T0454

Human/Server Targets
387 389 391 393
395 396 397 399
401 403 405 407
409 411 413 415
417 419 421 423
425 427 429 431
434 437 440 443
446 449 451 454
457 460 462 464
465 466 467 468
469 471 473 474
476 480 482 484
487 489 492 493
495 496 498 499
500

T0454

TetR family transcriptional regulator from Geobacter sulfurreducens PCA

Target type: Human/Server

Target sequence:

>T0454 transcriptional regulator, TetR family, Geobacter sulfurreducens PCA, 203 residues
MTRADCRSRLMEVATELFAQKGFYGVSIRELAQAAGASISMISYHFGGKEGLYAAVLQEQFACFGQLDDIRGQAGDPLAVMTAYLRWTIQRHRNNPQLLRFYTSELTNPTPCFAAIVSPAIASVIRLLAESIEAGMTRGLFRRDLHAVNSALALAGMVNYFFLSTLATEGLTSHSPDQDEELIRQYVAIFTRGIMADGGAAPA

Structure:
Method: X-ray, res=1.75Å, R/Rfree=0.17/0.21
Determined by: MCSG
PDB ID: 3dew

3dew cartoon
Cartoon diagram of 454: 3dew

PyMOL of 3dew

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 5-56 and 57-196. Residue ranges in target: 5-56 and 57-196.

454 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

1st domain: DNA/RNA-binding 3-helical bundle fold.

2nd domain: C-terminal domain of Tetracyclin repressor fold.

3dew cartoon
Ribbon diagram of 454: 3dew

CASP category:

Whole chain: Comparative modeling:hard.

1st domain: Comparative modeling:easy. 2nd domain: Comparative modeling:hard.

Closest templates:

2qtq, 1pb6, 1vi0, 2ibd, 2gen.

Target sequence - PDB file inconsistencies:

T0454    3dew.pdb    T0454.pdb    PyMOL    PyMOL of domains    

T0454    1 MTRADCRSRLMEVATELFAQKGFYGVSIRELAQAAGASISMISYHFGGKEGLYAAVLQEQFACFGQLDDIRGQAGDPLAVMTAYLRWTIQRHRNNPQLLRFYTSELTNPTPCFAAIVSPAIASVIRLLAESIEAGMTRGLFRRDLHAVNSALALAGMVNYFFLSTLATEGLTSHSPDQDEELIRQYVAIFTRGIMADGGAAPA 203
           ~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~
3dewA    5 ----DCRSRLMEVATELFAQKGFYGVSIRELAQAAGASISMISYHFGGKEGLYAAVLQEQFACFGQLDDIRGQAGDPLAVMTAYLRWTIQRHRNNPQLLRFYTSELTNPTPCFAAIVSPAIASVIRLLAESIEAGMTRGLFRRDLHAVNSALALAGMVNYFFLSTLATEGLTSHSPDQDEELIRQYVAIFTRGIMA------- 196

Residue change log: change 11, 41, 81, 136, 157, 195, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 5-56 ; pdb 5-56

2nd domain: target 57-196 ; pdb 57-196

Sequence classification:

1st domain: Bacterial regulatory proteins, tetR family (TetR_N) in Pfam.

2nd domain: Domain of unknown function (DUF1956) in Pfam.

Server predictions:

T0454:pdb 5-196:seq 5-196:CM_hard;   alignment

distribution of first scores
First models for T0454: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

454_1:pdb 5-56:seq 5-56:CM_easy;   alignment

distribution of first scores
First models for T0454_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

