T0443

Human/Server Targets
387 389 391 393
395 396 397 399
401 403 405 407
409 411 413 415
417 419 421 423
425 427 429 431
434 437 440 443
446 449 451 454
457 460 462 464
465 466 467 468
469 471 473 474
476 480 482 484
487 489 492 493
495 496 498 499
500

T0443

putative regulatory protein (YP_208969.1) from Neisseria gonorrhoeae

Target type: Human/Server

Target sequence:

>T0443 FP12834A, Neisseria gonorrhoeae, 248 residues
MQPETSAQYQHRFSQAIRGGEAADGLPQDRLNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSPPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLSAISENMEGNSPSQNHLSA

Structure:
Method: X-ray, res=2.1Å, R/Rfree=0.23/0.27
Determined by: JCSG
PDB ID: 3dee

3dee cartoon
Cartoon diagram of 443: 3dee

PyMOL of 3dee

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 31-116 and 117-230. Residue ranges in target: 31-116 and 117-230:

3dee domains
Cartoon diagram of 443 evolutionary domains: 3dee, N- and C-domains are colored blue and red.

443 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

N-domain is from the SAM-domain (HhH motif) fold, both HhH motifs deteriorated, but the loops typically housing them are still possibly functional for binding.

3dee:31-117 cartoon
Cartoon diagram of N-domain of T0443: 3dee residues 31-117

2aho:B 96-176 cartoon
Middle domain of eIFα: 2aho chain B residues 96-176

DALI finds partial, but quite significant (Z-score >5) similarity to the cyclin fold, matching 4 out of 5 cyclin helices. If found, this template would produce a very accurate starting model:

3dee:31-117 cartoon
Cartoon diagram of N-domain of T0443: 3dee residues 31-117

1gh6:B 648-733 cartoon
4 helices from a cyclin domain: 1gh6 chain B 648-733

The C-domain is a circularly permuted winged HTH, i.e. the last strand of the "wing" is the first strand of the domain, like in Methionine aminopeptidase:

1bia:1-63 cartoon
Classic winged HTH in biotin repressor: 1bia residues 1-63, HTH helices are green and yellow, "wing" strands
are orange and red

3dee:118-230 cartoon
Cartoon diagram of C-domain of T0443: 3dee residues 118-230,
HTH helices are orange-yellow and orange, "wing" strands are blue and red

1b6a:378-446 cartoon
Circularly permuted HTH in Met aminopeptidase: 1b6a 378-446, HTH helices are yellow and orange, "wing" strands are blue and red

Additionally, the winged HTH in the C-domain is decorated with a 3-stranded sheet inserted after the "wing". β-hairpins and strands are known to be present just before the N-helix of the HHTH domains, e.g. cullin 1st HTH and PhoB-like domains:

3dee:118-230 cartoon
Cartoon diagram of C-domain of T0443: 3dee residues 118-230,
HTH helices are orange-yellow and orange, "wing" strands are blue and red,
side β-sheet is cyan-green

1ldj_A:586-673, B:19-28 cartoon
2nd HTH in cullin: 1ldj chains A:586-673, B:19-28, HTH helices are green and lime, "wing" strands are yellow and orange,
side β-sheet is red and blue

 

3dee:118-230 cartoon
Cartoon diagram of C-domain of T0443: 3dee residues 118-230,
HTH helices are orange-yellow and orange, "wing" strands are blue and red,
side β-sheet is cyan-green

1qqi:10-104 cartoon
HTH domain of PhoB: 1qqi residues 10-104 HTH helices are green and yellow-orange, "wing" strands are orange and red,
side β-sheet is blue-cyan

The HTH conformation looks a bit unusual, probably due to strong crystal contacts that bend the α-helices. The molecule is probably a dimer, it binds a small ligand with the two consreved Arg (one is not even modeled in the structure, it is just N-terminal to the first modeled residue), each from each monomer. This protein family is very large, and this kind of HTH without the N-domain exists as a separate protein: "Coenzyme PQQ synthesis protein D".

Interestingly HHpred server finds HTH domains as templates for this C-domain.

CASP category:

Whole chain: Free modeling.

1st domain: Fold recognition. 2nd domain: Fold recognition.

