -0.22 0.30 -0.92 OLGAFS 77
78 CBSU 68.18 60.55 65.53 0.03 0.14 0.20 68.18 60.55 65.53 -0.22 -0.15 0.04 CBSU 78
79 TJ_Jiang 68.09 58.27 65.37 0.02 -0.13 0.18 71.09 66.06 66.73 0.23 0.68 0.20 TJ_Jiang 79
80 SAM−T06−server 67.73 55.18 67.35 -0.02 -0.50 0.41 67.73 55.18 67.35 -0.29 -0.96 0.28 SAM−T06−server 80
81 EB_AMU_Physics 66.82 60.94 62.54 -0.12 0.18 -0.16 66.82 60.94 62.54 -0.43 -0.09 -0.37 EB_AMU_Physics 81
82 fais−server 66.82 59.55 63.88 -0.12 0.02 -0.00 72.73 67.15 68.51 0.49 0.85 0.44 fais−server 82
83 Pushchino 66.64 51.67 53.83 -0.14 -0.91 -1.21 66.64 51.67 53.83 -0.45 -1.50 -1.55 Pushchino 83
84 keasar−server 66.36 56.18 65.16 -0.17 -0.38 0.15 72.27 63.58 69.47 0.42 0.31 0.57 keasar−server 84
85 FFASflextemplate 66.36 55.61 65.85 -0.17 -0.45 0.23 66.36 55.61 65.85 -0.50 -0.90 0.08 FFASflextemplate 85
86 tripos_08 66.18 60.55 58.69 -0.19 0.14 -0.62 66.18 60.55 58.69 -0.53 -0.15 -0.89 tripos_08 86
87 SAM−T08−server 65.64 53.33 65.35 -0.26 -0.72 0.17 66.18 57.39 65.35 -0.53 -0.63 0.01 SAM−T08−server 87
88 huber−torda−server 65.55 60.70 51.48 -0.27 0.15 -1.49 65.55 60.70 51.48 -0.62 -0.13 -1.86 huber−torda−server 88
89 keasar 65.27 58.67 60.76 -0.30 -0.09 -0.38 65.27 59.52 60.76 -0.67 -0.31 -0.61 keasar 89
90 ProtAnG 65.18 56.30 62.53 -0.31 -0.37 -0.16 65.18 56.30 62.53 -0.68 -0.79 -0.37 ProtAnG 90
91 RAPTOR 64.27 52.21 58.35 -0.41 -0.85 -0.67 69.45 60.79 66.94 -0.02 -0.11 0.23 RAPTOR 91
92 PSI 64.09 52.33 60.78 -0.43 -0.84 -0.37 64.09 52.33 60.78 -0.85 -1.40 -0.61 PSI 92
93 Pcons_dot_net 63.91 54.52 62.68 -0.45 -0.58 -0.15 63.91 54.52 62.68 -0.88 -1.06 -0.35 Pcons_dot_net 93
94 SAM−T02−server 63.55 51.85 57.11 -0.50 -0.89 -0.81 63.55 51.85 57.11 -0.93 -1.47 -1.10 SAM−T02−server 94
95 Pcons_multi 63.09 56.24 62.83 -0.55 -0.37 -0.13 63.91 56.24 62.83 -0.88 -0.80 -0.33 Pcons_multi 95
96 FFASstandard 63.09 50.36 61.50 -0.55 -1.07 -0.29 66.36 55.61 65.85 -0.50 -0.90 0.08 FFASstandard 96
97 StruPPi 62.91 52.55 59.62 -0.57 -0.81 -0.51 63.64 54.06 62.64 -0.92 -1.13 -0.35 StruPPi 97
98 panther_server 61.91 56.64 48.33 -0.68 -0.33 -1.87 61.91 56.64 48.33 -1.19 -0.74 -2.29 panther_server 98
99 YASARA 61.91 53.73 56.59 -0.68 -0.67 -0.88 62.64 56.27 57.39 -1.07 -0.80 -1.07 YASARA 99
100 Distill 61.82 53.88 52.95 -0.69 -0.65 -1.31 61.82 54.91 54.41 -1.20 -1.00 -1.47 Distill 100
101 xianmingpan 61.55 53.97 58.31 -0.72 -0.64 -0.67 63.09 53.97 59.55 -1.00 -1.15 -0.77 xianmingpan 101
102 SMEG−CCP 61.27 50.18 60.00 -0.76 -1.09 -0.47 61.27 50.18 60.00 -1.29 -1.72 -0.71 SMEG−CCP 102
103 Kolinski 58.82 52.82 53.36 -1.04 -0.78 -1.26 58.82 52.82 53.36 -1.67 -1.32 -1.61 Kolinski 103
104 3DShot2 54.27 45.24 42.79 -1.56 -1.67 -2.53 54.27 45.24 42.79 -2.37 -2.47 -3.04 3DShot2 104
105 fleil 50.45 43.12 42.65 -1.99 -1.93 -2.55 69.91 65.91 67.08 0.05 0.66 0.25 fleil 105
106 Zhou−SPARKS 49.00 42.36 40.68 -2.16 -2.02 -2.79 49.00 42.36 40.68 -3.19 -2.90 -3.33 Zhou−SPARKS 106
107 Frankenstein 49.00 41.73 43.08 -2.16 -2.09 -2.50 49.00 41.73 43.08 -3.19 -3.00 -3.00 Frankenstein 107
108 FrankensteinLong 49.00 41.73 43.08 -2.16 -2.09 -2.50 49.00 41.73 43.08 -3.19 -3.00 -3.00 FrankensteinLong 108
109 ACOMPMOD 48.82 40.94 43.98 -2.18 -2.18 -2.39 48.82 40.94 43.98 -3.21 -3.12 -2.88 ACOMPMOD 109
110 rehtnap 37.18 34.94 18.80 -3.51 -2.89 -5.41 38.91 36.55 18.80 -4.75 -3.78 -6.29 rehtnap 110
111 FOLDpro 26.45 23.18 25.07 -4.73 -4.28 -4.66 74.45 65.24 70.86 0.75 0.56 0.76 FOLDpro 111
112 LOOPP_Server 24.18 18.18 20.17 -4.99 -4.88 -5.25 39.73 30.67 34.13 -4.62 -4.67 -4.21 LOOPP_Server 112
113 DistillSN 24.00 18.36 21.26 -5.01 -4.85 -5.12 24.00 18.36 21.84 -7.06 -6.54 -5.87 DistillSN 113
114 Sasaki−Cetin−Sasai 15.91 14.82 34.37 -5.94 -5.27 -3.54 19.45 15.27 36.88 -7.76 -7.01 -3.84 Sasaki−Cetin−Sasai 114
115 MUFOLD−Server 15.64 12.48 18.35 -5.97 -5.55 -5.46 15.73 12.58 18.38 -8.34 -7.41 -6.34 MUFOLD−Server 115
116 MUFOLD−MD 15.54 12.21 17.40 -5.98 -5.58 -5.58 15.73 12.67 18.38 -8.34 -7.40 -6.34 MUFOLD−MD 116
117 RBO−Proteus 15.36 12.76 27.47 -6.00 -5.52 -4.37 15.36 13.00 28.69 -8.39 -7.35 -4.95 RBO−Proteus 117
118 DelCLab 13.73 11.76 15.34 -6.19 -5.64 -5.83 21.73 19.79 20.35 -7.41 -6.32 -6.08 DelCLab 118
119 mariner1 12.64 10.79 10.47 -6.31 -5.75 -6.41 23.18 19.61 24.63 -7.18 -6.35 -5.50 mariner1 119
120 RANDOM 11.47 9.29 11.47 -6.45 -5.93 -6.29 11.47 9.29 11.47 -9.00 -7.91 -7.28 RANDOM 120
121 MeilerLabRene 10.91 10.27 21.79 -6.51 -5.81 -5.05 15.64 12.48 25.09 -8.35 -7.43 -5.43 MeilerLabRene 121