454_2:pdb 57-196:seq 57-196:CM_hard;   alignment

distribution of first scores
First models for T0454_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0454 454_1 454_2 T0454 454_1 454_2 T0454 454_1 454_2 T0454 454_1 454_2
First score First Z-score Best score Best Z-score
1 Bates_BMM 64.32 48.70 67.51 94.71 94.39 89.75 67.32 55.06 62.45 1.40 1.22 1.21 1.15 1.06 1.54 1.02 1.09 0.96 64.32 52.26 68.47 94.71 94.39 89.75 67.32 57.98 64.96 1.38 1.93 1.12 1.07 0.97 1.51 0.88 1.19 0.98 Bates_BMM 1
2 POEMQA 62.24 47.61 69.56 91.83 91.51 88.31 66.96 56.01 66.12 1.09 1.03 1.51 0.54 0.63 1.17 0.97 1.22 1.44 62.24 47.61 70.41 93.27 92.95 88.45 66.96 56.01 68.68 1.01 0.85 1.43 0.62 0.65 1.07 0.82 0.87 1.50 POEMQA 2
3 TASSER 61.59 49.35 71.48 91.35 90.06 88.14 65.89 53.63 68.72 0.99 1.34 1.79 0.44 0.41 1.13 0.84 0.90 1.79 62.50 49.35 71.48 91.83 90.55 88.14 66.79 56.07 68.72 1.05 1.25 1.60 0.18 0.11 0.97 0.80 0.88 1.51 TASSER 3
4 pro−sp3−TASSER 61.46 44.97 66.10 89.90 88.62 85.95 66.07 53.57 62.63 0.97 0.55 1.01 0.13 0.19 0.57 0.86 0.89 0.98 62.63 48.70 70.39 92.79 91.51 88.20 66.96 56.73 67.67 1.08 1.10 1.42 0.48 0.33 0.99 0.82 0.99 1.36 pro−sp3−TASSER 4
5 Zhang 61.20 48.48 69.22 93.27 92.63 88.57 64.64 55.48 65.41 0.94 1.18 1.46 0.84 0.79 1.24 0.68 1.15 1.35 61.33 48.74 70.89 93.75 93.11 88.82 66.25 56.84 67.44 0.84 1.11 1.50 0.77 0.68 1.20 0.72 1.01 1.33 Zhang 5
6 Kolinski 61.20 44.62 57.66 90.39 88.46 81.00 64.64 52.74 54.29 0.94 0.48 -0.22 0.23 0.17 -0.69 0.68 0.77 -0.12 61.20 45.31 58.43 90.86 90.39 84.27 64.64 52.74 54.29 0.82 0.31 -0.47 -0.12 0.08 -0.33 0.48 0.35 -0.54 Kolinski 6
7 GeneSilico 60.94 48.52 67.79 93.27 92.63 88.38 64.82 50.06 63.61 0.90 1.19 1.26 0.84 0.79 1.19 0.71 0.41 1.11 60.94 48.52 68.43 93.27 92.63 88.38 64.82 52.98 64.49 0.77 1.06 1.11 0.62 0.58 1.05 0.50 0.39 0.91 GeneSilico 7
8 McGuffin 60.94 48.18 68.98 93.27 92.63 88.89 64.82 53.51 64.90 0.90 1.13 1.43 0.84 0.79 1.32 0.71 0.88 1.28 61.20 48.18 71.67 93.27 92.63 88.89 67.50 55.48 69.36 0.82 0.98 1.63 0.62 0.58 1.22 0.90 0.79 1.60 McGuffin 8
9 Jones−UCL 60.94 47.13 61.42 91.83 89.26 80.91 66.61 52.80 59.20 0.90 0.94 0.33 0.54 0.29 -0.71 0.93 0.78 0.53 60.94 47.13 61.42 92.79 92.15 85.19 66.61 52.80 59.20 0.77 0.74 0.01 0.48 0.47 -0.02 0.77 0.36 0.16 Jones−UCL 9
10 mufold 60.68 48.05 68.68 93.75 93.11 88.34 64.11 54.34 64.78 0.86 1.11 1.38 0.94 0.86 1.18 0.62 0.99 1.27 60.68 48.05 71.24 93.75 93.11 89.08 69.29 58.57 68.92 0.73 0.95 1.56 0.77 0.68 1.28 1.17 1.28 1.54 mufold 10
11 Chicken_George 60.68 48.05 63.06 92.79 92.15 87.58 62.50 50.95 58.03 0.86 1.11 0.57 0.74 0.72 0.99 0.42 0.53 0.38 60.81 48.05 68.96 93.27 92.15 88.03 65.54 54.46 65.04 0.75 0.95 1.20 0.62 0.47 0.93 0.61 0.63 0.99 Chicken_George 11
12 Zhang−Server 60.68 47.83 68.21 93.27 92.63 88.38 64.11 54.11 64.19 0.86 1.07 1.32 0.84 0.79 1.19 0.62 0.96 1.19 61.20 48.18 68.98 94.71 94.07 88.89 64.82 54.11 64.90 0.82 0.98 1.20 1.07 0.90 1.22 0.50 0.57 0.97 Zhang−Server 12
13 RAPTOR 60.55 49.83 64.94 91.35 89.42 86.12 67.50 54.41 61.17 0.84 1.43 0.84 0.44 0.31 0.62 1.04 1.00 0.79 60.55 49.83 64.94 93.27 92.15 86.49 67.50 54.41 61.17 0.70 1.36 0.56 0.62 0.47 0.42 0.90 0.62 0.44 RAPTOR 13
14 Zico 60.55 46.57 69.30 91.35 91.35 86.74 70.18 56.73 66.92 0.84 0.84 1.47 0.44 0.60 0.77 1.37 1.32 1.55 60.55 47.27 69.71 91.83 91.83 86.93 70.18 56.73 67.55 0.70 0.77 1.32 0.18 0.40 0.56 1.31 0.99 1.34 Zico 14
15 ZicoFullSTP 60.55 46.57 69.30 91.35 91.35 86.74 70.18 56.73 66.92 0.84 0.84 1.47 0.44 0.60 0.77 1.37 1.32 1.55 60.55 47.27 69.71 91.83 91.83 86.93 70.18 56.73 67.55 0.70 0.77 1.32 0.18 0.40 0.56 1.31 0.99 1.34 ZicoFullSTP 15
16 ZicoFullSTPFullData 60.55 46.57 69.30 91.35 91.35 86.74 70.18 56.73 66.92 0.84 0.84 1.47 0.44 0.60 0.77 1.37 1.32 1.55 60.55 47.27 69.71 91.83 91.83 86.93 70.18 56.73 67.55 0.70 0.77 1.32 0.18 0.40 0.56 1.31 0.99 1.34 ZicoFullSTPFullData 16
17 HHpred5 60.42 47.18 67.04 94.23 93.59 87.47 67.50 54.88 63.34 0.82 0.95 1.15 1.05 0.94 0.96 1.04 1.07 1.08 60.42 47.18 67.04 94.23 93.59 87.47 67.50 54.88 63.34 0.68 0.75 0.89 0.92 0.79 0.74 0.90 0.69 0.75 HHpred5 17
18 ABIpro 60.29 47.57 67.29 93.27 92.63 88.89 63.75 52.56 62.58 0.80 1.02 1.18 0.84 0.79 1.32 0.57 0.75 0.98 60.29 47.57 67.68 93.27 92.63 88.89 63.75 52.56 63.11 0.66 0.84 1.00 0.62 0.58 1.22 0.34 0.32 0.71 ABIpro 18
19 GeneSilicoMetaServer 60.29 46.53 59.65 92.79 92.15 84.94 61.61 48.99 54.82 0.80 0.83 0.07 0.74 0.72 0.32 0.31 0.26 -0.05 60.29 46.53 61.01 92.79 92.15 85.07 61.61 50.66 56.64 0.66 0.60 -0.06 0.48 0.47 -0.06 0.02 0.02 -0.20 GeneSilicoMetaServer 19
20 A−TASSER 60.16 47.48 64.83 90.39 90.39 84.41 66.43 57.14 62.07 0.78 1.00 0.83 0.23 0.46 0.18 0.91 1.38 0.91 61.98 48.66 67.42 92.79 92.79 86.34 66.96 58.51 64.49 0.96 1.09 0.95 0.48 0.61 0.36 0.82 1.27 0.91 A−TASSER 20
