T0460

PF0246 from Pyrococcus furiosus

Target type: Human/Server

Target sequence:

>T0460 PF0246, Pyrococcus furiosus, 111 residues
MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKYTNVKKVKIKKVYFETLDNVRVVTDYSEFQKILKKRGTKLEHHHHHH

Structure:

Method: NMR

Determined by: NESG

PDB ID: 2k4n

jumping through 460 NMR models
Jumping through 20 NMR models of 2k4n

all 20 460 NMR models
All 20 superimposed NMR models of 2k4n

PyMOL of 2k4n

Domains: PyMOL of domains

Single domain protein with poorly structured C-terminus and a long loop. Structurally variable regions were removed from NMR models for evaluation of predictions.

Structure classification:

Nqo5-like fold.

2k4n_1:1-52,67-103 cartoon
Cartoon diagram of 460: 2k4n model 1 residues 1-52,67-103

2fug_5:1-106 cartoon
Cartoon diagram of NADH-quinone oxidoreductase:
2fug chain 5 residues 1-106

CASP category:

Fold recognition. Very hard target, as its sequence is a singeton. No server found the right template.

Closest templates:

2fug, not found by any server. Local similarity, not covering the entire fold, to YbaK family proteins 1dbx found by some servers.

Target sequence - PDB file inconsistencies:

PDB sequence is an exact match to the target sequence, no discrepancies.

T0460 2k4n.pdb T0460.pdb PyMOL PyMOL of domains

T0460    1 MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKYTNVKKVKIKKVYFETLDNVRVVTDYSEFQKILKKRGTKLEHHHHHH 111
           ||||||||||||||||||||||||||||||||||||||||||||||||||||**************|||||||||||||||||||||||||||||||||||||********
2k4nA    1 MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKYTNVKKVKIKKVYFETLDNVRVVTDYSEFQKILKKRGTKLEHHHHHH 111

Residue change log: remove 53-VEPGEYDPPEMKYT-66, 104-LEHHHHHH-111 by 3.5Å SD cutoff;

Single domain protein: target 1-52, 67-103 ; pdb 1-52, 67-103

Sequence classification:

Singleton sequence, no family.

Server predictions:

T0460:pdb 1-103:seq 1-103:FR; alignment

distribution of
first scores
First models for T0460: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