122 TWPPLAB 9.09 8.36 18.06 -6.72 -6.04 -5.50 9.09 8.36 18.06 -9.36 -8.05 -6.39 TWPPLAB 122
123 psiphifoldings 8.64 7.67 18.95 -6.77 -6.12 -5.39 8.64 7.67 18.95 -9.43 -8.16 -6.27 psiphifoldings 123
124 schenk−torda−server 6.91 6.09 6.75 -6.97 -6.31 -6.86 8.73 7.49 7.97 -9.42 -8.18 -7.75 schenk−torda−server 124
125 MidwayFolding 0.00 0.00 64.92 -7.76 -7.03 0.12 0.00 0.00 67.57 -10.77 -9.32 0.31 MidwayFolding 125
126 Abagyan                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 Abagyan 126
127 BHAGEERATH                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 BHAGEERATH 127
128 FEIG_REFINE                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 FEIG_REFINE 128
129 FLOUDAS                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 FLOUDAS 129
130 HCA                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 HCA 130
131 Handl−Lovell                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 Handl−Lovell 131
132 JIVE08                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 JIVE08 132
133 KudlatyPredHuman                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 KudlatyPredHuman 133
134 LEE−SERVER                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 LEE−SERVER 134
135 Linnolt−UH−CMB                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 Linnolt−UH−CMB 135
136 NIM2                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 NIM2 136
137 Nano_team                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 Nano_team 137
138 Ozkan−Shell                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 Ozkan−Shell 138
139 PHAISTOS                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 PHAISTOS 139
140 POEMQA                   -6.45 -5.93 -6.29                   -1.17 -0.72 -7.28 POEMQA 140
141 POISE                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 POISE 141
142 PZ−UAM                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 PZ−UAM 142
143 ProteinShop                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 ProteinShop 143
144 RPFM                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 RPFM 144
145 SAINT1                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 SAINT1 145
146 SHORTLE                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 SHORTLE 146
147 Scheraga                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 Scheraga 147
148 ShakAbInitio                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 ShakAbInitio 148
149 TsaiLab                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 TsaiLab 149
150 UCDavisGenome                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 UCDavisGenome 150
151 Wolfson−FOBIA                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 Wolfson−FOBIA 151
152 Wolynes                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 Wolynes 152
153 YASARARefine                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 YASARARefine 153
154 dill_ucsf                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 dill_ucsf 154
155 dill_ucsf_extended                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 dill_ucsf_extended 155
156 fais@hgc                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 fais@hgc 156
157 igor                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 igor 157
158 jacobson                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 jacobson 158
159 mahmood−torda−server                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 mahmood−torda−server 159
160 mti                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 mti 160
161 mumssp                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 mumssp 161
162 ricardo                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 ricardo 162
163 rivilo                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 rivilo 163
164 sessions                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 sessions 164
165 taylor                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 taylor 165
166 test_http_server_01                   -6.45 -5.93 -6.29                   -9.00 -7.91 -7.28 test_http_server_01 166