21 Pcons_dot_net 60.03 44.75 60.65 93.27 91.99 84.73 62.32 50.30 56.28 0.76 0.51 0.22 0.84 0.70 0.26 0.40 0.44 0.14 60.03 44.88 60.65 93.27 92.15 84.93 62.32 50.30 56.28 0.61 0.21 -0.12 0.62 0.47 -0.11 0.13 -0.04 -0.25 Pcons_dot_net 21
22 Pcons_multi 60.03 44.75 60.65 93.27 91.99 84.73 62.32 50.30 56.28 0.76 0.51 0.22 0.84 0.70 0.26 0.40 0.44 0.14 60.03 45.23 60.65 93.27 92.15 84.85 62.32 50.30 56.28 0.61 0.30 -0.12 0.62 0.47 -0.14 0.13 -0.04 -0.25 Pcons_multi 22
23 MULTICOM 59.90 46.44 69.55 93.75 93.11 87.52 70.36 58.81 66.83 0.74 0.81 1.51 0.94 0.86 0.97 1.40 1.60 1.54 60.94 46.79 70.70 93.75 93.11 87.74 70.36 58.81 68.19 0.77 0.66 1.47 0.77 0.68 0.83 1.33 1.32 1.43 MULTICOM 23
24 MUProt 59.77 46.48 69.40 91.83 91.19 86.95 69.64 55.24 66.98 0.72 0.82 1.49 0.54 0.58 0.83 1.31 1.12 1.56 59.77 46.83 69.45 92.79 92.15 86.95 69.64 57.98 66.98 0.56 0.67 1.28 0.48 0.47 0.57 1.23 1.19 1.26 MUProt 24
25 Elofsson 59.77 45.83 61.61 93.27 92.63 86.31 61.96 50.95 56.68 0.72 0.70 0.36 0.84 0.79 0.66 0.35 0.53 0.20 59.77 46.48 61.61 93.27 92.63 86.46 61.96 50.95 56.68 0.56 0.59 0.04 0.62 0.58 0.41 0.07 0.07 -0.20 Elofsson 25
26 NirBenTal 59.77 45.23 59.08 92.31 91.67 84.58 61.61 51.13 54.16 0.72 0.59 -0.01 0.64 0.65 0.22 0.31 0.55 -0.13 59.77 45.23 59.08 92.31 91.67 84.58 61.61 51.13 54.16 0.56 0.30 -0.36 0.33 0.36 -0.23 0.02 0.09 -0.55 NirBenTal 26
27 ACOMPMOD 59.77 41.75 59.84 92.79 92.15 84.83 60.89 47.38 55.12 0.72 -0.04 0.10 0.74 0.72 0.29 0.22 0.04 -0.01 59.77 43.75 59.84 92.79 92.15 85.77 60.89 47.38 55.45 0.56 -0.05 -0.24 0.48 0.47 0.17 -0.09 -0.50 -0.37 ACOMPMOD 27
28 SAMUDRALA 59.63 45.27 63.29 94.23 93.59 87.32 64.11 50.12 58.24 0.70 0.60 0.60 1.05 0.94 0.92 0.62 0.41 0.40 60.55 47.35 64.57 94.23 93.59 87.91 64.11 52.86 59.87 0.70 0.79 0.50 0.92 0.79 0.89 0.40 0.37 0.26 SAMUDRALA 28
29 FUGUE_KM 59.38 45.36 58.56 92.31 91.67 84.58 60.89 50.42 53.44 0.66 0.62 -0.09 0.64 0.65 0.22 0.22 0.46 -0.23 59.38 45.36 58.56 92.31 91.67 85.71 60.89 50.42 53.44 0.49 0.33 -0.45 0.33 0.36 0.15 -0.09 -0.02 -0.66 FUGUE_KM 29
30 fams−ace2 59.24 45.62 68.76 91.83 91.83 86.53 68.75 56.37 66.44 0.64 0.66 1.40 0.54 0.67 0.72 1.20 1.27 1.49 60.94 48.52 69.62 91.83 91.83 86.55 68.75 56.37 67.43 0.77 1.06 1.30 0.18 0.40 0.44 1.09 0.93 1.33 fams−ace2 30
31 MULTICOM−CMFR 58.98 45.75 60.18 92.79 92.15 84.97 61.07 49.88 55.53 0.60 0.69 0.15 0.74 0.72 0.32 0.24 0.38 0.05 58.98 45.92 71.18 94.23 94.23 88.45 67.68 55.66 69.29 0.42 0.46 1.55 0.92 0.93 1.07 0.93 0.82 1.59 MULTICOM−CMFR 31
32 keasar−server 58.85 45.14 59.76 85.10 82.53 81.63 66.96 58.04 56.79 0.58 0.58 0.09 -0.88 -0.72 -0.53 0.97 1.50 0.21 58.98 45.53 60.19 85.58 83.65 81.65 67.50 58.04 57.34 0.42 0.37 -0.19 -1.74 -1.42 -1.21 0.90 1.20 -0.10 keasar−server 32
33 3DShotMQ 58.72 49.17 69.00 91.35 91.35 86.41 69.11 56.96 66.12 0.56 1.31 1.43 0.44 0.60 0.69 1.24 1.35 1.44 58.72 49.17 69.00 91.35 91.35 86.41 69.11 56.96 66.12 0.37 1.21 1.20 0.03 0.29 0.39 1.15 1.03 1.14 3DShotMQ 33
34 AMU−Biology 58.72 46.48 60.10 93.27 92.63 85.33 61.96 49.58 55.06 0.56 0.82 0.14 0.84 0.79 0.42 0.35 0.34 -0.02 58.72 46.48 60.10 93.27 92.63 85.33 61.96 49.94 55.06 0.37 0.59 -0.20 0.62 0.58 0.03 0.07 -0.10 -0.43 AMU−Biology 34
35 nFOLD3 58.72 44.75 55.86 92.31 91.67 84.58 60.54 43.09 49.73 0.56 0.51 -0.48 0.64 0.65 0.22 0.17 -0.55 -0.72 58.72 44.75 59.48 92.79 92.15 85.12 62.68 49.70 57.38 0.37 0.18 -0.30 0.48 0.47 -0.04 0.18 -0.13 -0.10 nFOLD3 35
36 MULTICOM−REFINE 58.59 45.49 69.71 92.31 91.67 86.57 68.39 56.01 67.22 0.54 0.64 1.53 0.64 0.65 0.73 1.15 1.22 1.59 59.77 46.48 69.76 93.27 92.63 86.95 69.64 56.01 67.33 0.56 0.59 1.32 0.62 0.58 0.57 1.23 0.87 1.31 MULTICOM−REFINE 36
37 PSI 58.46 44.53 58.26 92.31 91.03 84.41 59.29 48.93 53.11 0.53 0.47 -0.13 0.64 0.55 0.18 0.02 0.25 -0.27 60.68 44.53 60.86 92.31 91.03 84.41 65.71 56.31 57.10 0.73 0.13 -0.08 0.33 0.22 -0.28 0.64 0.92 -0.14 PSI 37
38 GS−KudlatyPred 58.46 43.88 57.74 93.27 92.63 84.99 59.29 47.98 52.06 0.53 0.35 -0.20 0.84 0.79 0.33 0.02 0.12 -0.41 58.46 43.88 57.74 93.27 92.63 84.99 59.29 47.98 52.06 0.33 -0.02 -0.58 0.62 0.58 -0.09 -0.33 -0.41 -0.85 GS−KudlatyPred 38
39 3DShot1 58.33 44.88 60.03 92.79 90.86 84.50 63.04 46.96 55.59 0.51 0.53 0.13 0.74 0.53 0.20 0.49 -0.02 0.05 58.33 44.88 60.03 92.79 90.86 84.50 63.04 46.96 55.59 0.30 0.21 -0.21 0.48 0.18 -0.25 0.23 -0.57 -0.35 3DShot1 39
40 FFASstandard 58.33 44.53 57.21 85.10 83.17 80.78 64.64 55.12 53.68 0.51 0.47 -0.28 -0.88 -0.62 -0.74 0.68 1.10 -0.20 58.33 44.53 60.28 92.31 91.03 88.23 64.64 55.12 54.62 0.30 0.13 -0.17 0.33 0.22 1.00 0.48 0.73 -0.49 FFASstandard 40
41 METATASSER 58.33 44.18 70.45 90.39 88.46 86.52 63.21 47.14 68.00 0.51 0.40 1.64 0.23 0.17 0.72 0.51 0.01 1.69 62.50 48.78 70.45 91.35 90.06 87.45 66.79 56.07 68.00 1.05 1.12 1.43 0.03 0.00 0.74 0.80 0.88 1.41 METATASSER 41
42 CBSU 58.20 46.48 59.29 91.83 90.55 85.79 57.86 47.02 53.74 0.49 0.82 0.02 0.54 0.48 0.53 -0.16 -0.01 -0.19 60.16 49.13 61.25 92.79 91.51 86.37 62.14 48.87 56.30 0.63 1.20 -0.02 0.48 0.33 0.37 0.10 -0.27 -0.25 CBSU 42