#	GROUP ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	↓ GROUP	#
		T0460			T0460			T0460			T0460
		First score			First Z-score			Best score			Best Z-score
1	Jones−UCL	53.37	44.94	60.88	5.01	4.90	2.15	53.37	44.94	60.88	3.89	3.77	1.81	Jones−UCL	1
2	AMU−Biology	38.48	32.87	47.22	2.19	2.18	0.88	41.57	33.99	58.61	1.95	1.63	1.60	AMU−Biology	2
3	RBO−Proteus	38.20	31.09	52.58	2.13	1.78	1.38	39.33	32.21	54.46	1.58	1.28	1.20	RBO−Proteus	3
4	BioSerf	37.36	33.24	58.98	1.97	2.26	1.97	37.36	33.24	58.98	1.26	1.48	1.63	BioSerf	4
5	A−TASSER	37.36	32.21	51.91	1.97	2.03	1.32	37.36	32.21	53.65	1.26	1.28	1.13	A−TASSER	5
6	MULTICOM−RANK	37.36	31.55	49.40	1.97	1.88	1.08	37.36	31.55	49.40	1.26	1.15	0.72	MULTICOM−RANK	6
7	Elofsson	37.08	31.46	50.48	1.92	1.86	1.18	37.64	31.93	50.48	1.31	1.23	0.82	Elofsson	7
8	FAMS−multi	37.08	31.09	47.71	1.92	1.78	0.92	37.08	31.55	47.71	1.22	1.15	0.56	FAMS−multi	8
9	Sternberg	36.80	29.87	44.89	1.87	1.50	0.66	36.80	29.87	45.01	1.17	0.82	0.31	Sternberg	9
10	Phragment	36.80	29.87	44.83	1.87	1.50	0.66	36.80	29.87	44.83	1.17	0.82	0.29	Phragment	10
11	RAPTOR	36.52	31.84	49.41	1.81	1.95	1.08	36.52	31.84	50.46	1.12	1.21	0.82	RAPTOR	11
12	pro−sp3−TASSER	36.24	30.62	53.39	1.76	1.67	1.45	36.80	30.62	54.28	1.17	0.97	1.19	pro−sp3−TASSER	12
13	SAINT1	35.67	30.43	49.32	1.65	1.63	1.07	35.67	30.43	49.32	0.98	0.93	0.71	SAINT1	13
14	POEM	35.11	29.12	51.65	1.55	1.33	1.29	39.33	33.33	55.56	1.58	1.50	1.31	POEM	14
15	fais@hgc	33.99	27.06	42.54	1.33	0.87	0.44	33.99	27.06	47.51	0.71	0.28	0.54	fais@hgc	15
16	Zico	33.71	30.34	55.46	1.28	1.61	1.65	33.71	30.34	55.46	0.66	0.92	1.30	Zico	16
17	ZicoFullSTP	33.71	30.34	55.46	1.28	1.61	1.65	33.71	30.34	55.46	0.66	0.92	1.30	ZicoFullSTP	17
18	ZicoFullSTPFullData	33.71	30.34	55.46	1.28	1.61	1.65	33.71	30.34	55.46	0.66	0.92	1.30	ZicoFullSTPFullData	18
19	PSI	33.71	27.34	43.33	1.28	0.93	0.52	35.67	27.34	45.66	0.98	0.33	0.37	PSI	19
20	MUProt	33.43	30.06	42.58	1.23	1.54	0.45	37.08	31.65	50.38	1.22	1.17	0.82	MUProt	20
21	GeneSilico	33.43	25.56	32.24	1.23	0.53	-0.52	33.99	26.68	35.98	0.71	0.20	-0.55	GeneSilico	21
22	SHORTLE	33.15	27.34	41.94	1.17	0.93	0.39	33.15	27.34	44.28	0.57	0.33	0.24	SHORTLE	22
23	MULTICOM−REFINE	32.87	30.62	42.62	1.12	1.67	0.45	37.08	31.65	49.92	1.22	1.17	0.77	MULTICOM−REFINE	23
24	TJ_Jiang	32.87	29.77	57.99	1.12	1.48	1.88	32.87	29.87	57.99	0.53	0.82	1.54	TJ_Jiang	24
25	3DShot1	32.58	25.09	29.73	1.07	0.42	-0.75	32.58	25.09	29.73	0.48	-0.11	-1.14	3DShot1	25
26	SAM−T08−human	31.74	27.81	50.57	0.91	1.04	1.19	33.43	30.62	55.07	0.62	0.97	1.26	SAM−T08−human	26
27	3DShotMQ	31.74	18.63	33.54	0.91	-1.03	-0.40	31.74	18.63	33.54	0.34	-1.37	-0.78	3DShotMQ	27