43 mGenTHREADER 58.20 44.23 57.23 92.31 91.67 84.58 59.64 47.02 51.61 0.49 0.41 -0.28 0.64 0.65 0.22 0.06 -0.01 -0.47 58.20 44.23 57.23 92.31 91.67 84.58 59.64 47.02 51.61 0.28 0.06 -0.66 0.33 0.36 -0.23 -0.28 -0.56 -0.92 mGenTHREADER 43
44 MidwayFolding 58.07 47.48 61.65 91.35 89.42 86.12 63.39 50.54 56.65 0.47 1.00 0.36 0.44 0.31 0.62 0.53 0.47 0.19 58.07 47.48 61.65 91.35 89.42 86.12 63.39 50.54 56.65 0.26 0.82 0.04 0.03 -0.14 0.29 0.29 -0.00 -0.20 MidwayFolding 44
45 ricardo 58.07 45.23 53.64 94.23 94.23 87.69 54.64 38.45 44.84 0.47 0.59 -0.80 1.05 1.03 1.02 -0.56 -1.18 -1.36 60.94 47.13 61.03 94.71 94.23 87.69 61.61 47.92 54.90 0.77 0.74 -0.06 1.07 0.93 0.82 0.02 -0.42 -0.45 ricardo 45
46 Phyre2 58.07 44.18 59.34 92.31 91.03 85.01 61.79 45.18 54.10 0.47 0.40 0.03 0.64 0.55 0.33 0.33 -0.26 -0.14 58.07 44.18 60.15 92.31 91.03 85.01 62.68 54.82 61.85 0.26 0.05 -0.19 0.33 0.22 -0.08 0.18 0.68 0.54 Phyre2 46
47 Phragment 58.07 44.18 59.34 92.31 91.03 85.01 61.79 45.18 54.10 0.47 0.40 0.03 0.64 0.55 0.33 0.33 -0.26 -0.14 58.07 44.18 60.15 92.31 91.03 85.01 62.68 54.82 61.85 0.26 0.05 -0.19 0.33 0.22 -0.08 0.18 0.68 0.54 Phragment 47
48 Poing 58.07 44.10 59.34 92.31 91.03 85.01 61.79 45.18 54.10 0.47 0.39 0.03 0.64 0.55 0.33 0.33 -0.26 -0.14 58.07 44.10 60.15 92.31 91.03 85.01 62.68 54.70 61.85 0.26 0.03 -0.19 0.33 0.22 -0.08 0.18 0.66 0.54 Poing 48
49 DBAKER 58.07 43.10 59.03 91.83 89.90 85.00 59.46 48.39 53.99 0.47 0.21 -0.02 0.54 0.38 0.33 0.04 0.18 -0.16 61.20 48.57 68.89 95.67 95.03 89.46 64.64 52.86 64.75 0.82 1.07 1.19 1.36 1.11 1.41 0.48 0.37 0.95 DBAKER 49
50 IBT_LT 57.94 44.40 65.27 90.86 90.22 87.21 65.89 53.99 61.39 0.45 0.44 0.89 0.33 0.43 0.89 0.84 0.94 0.82 57.94 44.40 65.27 90.86 90.22 87.21 65.89 53.99 61.39 0.23 0.10 0.61 -0.12 0.04 0.66 0.66 0.55 0.47 IBT_LT 50
51 MUSTER 57.81 44.84 61.21 92.79 90.86 84.91 62.50 47.14 56.83 0.43 0.52 0.30 0.74 0.53 0.31 0.42 0.01 0.22 57.81 44.84 61.21 92.79 90.86 84.91 64.82 56.25 57.78 0.21 0.21 -0.03 0.48 0.18 -0.12 0.50 0.91 -0.04 MUSTER 51
52 BAKER−ROBETTA 57.81 43.58 58.54 91.35 89.42 84.57 59.64 47.98 53.50 0.43 0.29 -0.09 0.44 0.31 0.22 0.06 0.12 -0.22 59.12 45.75 60.11 91.35 89.42 84.65 61.61 47.98 55.65 0.44 0.42 -0.20 0.03 -0.14 -0.20 0.02 -0.41 -0.34 BAKER−ROBETTA 52
53 MULTICOM−RANK 57.68 42.92 64.96 92.79 92.15 86.44 62.86 49.64 60.72 0.41 0.17 0.84 0.74 0.72 0.70 0.46 0.35 0.73 59.38 46.09 69.02 93.27 93.27 86.69 68.57 56.55 66.56 0.49 0.50 1.21 0.62 0.72 0.48 1.07 0.96 1.20 MULTICOM−RANK 53
54 COMA−M 57.68 42.45 58.82 86.06 84.14 81.22 64.82 55.42 55.87 0.41 0.09 -0.05 -0.68 -0.48 -0.63 0.71 1.14 0.09 57.68 42.45 64.51 91.83 91.19 85.12 64.82 55.42 62.00 0.19 -0.35 0.49 0.18 0.26 -0.04 0.50 0.78 0.56 COMA−M 54
55 CpHModels 57.68 40.06 54.51 85.58 84.30 80.27 63.75 52.32 50.51 0.41 -0.35 -0.67 -0.78 -0.45 -0.87 0.57 0.72 -0.62 57.68 40.06 54.51 85.58 84.30 80.27 63.75 52.32 50.51 0.19 -0.90 -1.09 -1.74 -1.28 -1.67 0.34 0.28 -1.07 CpHModels 55
56 fais−server 57.68 39.58 60.13 86.06 84.14 84.01 64.46 48.51 56.06 0.41 -0.43 0.14 -0.68 -0.48 0.08 0.66 0.19 0.12 57.68 45.53 60.13 93.27 92.63 87.99 65.00 56.67 56.06 0.19 0.37 -0.20 0.62 0.58 0.92 0.53 0.98 -0.28 fais−server 56
57 tripos_08 57.55 43.97 58.05 91.35 89.42 83.99 58.93 44.41 53.05 0.39 0.36 -0.16 0.44 0.31 0.07 -0.03 -0.37 -0.28 57.81 44.18 58.70 92.31 92.31 84.27 59.46 45.71 54.04 0.21 0.05 -0.42 0.33 0.51 -0.33 -0.30 -0.77 -0.57 tripos_08 57
58 FAMSD 57.42 42.41 57.40 90.86 90.86 84.86 58.75 44.82 51.58 0.37 0.08 -0.25 0.33 0.53 0.30 -0.05 -0.31 -0.48 58.98 43.62 59.51 92.31 92.31 84.86 66.43 52.74 57.43 0.42 -0.08 -0.30 0.33 0.51 -0.13 0.74 0.35 -0.09 FAMSD 58
59 LevittGroup 57.42 42.06 60.52 92.79 92.15 88.40 55.71 41.37 53.49 0.37 0.02 0.20 0.74 0.72 1.20 -0.43 -0.78 -0.22 57.42 42.06 60.52 92.79 92.15 88.40 55.71 41.37 53.49 0.14 -0.44 -0.14 0.48 0.47 1.06 -0.87 -1.46 -0.65 LevittGroup 59
60 3DShot2 57.16 39.89 47.29 84.14 82.85 78.47 61.61 47.32 41.92 0.33 -0.38 -1.72 -1.09 -0.67 -1.33 0.31 0.03 -1.75 57.16 39.89 47.29 84.14 82.85 78.47 61.61 47.32 41.92 0.09 -0.94 -2.23 -2.19 -1.60 -2.28 0.02 -0.51 -2.29 3DShot2 60
61 PS2−server 57.03 44.88 58.23 91.83 91.19 84.38 59.29 44.76 53.06 0.31 0.53 -0.13 0.54 0.58 0.17 0.02 -0.32 -0.28 57.03 44.88 61.99 91.83 91.19 84.38 61.79 49.88 60.16 0.07 0.21 0.10 0.18 0.26 -0.29 0.05 -0.11 0.30 PS2−server 61
62 PS2−manual 57.03 44.88 58.23 91.83 91.19 84.38 59.29 44.76 53.06 0.31 0.53 -0.13 0.54 0.58 0.17 0.02 -0.32 -0.28 57.03 44.88 61.99 91.83 91.19 84.38 61.79 49.88 60.16 0.07 0.21 0.10 0.18 0.26 -0.29 0.05 -0.11 0.30 PS2−manual 62
63 EB_AMU_Physics 56.90 46.01 60.71 92.31 91.67 85.22 59.64 49.05 55.98 0.29 0.73 0.23 0.64 0.65 0.39 0.06 0.27 0.11 56.90 46.01 60.71 92.31 91.67 85.22 59.64 49.05 55.98 0.04 0.48 -0.11 0.33 0.36 -0.01 -0.28 -0.24 -0.30 EB_AMU_Physics 63
64 panther_server 56.90 45.79 51.79 84.61 82.69 76.65 61.25 53.63 49.05 0.29 0.69 -1.07 -0.99 -0.69 -1.79 0.26 0.90 -0.81 60.42 47.53 60.94 93.27 91.99 84.83 63.93 54.88 56.42 0.68 0.83 -0.07 0.62 0.43 -0.14 0.37 0.69 -0.23 panther_server 64
65 TJ_Jiang 56.90 42.32 58.45 92.79 92.15 84.75 59.64 47.14 53.17 0.29 0.06 -0.10 0.74 0.72 0.27 0.06 0.01 -0.27 56.90 42.32 59.38 92.79 92.15 84.75 61.43 53.45 58.78 0.04 -0.38 -0.32 0.48 0.47 -0.17 -0.01 0.46 0.10 TJ_Jiang 65
66 GS−MetaServer2 56.90 40.06 58.22 85.58 83.01 83.21 64.64 51.67 53.88 0.29 -0.35 -0.13 -0.78 -0.65 -0.12 0.68 0.63 -0.17 59.77 44.31 59.41 92.79 92.15 84.92 65.00 58.33 55.46 0.56 0.08 -0.31 0.48 0.47 -0.11 0.53 1.24 -0.37 GS−MetaServer2 66
67 FEIG 56.77 48.05 66.16 89.42 88.14 83.04 64.46 53.51 64.31 0.27 1.11 1.02 0.03 0.12 -0.17 0.66 0.88 1.20 57.68 48.05 66.16 89.42 88.14 83.04 65.00 55.36 64.31 0.19 0.95 0.76 -0.56 -0.42 -0.74 0.53 0.77 0.88 FEIG 67
68 Zhou−SPARKS 56.77 45.83 57.73 92.79 92.15 84.67 59.82 48.04 52.17 0.27 0.70 -0.21 0.74 0.72 0.25 0.08 0.13 -0.40 56.77 45.83 57.73 92.79 92.15 84.67 59.82 48.04 52.17 0.02 0.44 -0.58 0.48 0.47 -0.20 -0.25 -0.40 -0.84 Zhou−SPARKS 68
69 BioSerf 56.77 45.66 57.91 92.79 92.15 84.52 59.29 44.76 52.64 0.27 0.67 -0.18 0.74 0.72 0.21 0.02 -0.32 -0.34 56.77 45.66 57.91 92.79 92.15 84.52 59.29 44.76 52.64 0.02 0.40 -0.55 0.48 0.47 -0.25 -0.33 -0.92 -0.77 BioSerf 69
70 SAM−T08−server 56.77 39.06 65.02 85.58 83.33 83.49 61.96 51.01 62.93 0.27 -0.53 0.85 -0.78 -0.60 -0.05 0.35 0.54 1.02 56.77 43.01 65.02 92.31 91.03 88.23 61.96 56.73 62.93 0.02 -0.22 0.58 0.33 0.22 1.00 0.07 0.99 0.69 SAM−T08−server 70
71 Hao_Kihara 56.64 44.40 59.98 93.27 92.63 85.00 60.00 46.31 55.20 0.25 0.44 0.12 0.84 0.79 0.33 0.11 -0.11 0.00 56.64 44.40 59.98 93.27 92.63 85.00 65.36 53.33 55.73 -0.00 0.10 -0.22 0.62 0.58 -0.08 0.58 0.45 -0.33 Hao_Kihara 71
72 circle 56.38 45.14 57.65 91.35 90.70 83.97 59.82 48.75 52.39 0.21 0.58 -0.22 0.44 0.50 0.07 0.08 0.23 -0.37 58.72 45.23 60.95 93.27 93.27 85.40 63.93 49.88 58.00 0.37 0.30 -0.07 0.62 0.72 0.05 0.37 -0.11 -0.01 circle 72
73 MULTICOM−CLUSTER 56.12 43.97 70.84 91.35 91.35 87.11 66.07 53.21 68.51 0.18 0.36 1.70 0.44 0.60 0.87 0.86 0.84 1.76 60.42 47.74 71.67 91.83 91.35 87.28 68.57 56.55 69.36 0.68 0.88 1.63 0.18 0.29 0.68 1.07 0.96 1.60 MULTICOM−CLUSTER 73
74 Softberry 56.12 43.27 55.57 92.31 91.67 84.77 55.36 45.48 49.20 0.18 0.24 -0.52 0.64 0.65 0.27 -0.47 -0.22 -0.79 56.12 43.27 55.57 92.31 91.67 84.77 55.36 45.48 49.20 -0.10 -0.16 -0.92 0.33 0.36 -0.16 -0.92 -0.81 -1.26 Softberry 74
75 FAMS−multi 56.12 37.63 60.95 92.79 92.15 85.97 60.71 45.71 56.29 0.18 -0.79 0.26 0.74 0.72 0.58 0.19 -0.19 0.15 58.72 46.31 60.95 92.79 92.15 86.05 61.96 50.71 56.29 0.37 0.55 -0.07 0.48 0.47 0.27 0.07 0.03 -0.25 FAMS−multi 75
76 SHORTLE 55.86 45.01 65.11 92.31 90.70 88.33 61.07 47.62 60.43 0.14 0.55 0.87 0.64 0.50 1.18 0.24 0.07 0.69 57.81 45.05 70.72 92.79 91.19 88.83 64.82 50.77 67.76 0.21 0.25 1.48 0.48 0.26 1.20 0.50 0.04 1.37 SHORTLE 76
77 FFASsuboptimal 55.73 42.27 56.92 85.10 82.53 80.77 63.93 54.64 53.33 0.12 0.05 -0.32 -0.88 -0.72 -0.74 0.60 1.03 -0.24 57.55 44.70 58.47 86.06 84.14 81.14 65.71 56.31 55.13 0.16 0.17 -0.46 -1.60 -1.31 -1.38 0.64 0.92 -0.42 FFASsuboptimal 77
78 Sternberg 55.60 43.36 67.45 89.90 88.62 85.72 64.82 52.92 65.17 0.10 0.25 1.21 0.13 0.19 0.51 0.71 0.80 1.32 55.60 43.36 67.45 89.90 88.62 85.72 64.82 52.92 65.17 -0.19 -0.14 0.96 -0.41 -0.32 0.16 0.50 0.38 1.01 Sternberg 78
79 Phyre_de_novo 55.60 43.36 67.45 89.90 88.62 85.72 64.82 52.92 65.17 0.10 0.25 1.21 0.13 0.19 0.51 0.71 0.80 1.32 58.85 44.88 67.45 93.27 91.99 85.72 64.82 52.92 65.17 0.40 0.21 0.96 0.62 0.43 0.16 0.50 0.38 1.01 Phyre_de_novo 79
80 fais@hgc 55.60 43.10 64.45 87.50 86.22 83.88 59.64 45.95 61.68 0.10 0.21 0.77 -0.38 -0.17 0.05 0.06 -0.16 0.86 58.20 44.58 69.60 87.50 86.22 86.03 63.93 52.02 67.75 0.28 0.15 1.30 -1.15 -0.85 0.26 0.37 0.24 1.37 fais@hgc 80
81 SAM−T08−human 55.47 43.10 65.73 86.54 85.90 84.96 63.04 54.46 63.11 0.08 0.21 0.96 -0.58 -0.21 0.32 0.49 1.01 1.05 60.03 48.22 69.62 92.31 92.31 86.47 68.93 61.31 67.52 0.61 0.99 1.30 0.33 0.51 0.41 1.12 1.72 1.34 SAM−T08−human 81
82 SMEG−CCP 55.08 43.62 49.65 76.92 73.40 65.95 60.71 47.98 51.49 0.02 0.30 -1.38 -2.61 -2.09 -4.51 0.19 0.12 -0.49 55.08 43.62 49.65 76.92 73.40 65.95 60.71 47.98 51.49 -0.28 -0.08 -1.85 -4.41 -3.70 -6.48 -0.11 -0.41 -0.93 SMEG−CCP 82
83 Frankenstein 54.43 35.33 56.06 78.36 71.64 76.23 60.00 47.62 54.53 -0.08 -1.21 -0.45 -2.31 -2.35 -1.90 0.11 0.07 -0.09 56.64 44.14 57.30 87.50 84.94 78.81 61.79 55.59 57.33 -0.00 0.04 -0.65 -1.15 -1.13 -2.16 0.05 0.81 -0.10 Frankenstein 83
84 3D−JIGSAW_V3 54.17 37.33 56.75 86.54 84.61 84.64 60.71 50.95 51.25 -0.12 -0.84 -0.35 -0.58 -0.41 0.24 0.19 0.53 -0.52 54.43 38.11 56.75 86.54 84.61 84.73 60.71 50.95 51.25 -0.40 -1.36 -0.73 -1.45 -1.21 -0.18 -0.11 0.07 -0.97 3D−JIGSAW_V3 84