28	Bates_BMM	31.46	27.90	51.09	0.85	1.06	1.24	31.46	27.90	51.09	0.29	0.44	0.88	Bates_BMM	28
29	MULTICOM	30.62	27.62	47.44	0.69	0.99	0.90	33.71	29.59	55.21	0.66	0.77	1.27	MULTICOM	29
30	BAKER−ROBETTA	30.62	27.06	47.26	0.69	0.87	0.88	33.43	29.87	54.85	0.62	0.82	1.24	BAKER−ROBETTA	30
31	MULTICOM−CLUSTER	30.34	22.29	41.81	0.64	-0.21	0.37	41.01	38.39	52.58	1.86	2.49	1.02	MULTICOM−CLUSTER	31
32	Bilab−UT	30.06	24.53	46.04	0.59	0.30	0.77	36.52	33.52	51.03	1.12	1.54	0.88	Bilab−UT	32
33	METATASSER	29.49	26.12	46.33	0.48	0.66	0.80	29.49	26.12	46.79	-0.03	0.09	0.48	METATASSER	33
34	ABIpro	29.49	25.56	47.74	0.48	0.53	0.93	35.67	29.87	54.85	0.98	0.82	1.24	ABIpro	34
35	LevittGroup	29.21	26.59	46.20	0.43	0.76	0.78	33.99	27.53	51.24	0.71	0.37	0.90	LevittGroup	35
36	Ozkan−Shell	28.65	24.25	47.74	0.32	0.24	0.93	29.49	25.66	49.67	-0.03	0.00	0.75	Ozkan−Shell	36
37	Zhang−Server	28.65	22.57	52.01	0.32	-0.14	1.32	32.87	26.59	52.01	0.53	0.18	0.97	Zhang−Server	37
38	McGuffin	28.65	22.57	52.01	0.32	-0.14	1.32	35.67	29.40	53.98	0.98	0.73	1.16	McGuffin	38
39	Zhang	28.65	21.44	52.99	0.32	-0.40	1.42	32.30	24.44	55.70	0.43	-0.24	1.32	Zhang	39
40	keasar	28.37	23.41	44.95	0.27	0.05	0.67	39.05	35.11	54.85	1.54	1.85	1.24	keasar	40
41	xianmingpan	28.37	23.32	41.43	0.27	0.03	0.34	28.37	23.32	41.43	-0.21	-0.46	-0.03	xianmingpan	41
42	fams−ace2	28.09	22.00	51.44	0.21	-0.27	1.27	37.36	31.93	51.44	1.26	1.23	0.92	fams−ace2	42
43	Phyre_de_novo	27.53	24.16	33.69	0.11	0.22	-0.38	27.53	24.16	35.66	-0.35	-0.29	-0.58	Phyre_de_novo	43
44	POEMQA	27.53	22.85	44.86	0.11	-0.08	0.66	36.24	33.33	55.56	1.08	1.50	1.31	POEMQA	44
45	Distill	27.53	19.66	44.45	0.11	-0.80	0.62	27.53	24.81	44.51	-0.35	-0.16	0.26	Distill	45
46	MUFOLD−MD	27.25	24.44	45.94	0.06	0.28	0.76	36.80	34.92	52.33	1.17	1.81	1.00	MUFOLD−MD	46
47	SAM−T08−server	26.97	24.34	30.31	0.00	0.26	-0.70	26.97	25.47	30.31	-0.44	-0.04	-1.09	SAM−T08−server	47
48	HHpred2	26.97	24.25	39.06	0.00	0.24	0.12	26.97	24.25	39.06	-0.44	-0.27	-0.26	HHpred2	48
49	HHpred4	26.97	23.97	38.62	0.00	0.17	0.08	26.97	23.97	38.62	-0.44	-0.33	-0.30	HHpred4	49
50	DBAKER	26.68	25.94	51.48	-0.05	0.62	1.28	59.27	47.66	67.15	4.85	4.30	2.41	DBAKER	50
51	ProteinShop	26.68	23.22	38.94	-0.05	0.00	0.11	27.81	25.47	46.69	-0.30	-0.04	0.47	ProteinShop	51
52	ShakAbInitio	26.68	22.94	47.71	-0.05	-0.06	0.92	32.02	24.53	51.22	0.39	-0.22	0.90	ShakAbInitio	52
53	3D−JIGSAW_AEP	26.40	26.22	35.80	-0.11	0.68	-0.19	26.97	26.59	36.39	-0.44	0.18	-0.51	3D−JIGSAW_AEP	53
54	HHpred5	26.40	18.35	41.80	-0.11	-1.09	0.37	26.40	18.35	41.80	-0.53	-1.43	0.00	HHpred5	54
55	Poing	26.12	24.44	35.08	-0.16	0.28	-0.25	26.12	24.44	35.08	-0.58	-0.24	-0.63	Poing	55
56	Handl−Lovell	26.12	24.44	42.91	-0.16	0.28	0.48	26.97	24.44	44.39	-0.44	-0.24	0.25	Handl−Lovell	56