85 Pcons_local 53.91 36.63 57.17 84.61 82.69 81.51 59.11 49.46 53.32 -0.15 -0.97 -0.29 -0.99 -0.69 -0.56 -0.00 0.32 -0.25 57.42 39.02 57.69 84.61 82.69 81.60 63.57 53.16 55.83 0.14 -1.15 -0.58 -2.04 -1.64 -1.23 0.31 0.42 -0.32 Pcons_local 85
86 DelCLab 52.34 40.80 53.35 94.23 92.31 86.68 50.71 41.19 44.78 -0.39 -0.21 -0.84 1.05 0.75 0.76 -1.05 -0.81 -1.37 52.34 44.36 53.61 94.23 94.23 89.30 50.71 41.19 44.78 -0.78 0.09 -1.23 0.92 0.93 1.36 -1.62 -1.49 -1.88 DelCLab 86
87 3D−JIGSAW_AEP 52.21 39.45 56.15 86.54 83.97 78.81 58.57 46.55 53.45 -0.41 -0.46 -0.44 -0.58 -0.50 -1.24 -0.07 -0.07 -0.23 53.78 40.28 57.69 88.94 84.45 83.38 59.11 47.56 53.94 -0.52 -0.85 -0.58 -0.71 -1.24 -0.63 -0.36 -0.48 -0.58 3D−JIGSAW_AEP 87
88 LEE 52.08 37.67 62.94 87.02 86.38 84.08 58.57 46.19 59.19 -0.43 -0.78 0.55 -0.48 -0.14 0.10 -0.07 -0.12 0.53 58.33 45.66 66.26 89.42 88.78 85.94 65.36 52.74 63.45 0.30 0.40 0.77 -0.56 -0.28 0.23 0.58 0.35 0.76 LEE 88
89 Bilab−UT 51.82 39.50 58.49 87.50 83.97 80.27 58.39 48.51 55.91 -0.47 -0.45 -0.10 -0.38 -0.50 -0.87 -0.09 0.19 0.10 58.33 45.75 59.60 92.79 92.15 84.89 61.43 49.52 55.91 0.30 0.42 -0.28 0.48 0.47 -0.12 -0.01 -0.16 -0.31 Bilab−UT 89
90 FrankensteinLong 51.56 39.80 53.66 90.39 89.42 84.98 57.32 43.27 47.07 -0.51 -0.39 -0.80 0.23 0.31 0.33 -0.23 -0.52 -1.07 57.03 43.06 57.41 90.39 89.42 84.98 62.14 55.36 57.39 0.07 -0.21 -0.63 -0.26 -0.14 -0.09 0.10 0.77 -0.10 FrankensteinLong 90
91 SAM−T02−server 51.56 39.24 37.37 92.31 91.67 88.65 48.21 39.41 21.93 -0.51 -0.50 -3.16 0.64 0.65 1.26 -1.36 -1.05 -4.39 56.38 43.36 55.85 94.23 94.23 88.65 55.89 46.25 49.72 -0.05 -0.14 -0.87 0.92 0.93 1.14 -0.84 -0.69 -1.18 SAM−T02−server 91
92 Fiser−M4T 51.30 40.54 31.58 82.21 81.25 76.04 46.96 35.06 21.96 -0.54 -0.26 -4.00 -1.49 -0.91 -1.95 -1.52 -1.65 -4.38 51.30 40.54 31.58 82.21 81.25 76.04 46.96 35.06 21.96 -0.96 -0.79 -4.71 -2.78 -1.96 -3.09 -2.18 -2.47 -5.12 Fiser−M4T 92
93 YASARA 51.04 35.72 46.88 93.75 92.79 89.82 43.21 31.91 33.88 -0.58 -1.14 -1.78 0.94 0.82 1.56 -1.99 -2.08 -2.81 51.04 41.62 55.41 94.71 94.71 89.82 58.75 48.16 47.75 -1.01 -0.54 -0.94 1.07 1.04 1.53 -0.41 -0.38 -1.46 YASARA 93
94 rehtnap 50.91 41.15 51.58 89.90 89.58 80.90 56.43 43.16 46.47 -0.60 -0.15 -1.10 0.13 0.34 -0.71 -0.34 -0.54 -1.15 51.43 41.15 52.35 89.90 89.58 80.90 57.50 47.38 48.39 -0.94 -0.65 -1.43 -0.41 -0.10 -1.46 -0.60 -0.50 -1.37 rehtnap 94
95 Jiang_Zhu 50.91 32.12 56.90 78.36 72.28 75.68 54.82 40.54 55.95 -0.60 -1.79 -0.33 -2.31 -2.25 -2.04 -0.54 -0.90 0.10 58.46 44.18 59.64 93.75 93.75 85.74 58.75 46.84 55.95 0.33 0.05 -0.28 0.77 0.83 0.16 -0.41 -0.59 -0.30 Jiang_Zhu 95
96 xianmingpan 49.61 39.02 47.89 83.17 80.29 75.55 49.11 40.42 43.21 -0.80 -0.54 -1.63 -1.29 -1.05 -2.07 -1.25 -0.91 -1.58 49.61 39.02 54.39 85.58 84.30 81.92 50.54 43.04 52.24 -1.27 -1.15 -1.11 -1.74 -1.28 -1.12 -1.64 -1.20 -0.83 xianmingpan 96
97 fleil 49.22 40.19 56.18 88.94 87.66 82.57 59.46 49.94 53.62 -0.86 -0.32 -0.43 -0.07 0.05 -0.29 0.04 0.39 -0.21 49.35 40.93 56.18 90.39 88.46 83.18 59.46 50.12 53.62 -1.32 -0.70 -0.82 -0.26 -0.35 -0.70 -0.30 -0.07 -0.63 fleil 97
98 PRI−Yang−KiharA 48.57 37.20 45.17 94.71 94.71 88.87 39.29 32.20 32.51 -0.95 -0.87 -2.03 1.15 1.10 1.32 -2.47 -2.04 -2.99 48.57 37.20 45.17 94.71 94.71 88.87 39.29 32.20 32.51 -1.46 -1.57 -2.56 1.07 1.04 1.21 -3.33 -2.93 -3.62 PRI−Yang−KiharA 98
99 pipe_int 48.18 33.68 59.60 80.29 72.92 76.82 57.68 38.99 60.14 -1.01 -1.51 0.07 -1.90 -2.16 -1.75 -0.18 -1.11 0.65 52.21 42.58 59.60 91.35 90.39 85.17 58.21 50.83 60.14 -0.80 -0.32 -0.28 0.03 0.08 -0.03 -0.49 0.05 0.29 pipe_int 99
100 COMA 47.53 34.42 58.74 81.25 72.60 76.51 56.43 39.17 59.10 -1.11 -1.37 -0.06 -1.70 -2.21 -1.83 -0.34 -1.08 0.52 51.43 41.41 64.51 90.39 89.74 85.52 60.00 48.93 62.00 -0.94 -0.59 0.49 -0.26 -0.07 0.09 -0.22 -0.26 0.56 COMA 100
101 HHpred2 47.53 33.98 59.49 82.21 74.52 77.48 57.14 39.64 59.62 -1.11 -1.45 0.05 -1.49 -1.92 -1.58 -0.25 -1.02 0.59 47.53 33.98 59.49 82.21 74.52 77.48 57.14 39.64 59.62 -1.64 -2.32 -0.30 -2.78 -3.45 -2.61 -0.65 -1.74 0.22 HHpred2 101
102 HHpred4 47.40 34.07 59.24 80.77 72.11 77.10 56.61 38.99 59.53 -1.13 -1.44 0.01 -1.80 -2.28 -1.68 -0.32 -1.11 0.57 47.40 34.07 59.24 80.77 72.11 77.10 56.61 38.99 59.53 -1.67 -2.30 -0.34 -3.22 -3.99 -2.74 -0.73 -1.85 0.21 HHpred4 102
103 LOOPP_Server 45.96 30.21 46.34 78.36 77.40 72.70 50.36 36.55 43.16 -1.34 -2.14 -1.86 -2.31 -1.49 -2.80 -1.10 -1.44 -1.59 57.29 43.45 57.00 92.79 92.15 85.12 58.39 49.23 55.30 0.11 -0.12 -0.69 0.48 0.47 -0.04 -0.46 -0.21 -0.39 LOOPP_Server 103
104 huber−torda−server 45.18 31.60 52.15 80.29 72.28 76.95 54.29 36.73 49.85 -1.46 -1.89 -1.02 -1.90 -2.25 -1.72 -0.61 -1.42 -0.70 56.25 41.75 52.15 92.31 91.67 84.58 55.89 46.13 49.85 -0.07 -0.51 -1.46 0.33 0.36 -0.23 -0.84 -0.70 -1.16 huber−torda−server 104
105 3Dpro 44.79 37.24 49.46 93.75 93.11 87.92 33.21 28.09 38.93 -1.52 -0.86 -1.41 0.94 0.86 1.07 -3.23 -2.60 -2.14 48.57 39.45 52.99 94.23 94.23 89.63 46.61 40.18 44.06 -1.46 -1.05 -1.33 0.92 0.93 1.47 -2.23 -1.65 -1.99 3Dpro 105
106 Pushchino 42.32 32.25 49.71 78.36 70.99 75.27 50.00 38.09 47.38 -1.89 -1.77 -1.37 -2.31 -2.45 -2.14 -1.14 -1.23 -1.03 42.32 32.25 49.71 78.36 70.99 75.27 50.00 38.09 47.38 -2.58 -2.72 -1.85 -3.96 -4.24 -3.35 -1.72 -1.99 -1.51 Pushchino 106
107 ProtAnG 41.93 34.81 48.67 94.71 91.83 88.10 31.07 25.71 38.16 -1.95 -1.30 -1.52 1.15 0.67 1.12 -3.50 -2.93 -2.25 41.93 34.81 48.67 94.71 91.83 88.10 31.07 25.71 38.16 -2.65 -2.12 -2.01 1.07 0.40 0.96 -4.57 -3.97 -2.82 ProtAnG 107
108 FALCON_CONSENSUS 41.54 30.69 49.93 80.77 68.59 75.21 38.39 28.27 48.58 -2.00 -2.05 -1.34 -1.80 -2.81 -2.16 -2.59 -2.58 -0.87 41.54 30.69 51.04 80.77 71.80 77.51 38.39 33.09 48.66 -2.72 -3.08 -1.63 -3.22 -4.06 -2.60 -3.47 -2.79 -1.33 FALCON_CONSENSUS 108
109 MUFOLD−Server 40.37 33.81 51.44 84.61 80.45 79.91 46.79 42.26 48.02 -2.18 -1.48 -1.12 -0.99 -1.03 -0.96 -1.54 -0.66 -0.95 40.49 34.55 51.91 84.61 80.45 81.21 48.39 42.74 48.02 -2.91 -2.18 -1.50 -2.04 -2.13 -1.36 -1.96 -1.25 -1.42 MUFOLD−Server 109
110 FFASflextemplate 38.15 27.91 38.67 87.02 84.14 79.35 42.86 27.68 29.83 -2.51 -2.56 -2.97 -0.48 -0.48 -1.11 -2.03 -2.66 -3.35 38.67 28.78 41.56 87.02 85.10 79.55 43.21 29.46 33.69 -3.24 -3.52 -3.13 -1.30 -1.10 -1.91 -2.74 -3.37 -3.45 FFASflextemplate 110
111 mariner1 37.63 30.43 39.13 82.21 80.29 73.41 51.61 41.73 38.02 -2.59 -2.10 -2.91 -1.49 -1.05 -2.62 -0.94 -0.73 -2.26 41.28 34.63 40.71 87.50 86.86 77.77 52.86 43.51 38.56 -2.77 -2.17 -3.27 -1.15 -0.71 -2.51 -1.29 -1.12 -2.76 mariner1 111
112 StruPPi 35.81 26.43 34.93 55.29 45.67 65.29 37.14 29.88 31.36 -2.86 -2.83 -3.52 -7.18 -6.24 -4.68 -2.74 -2.36 -3.14 36.59 30.08 34.93 56.73 49.04 65.29 37.14 30.06 31.36 -3.62 -3.22 -4.18 -10.62 -9.12 -6.70 -3.65 -3.27 -3.79 StruPPi 112
113 POEM 33.72 28.86 39.42 78.36 73.88 80.33 29.46 21.84 31.34 -3.17 -2.39 -2.87 -2.31 -2.01 -0.86 -3.70 -3.46 -3.15 37.89 34.29 70.41 87.50 86.54 88.45 33.93 27.86 68.68 -3.38 -2.24 1.43 -1.15 -0.78 1.07 -4.14 -3.62 1.50 POEM 113
114 Distill 32.42 21.18 38.48 75.48 63.30 73.66 28.04 22.44 33.15 -3.37 -3.78 -3.00 -2.92 -3.60 -2.55 -3.88 -3.37 -2.91 32.42 22.96 38.48 75.48 63.30 73.66 28.04 22.62 33.43 -4.37 -4.88 -3.62 -4.85 -5.95 -3.89 -5.02 -4.46 -3.49 Distill 114
115 RBO−Proteus 32.29 29.60 52.80 83.65 70.19 79.31 37.50 33.81 50.39 -3.39 -2.25 -0.92 -1.19 -2.57 -1.12 -2.70 -1.82 -0.63 33.07 30.47 52.80 83.65 77.40 79.31 37.68 33.81 50.72 -4.25 -3.13 -1.36 -2.34 -2.81 -1.99 -3.57 -2.67 -1.04 RBO−Proteus 115
116 FALCON 31.25 26.65 51.04 77.89 70.51 77.39 37.68 28.99 48.62 -3.54 -2.79 -1.18 -2.41 -2.52 -1.60 -2.68 -2.48 -0.87 31.25 26.65 51.04 77.89 70.51 77.51 37.68 29.58 48.66 -4.58 -4.02 -1.63 -4.11 -4.35 -2.60 -3.57 -3.35 -1.33 FALCON 116
117 SAM−T06−server 29.56 26.61 49.69 82.21 77.72 78.34 40.36 36.43 46.24 -3.79 -2.79 -1.37 -1.49 -1.44 -1.36 -2.34 -1.46 -1.18 56.12 41.88 54.23 92.31 91.67 84.58 55.36 46.49 47.50 -0.10 -0.48 -1.13 0.33 0.36 -0.23 -0.92 -0.65 -1.50 SAM−T06−server 117
118 keasar 29.43 20.09 49.29 73.08 68.59 73.57 35.18 27.20 48.95 -3.81 -3.98 -1.43 -3.42 -2.81 -2.58 -2.99 -2.72 -0.82 59.51 45.70 69.01 92.79 91.51 87.71 67.68 58.04 66.78 0.52 0.41 1.21 0.48 0.33 0.82 0.93 1.20 1.24 keasar 118
119 FOLDpro 27.08 24.22 9.95 57.21 45.35 37.04 31.96 28.04 13.11 -4.17 -3.23 -7.15 -6.78 -6.28 -11.87 -3.39 -2.61 -5.55 37.11 27.91 35.72 75.96 64.10 69.64 46.61 40.18 39.68 -3.52 -3.73 -4.06 -4.70 -5.77 -5.24 -2.23 -1.65 -2.61 FOLDpro 119
120 MUFOLD−MD 26.95 24.09 49.77 75.48 65.86 75.95 33.57 29.64 48.52 -4.19 -3.25 -1.36 -2.92 -3.21 -1.97 -3.19 -2.39 -0.88 27.34 25.52 51.15 84.61 79.49 81.51 33.57 29.64 48.52 -5.28 -4.28 -1.62 -2.04 -2.35 -1.26 -4.19 -3.34 -1.35 MUFOLD−MD 120
121 JIVE08 25.91 21.31 48.43 73.08 65.70 76.23 32.14 24.64 46.35 -4.34 -3.76 -1.56 -3.42 -3.24 -1.90 -3.37 -3.07 -1.17 38.28 29.69 52.55 84.14 78.69 78.62 51.61 38.27 50.93 -3.31 -3.31 -1.40 -2.19 -2.53 -2.23 -1.48 -1.96 -1.01 JIVE08 121
122 MeilerLabRene 21.09 16.93 32.62 44.71 30.29 44.45 29.46 23.75 41.41 -5.06 -4.56 -3.85 -9.42 -8.54 -9.98 -3.70 -3.20 -1.82 23.31 21.01 32.63 48.56 43.11 51.99 30.54 27.20 41.41 -6.01 -5.33 -4.55 -13.13 -10.44 -11.16 -4.64 -3.73 -2.36 MeilerLabRene 122
123 DistillSN 20.57 16.28 2.52 57.21 45.03 43.51 18.21 14.40 1.40 -5.14 -4.67 -8.22 -6.78 -6.33 -10.22 -5.10 -4.48 -7.10 22.27 17.01 2.52 57.21 45.03 43.51 21.61 16.55 7.41 -6.20 -6.26 -9.31 -10.47 -10.02 -14.01 -5.99 -5.43 -7.18 DistillSN 123
124 Scheraga 17.19 14.41 20.22 39.42 31.09 41.51 23.75 21.37 26.45 -5.64 -5.01 -5.65 -10.53 -8.42 -10.73 -4.41 -3.52 -3.79 18.75 15.45 23.67 39.42 35.42 45.04 25.00 23.93 31.90 -6.83 -6.62 -5.96 -15.95 -12.15 -13.49 -5.48 -4.25 -3.71 Scheraga 124
125 forecast 16.54 13.89 12.97 25.96 22.76 15.07 22.32 18.63 30.07 -5.74 -5.11 -6.71 -13.38 -9.67 -17.45 -4.59 -3.90 -3.31 17.45 14.84 22.59 40.38 39.90 50.21 22.50 18.63 30.07 -7.07 -6.76 -6.13 -15.65 -11.16 -11.76 -5.85 -5.10 -3.97 forecast 125