57	FALCON	26.12	23.88	40.47	-0.16	0.15	0.25	35.67	30.99	47.74	0.98	1.04	0.57	FALCON	57
58	Wolynes	26.12	21.82	33.35	-0.16	-0.31	-0.42	32.02	27.53	43.86	0.39	0.37	0.20	Wolynes	58
59	FEIG	25.84	22.85	36.36	-0.21	-0.08	-0.13	25.84	22.85	40.22	-0.63	-0.55	-0.15	FEIG	59
60	IBT_LT	25.56	22.38	32.24	-0.26	-0.19	-0.52	25.56	22.38	32.24	-0.67	-0.64	-0.90	IBT_LT	60
61	LOOPP_Server	25.56	22.00	25.55	-0.26	-0.27	-1.14	25.56	22.00	25.55	-0.67	-0.71	-1.54	LOOPP_Server	61
62	Zhou−SPARKS	25.28	23.60	47.74	-0.32	0.09	0.93	25.28	23.60	47.74	-0.72	-0.40	0.57	Zhou−SPARKS	62
63	FAMSD	25.28	23.03	35.13	-0.32	-0.04	-0.25	26.12	23.32	43.32	-0.58	-0.46	0.15	FAMSD	63
64	Sasaki−Cetin−Sasai	25.28	22.47	39.39	-0.32	-0.17	0.15	28.65	25.84	41.52	-0.17	0.04	-0.02	Sasaki−Cetin−Sasai	64
65	Kolinski	25.28	21.44	28.95	-0.32	-0.40	-0.83	28.37	24.44	38.91	-0.21	-0.24	-0.27	Kolinski	65
66	GS−KudlatyPred	25.28	20.97	37.58	-0.32	-0.50	-0.02	30.90	26.78	40.42	0.20	0.22	-0.13	GS−KudlatyPred	66
67	JIVE08	25.00	23.50	25.63	-0.37	0.07	-1.14	27.53	24.44	31.36	-0.35	-0.24	-0.99	JIVE08	67
68	circle	25.00	22.66	35.44	-0.37	-0.12	-0.22	26.12	24.25	36.52	-0.58	-0.27	-0.50	circle	68
69	FLOUDAS	25.00	18.26	43.42	-0.37	-1.11	0.52	25.00	21.91	45.75	-0.76	-0.73	0.38	FLOUDAS	69
70	TASSER	24.72	22.29	44.62	-0.42	-0.21	0.64	26.12	23.60	53.65	-0.58	-0.40	1.13	TASSER	70
71	Softberry	24.72	21.72	38.38	-0.42	-0.33	0.05	24.72	24.06	38.38	-0.81	-0.31	-0.32	Softberry	71
72	Phyre2	24.44	22.94	29.55	-0.48	-0.06	-0.77	24.44	23.03	41.35	-0.86	-0.51	-0.04	Phyre2	72
73	SAM−T06−server	24.44	21.91	21.39	-0.48	-0.29	-1.53	24.44	21.91	31.96	-0.86	-0.73	-0.93	SAM−T06−server	73
74	DistillSN	24.44	21.25	30.15	-0.48	-0.44	-0.71	26.97	23.13	35.52	-0.44	-0.49	-0.59	DistillSN	74
75	3DShot2	24.16	21.72	33.57	-0.53	-0.33	-0.39	24.16	21.72	33.57	-0.90	-0.77	-0.78	3DShot2	75
76	Jiang_Zhu	23.88	23.13	35.52	-0.58	-0.02	-0.21	24.72	23.13	41.65	-0.81	-0.49	-0.01	Jiang_Zhu	76
77	MUFOLD−Server	23.88	20.88	39.11	-0.58	-0.52	0.12	24.16	20.88	39.91	-0.90	-0.93	-0.18	MUFOLD−Server	77
78	FALCON_CONSENSUS	23.88	19.57	41.04	-0.58	-0.82	0.30	31.74	22.75	44.29	0.34	-0.57	0.24	FALCON_CONSENSUS	78
79	GS−MetaServer2	23.60	20.97	24.23	-0.64	-0.50	-1.27	23.60	20.97	30.60	-0.99	-0.92	-1.06	GS−MetaServer2	79
80	GeneSilicoMetaServer	23.60	20.97	24.23	-0.64	-0.50	-1.27	23.60	20.97	30.60	-0.99	-0.92	-1.06	GeneSilicoMetaServer	80
81	LEE	23.32	22.85	34.49	-0.69	-0.08	-0.31	37.64	32.30	54.19	1.31	1.30	1.18	LEE	81
82	MeilerLabRene	23.32	18.45	37.50	-0.69	-1.07	-0.03	27.53	24.91	41.99	-0.35	-0.15	0.02	MeilerLabRene	82
83	Scheraga	23.32	16.85	36.55	-0.69	-1.43	-0.12	26.40	21.54	38.55	-0.53	-0.80	-0.31	Scheraga	83