126 RANDOM 14.66 12.61 14.66 37.13 29.68 37.13 20.22 17.50 20.22 -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61 14.66 12.61 14.66 37.13 29.68 37.13 20.22 17.50 20.22 -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 RANDOM 126
127 mahmood−torda−server 12.76 9.29 -0.77 34.62 32.69 35.51 16.61 11.85 2.90 -6.31 -5.95 -8.70 -11.55 -8.18 -12.26 -5.30 -4.82 -6.90 12.76 9.63 -0.77 39.42 33.17 35.51 16.61 12.20 6.36 -7.91 -7.97 -9.83 -15.95 -12.65 -16.69 -6.74 -6.12 -7.33 mahmood−torda−server 127
128 TWPPLAB 12.50 11.76 -6.01 35.58 27.24 18.55 17.14 16.13 2.80 -6.35 -5.50 -9.46 -11.35 -8.99 -16.57 -5.23 -4.24 -6.91 12.50 11.76 -6.01 35.58 27.24 18.55 17.14 16.13 2.80 -7.96 -7.48 -10.65 -17.13 -13.97 -22.38 -6.66 -5.50 -7.83 TWPPLAB 128
129 schenk−torda−server 11.59 9.98 -9.59 26.44 20.99 4.82 15.36 13.21 5.37 -6.48 -5.82 -9.98 -13.28 -9.93 -20.06 -5.46 -4.64 -6.57 12.76 10.46 -9.39 37.02 30.61 33.12 16.07 13.63 5.37 -7.91 -7.78 -11.19 -16.68 -13.22 -17.49 -6.82 -5.90 -7.47 schenk−torda−server 129
130 Abagyan                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 Abagyan 130
131 BHAGEERATH                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 BHAGEERATH 131
132 FEIG_REFINE                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 FEIG_REFINE 132
133 FLOUDAS                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 FLOUDAS 133
134 HCA                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 HCA 134
135 Handl−Lovell                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 Handl−Lovell 135
136 KudlatyPredHuman                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 KudlatyPredHuman 136
137 LEE−SERVER                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 LEE−SERVER 137
138 Linnolt−UH−CMB                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 Linnolt−UH−CMB 138
139 NIM2                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 NIM2 139
140 Nano_team                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 Nano_team 140
141 OLGAFS                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 OLGAFS 141
142 Ozkan−Shell                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 Ozkan−Shell 142
143 PHAISTOS                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 PHAISTOS 143
144 POISE                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 POISE 144
145 PZ−UAM                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 PZ−UAM 145
146 ProteinShop                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 ProteinShop 146
147 RPFM                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 RPFM 147
148 SAINT1                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 SAINT1 148
149 Sasaki−Cetin−Sasai                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 Sasaki−Cetin−Sasai 149
150 ShakAbInitio                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 ShakAbInitio 150
151 TsaiLab                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 TsaiLab 151
152 UCDavisGenome                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 UCDavisGenome 152
153 Wolfson−FOBIA                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 Wolfson−FOBIA 153
154 Wolynes                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 Wolynes 154
155 YASARARefine                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 YASARARefine 155
156 dill_ucsf                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 dill_ucsf 156
157 dill_ucsf_extended                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 dill_ucsf_extended 157
158 igor                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 igor 158
159 jacobson                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 jacobson 159
160 mti                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 mti 160
161 mumssp                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 mumssp 161
162 psiphifoldings                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 psiphifoldings 162
163 rivilo                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 rivilo 163
164 sessions                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 sessions 164
165 taylor                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 taylor 165
166 test_http_server_01                                                       -6.02 -5.34 -6.46 -11.02 -8.63 -11.84 -4.85 -4.05 -4.61                                                       -7.57 -7.28 -7.39 -16.65 -13.43 -16.15 -6.19 -5.28 -5.36 test_http_server_01 166