84	MidwayFolding	23.03	19.38	36.76	-0.74	-0.86	-0.10	27.53	22.85	42.19	-0.35	-0.55	0.04	MidwayFolding	84
85	HCA	22.75	20.13	26.26	-0.80	-0.69	-1.08	22.75	20.13	26.26	-1.13	-1.08	-1.47	HCA	85
86	MULTICOM−CMFR	22.75	19.76	34.36	-0.80	-0.78	-0.32	26.40	20.23	36.21	-0.53	-1.06	-0.53	MULTICOM−CMFR	86
87	fais−server	22.75	19.29	41.07	-0.80	-0.88	0.30	36.52	31.65	52.31	1.12	1.17	1.00	fais−server	87
88	Pcons_local	22.47	20.79	23.52	-0.85	-0.54	-1.33	22.47	20.79	23.52	-1.18	-0.95	-1.73	Pcons_local	88
89	PS2−manual	22.47	19.10	28.84	-0.85	-0.92	-0.84	23.03	20.32	36.78	-1.09	-1.04	-0.47	PS2−manual	89
90	mariner1	22.19	20.88	20.87	-0.90	-0.52	-1.58	26.40	21.54	37.97	-0.53	-0.80	-0.36	mariner1	90
91	nFOLD3	22.19	20.69	24.40	-0.90	-0.57	-1.25	25.28	22.57	37.16	-0.72	-0.60	-0.44	nFOLD3	91
92	3D−JIGSAW_V3	22.19	16.48	36.19	-0.90	-1.51	-0.15	25.84	20.97	37.19	-0.63	-0.92	-0.43	3D−JIGSAW_V3	92
93	StruPPi	21.91	21.16	30.22	-0.96	-0.46	-0.71	21.91	21.16	30.22	-1.27	-0.88	-1.10	StruPPi	93
94	mGenTHREADER	21.91	20.41	27.60	-0.96	-0.63	-0.95	21.91	20.41	27.60	-1.27	-1.03	-1.34	mGenTHREADER	94
95	MUSTER	21.91	19.10	24.50	-0.96	-0.92	-1.24	25.00	22.10	30.20	-0.76	-0.69	-1.10	MUSTER	95
96	3Dpro	21.63	20.13	26.96	-1.01	-0.69	-1.01	23.88	21.72	38.56	-0.95	-0.77	-0.31	3Dpro	96
97	Pcons_dot_net	21.63	19.76	31.58	-1.01	-0.78	-0.58	25.56	20.51	36.88	-0.67	-1.01	-0.46	Pcons_dot_net	97
98	Pcons_multi	21.63	19.76	31.58	-1.01	-0.78	-0.58	25.56	21.82	33.30	-0.67	-0.75	-0.80	Pcons_multi	98
99	RPFM	21.63	18.07	34.68	-1.01	-1.16	-0.29	23.88	22.00	36.42	-0.95	-0.71	-0.51	RPFM	99
100	PS2−server	21.63	16.39	32.21	-1.01	-1.53	-0.52	30.90	29.40	40.48	0.20	0.73	-0.12	PS2−server	100
101	SMEG−CCP	21.35	19.38	30.60	-1.06	-0.86	-0.67	21.35	19.38	30.60	-1.36	-1.23	-1.06	SMEG−CCP	101
102	PRI−Yang−KiharA	21.35	19.01	28.29	-1.06	-0.94	-0.89	21.35	19.01	28.29	-1.36	-1.30	-1.28	PRI−Yang−KiharA	102
103	Hao_Kihara	21.35	18.35	22.37	-1.06	-1.09	-1.44	21.35	19.01	32.33	-1.36	-1.30	-0.90	Hao_Kihara	103
104	Frankenstein	21.07	18.45	16.96	-1.12	-1.07	-1.94	21.07	19.01	17.63	-1.41	-1.30	-2.29	Frankenstein	104
105	keasar−server	21.07	17.88	13.02	-1.12	-1.20	-2.31	21.07	18.45	14.88	-1.41	-1.41	-2.55	keasar−server	105
106	FrankensteinLong	20.79	18.54	16.37	-1.17	-1.05	-2.00	20.79	18.54	17.22	-1.45	-1.39	-2.33	FrankensteinLong	106
107	Chicken_George	20.79	16.48	37.27	-1.17	-1.51	-0.05	34.55	29.31	48.24	0.80	0.71	0.61	Chicken_George	107
108	schenk−torda−server	20.51	17.32	31.18	-1.22	-1.32	-0.62	24.44	22.57	31.18	-0.86	-0.60	-1.00	schenk−torda−server	108
109	ACOMPMOD	20.23	18.73	16.46	-1.28	-1.01	-1.99	20.51	18.73	16.46	-1.50	-1.35	-2.40	ACOMPMOD	109
110	RANDOM	20.05	17.35	20.05	-1.31	-1.32	-1.66	20.05	17.35	20.05	-1.58	-1.62	-2.06	RANDOM	110
111	forecast	19.94	19.20	25.69	-1.33	-0.90	-1.13	25.00	20.51	32.09	-0.76	-1.01	-0.92	forecast	111
112	TWPPLAB	19.66	16.01	28.84	-1.38	-1.62	-0.84	19.66	16.01	28.84	-1.64	-1.89	-1.23	TWPPLAB	112
113	FOLDpro	19.38	16.76	18.91	-1.44	-1.45	-1.76	26.68	21.72	28.87	-0.49	-0.77	-1.22	FOLDpro	113
114	SAM−T02−server	18.54	17.42	4.34	-1.60	-1.30	-3.12	22.47	19.20	33.23	-1.18	-1.26	-0.81	SAM−T02−server	114
115	EB_AMU_Physics	18.54	16.85	14.57	-1.60	-1.43	-2.17	18.54	16.85	14.57	-1.82	-1.72	-2.58	EB_AMU_Physics	115
116	FUGUE_KM	18.26	16.67	13.81	-1.65	-1.47	-2.24	19.38	17.79	18.59	-1.69	-1.54	-2.20	FUGUE_KM	116
117	FFASstandard	17.70	15.36	8.69	-1.76	-1.77	-2.71	17.70	15.36	8.69	-1.96	-2.01	-3.14	FFASstandard	117
118	OLGAFS	17.42	16.48	16.72	-1.81	-1.51	-1.97	20.79	17.98	18.24	-1.45	-1.50	-2.23	OLGAFS	118
119	mahmood−torda−server	17.42	13.02	26.07	-1.81	-2.29	-1.09	21.35	19.38	27.89	-1.36	-1.23	-1.32	mahmood−torda−server	119
120	COMA	17.14	14.51	9.66	-1.86	-1.96	-2.62	19.38	15.07	10.26	-1.69	-2.07	-2.99	COMA	120
121	FFASflextemplate	17.14	13.67	7.89	-1.86	-2.15	-2.79	17.42	13.67	7.89	-2.01	-2.34	-3.21	FFASflextemplate	121
122	FFASsuboptimal	17.14	13.67	7.89	-1.86	-2.15	-2.79	17.42	13.67	7.89	-2.01	-2.34	-3.21	FFASsuboptimal	122
123	COMA−M	16.85	12.92	10.26	-1.92	-2.32	-2.57	19.38	15.07	10.26	-1.69	-2.07	-2.99	COMA−M	123
124	fleil	16.57	14.79	13.34	-1.97	-1.89	-2.28	17.14	14.79	13.63	-2.05	-2.12	-2.67	fleil	124
125	CpHModels	15.45	14.51	0.43	-2.18	-1.96	-3.48	15.45	14.51	0.43	-2.33	-2.18	-3.92	CpHModels	125
126	panther_server	14.33	12.08	3.64	-2.40	-2.50	-3.19	14.33	13.20	3.64	-2.51	-2.43	-3.62	panther_server	126
127	rehtnap	10.67	9.18	0.00	-3.09	-3.16	-3.53	10.67	9.18	0.00	-3.11	-3.22	-3.96	rehtnap	127
128	huber−torda−server	0.00	0.00	0.00	-5.11	-5.23	-3.53	0.00	0.00	0.00	-4.86	-5.02	-3.96	huber−torda−server	128
129	Pushchino	0.00	0.00	0.00	-5.11	-5.23	-3.53	0.00	0.00	0.00	-4.86	-5.02	-3.96	Pushchino	129
130	Abagyan				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	Abagyan	130
131	BHAGEERATH				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	BHAGEERATH	131
132	CBSU				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	CBSU	132
133	DelCLab				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	DelCLab	133
134	FEIG_REFINE				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	FEIG_REFINE	134
135	Fiser−M4T				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	Fiser−M4T	135
136	KudlatyPredHuman				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	KudlatyPredHuman	136
137	LEE−SERVER				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	LEE−SERVER	137
138	Linnolt−UH−CMB				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	Linnolt−UH−CMB	138
139	NIM2				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	NIM2	139
140	Nano_team				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	Nano_team	140
141	NirBenTal				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	NirBenTal	141
142	PHAISTOS				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	PHAISTOS	142
143	POISE				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	POISE	143
144	PZ−UAM				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	PZ−UAM	144
145	ProtAnG				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	ProtAnG	145
146	SAMUDRALA				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	SAMUDRALA	146
147	TsaiLab				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	TsaiLab	147
148	UCDavisGenome				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	UCDavisGenome	148
149	Wolfson−FOBIA				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	Wolfson−FOBIA	149
150	YASARA				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	YASARA	150
151	YASARARefine				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	YASARARefine	151
152	dill_ucsf				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	dill_ucsf	152
153	dill_ucsf_extended				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	dill_ucsf_extended	153
154	igor				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	igor	154
155	jacobson				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	jacobson	155
156	mti				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	mti	156
157	mufold				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	mufold	157
158	mumssp				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	mumssp	158
159	pipe_int				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	pipe_int	159
160	psiphifoldings				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	psiphifoldings	160
161	ricardo				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	ricardo	161
162	rivilo				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	rivilo	162
163	sessions				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	sessions	163
164	taylor				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	taylor	164
165	test_http_server_01				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	test_http_server_01	165
166	tripos_08				-1.31	-1.32	-1.66				-1.58	-1.62	-2.06	tripos_08	166

Human/Server Targets
387	389	391	393
395	396	397	399
401	403	405	407
409	411	413	415
417	419	421	423
425	427	429	431
434	437	440	443
446	449	451	454
457	460	462	464
465	466	467	468
469	471	473	474
476	480	482	484
487	489	492	493
495	496	498	499
500