Closest templates:

The first COMPASS hit in SCOP database is to the DNA/RNA-binding 3-helical bundle HTH-containing superfamily: 

Subject = d1hsta_   a.4.5.13  Histone H5, globular domain
length=74 filtered_length=74 Neff=12.554 Smith-Waterman score = 56 Evalue = 3.65e-01
QUERY         172    TLDGFDMMLLEIMGS=SALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIII  226
CONSENSUS_1   172    PLSPLEAALLQALAE=GGLSLEALLEALAEELPDFDALLALLAQLLAQLLDAGLIL  226
                     P+S++ + +++AL E +G+SL A+   +++ ++D++ +++LL++ L++L+++G+++
CONSENSUS_2   4      PYSEMILEAIKALKERKGSSLAAIKKYIEAKYKDVENFKSLLKRALKKLVAKGKLV  59
d1hsta_       4      TYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLSIRRLLAAGVLK  59

Although E-value estimate is only marginally significant (~0.4), the alignment is largely correct and can be used for template-based modeling of the C-domain. Here is structure comparison of the segments aligned by COMPASS, HTH motif is from green to red :

3dee:172-226
HTH domain of T0443: 3dee residues 172-226

1hst_A:27-82
Histone H5: 1hst chain A residues 27-82

2dql was found by HHpred for HTH C-domain.

Target sequence - PDB file inconsistencies:

T0443    3dee.pdb    T0443.pdb    PyMOL    PyMOL of domains    

T0443    1 MQPETSAQYQHRFSQAIRGGEAADGLPQDRLNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSPPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLSAISENMEGNSPSQNHLSA 248
           ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~
3deeA   31 ------------------------------LNVYIRLIRNNIHSFIDRCYTETRQYFDSKEWSRLKEGFVRDARAQTPYFQEIPGEFLQYCQSLPLSDGILALMDFEYTQLLAEVAQIPDIPDIHYSNDSKYTPSPAAFIRQYRYDVTHDLQEAETALLIWRNAEDDVMYQTLDGFDMMLLEIMGSSALSFDTLAQTLVEFMPKADNWKNILLGKWSGWIEQRIIIPSLS------------------ 230

Residue change log: change 94 L to P; change 104, 169, 178, 179, 184, 202, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 31-116 ; pdb 31-116

2nd domain: target 117-230 ; pdb 117-230

Sequence classification:

COG3219 in CDD.

Server predictions:

T0443:pdb 31-230:seq 31-230:FM;   alignment

distribution of first scores
First models for T0443: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

443_1:pdb 31-116:seq 31-116:FR;   alignment

distribution of first scores
First models for T0443_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

443_2:pdb 117-230:seq 117-230:FR;   alignment

distribution of first scores
First models for T0443_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0443 443_1 443_2 T0443 443_1 443_2 T0443 443_1 443_2 T0443 443_1 443_2
First score First Z-score Best score Best Z-score
1 fais@hgc 23.50 21.08 35.95 34.59 28.20 46.88 39.47 34.80 38.69 2.20 2.72 0.89 0.40 0.09 1.08 2.05 2.48 0.69 23.50 21.12 36.22 39.24 31.88 46.88 39.47 34.94 39.99 1.70 2.04 0.74 0.78 0.35 0.95 1.47 1.79 0.50 fais@hgc 1
2 3DShot1 22.38 15.38 19.31 31.11 24.52 5.32 39.47 27.19 32.94 1.82 0.42 -0.61 -0.20 -0.63 -1.63 2.05 1.10 0.07 22.38 15.38 19.31 31.11 24.52 5.32 39.47 27.19 32.94 1.33 -0.16 -0.99 -0.71 -1.22 -2.24 1.47 0.48 -0.33 3DShot1 2
3 LevittGroup 21.75 16.58 38.64 35.47 32.66 45.90 38.38 28.87 43.36 1.61 0.90 1.13 0.55 0.97 1.02 1.89 1.40 1.20 24.62 19.25 40.35 38.37 35.66 47.12 42.33 32.24 45.48 2.07 1.32 1.17 0.62 1.16 0.96 1.87 1.33 1.15 LevittGroup 3
4 SAM−T08−server 21.75 16.42 37.00 30.81 27.91 36.53 36.62 27.56 45.37 1.61 0.84 0.98 -0.26 0.03 0.41 1.64 1.17 1.42 21.75 17.29 37.50 32.56 28.59 41.14 37.06 30.34 45.37 1.12 0.57 0.88 -0.44 -0.35 0.51 1.13 1.01 1.14 SAM−T08−server 4
5 FAMSD 21.50 16.54 27.65 29.07 29.07 30.18 37.28 30.04 33.39 1.53 0.89 0.14 -0.56 0.26 -0.01 1.73 1.62 0.11 21.50 16.54 27.65 35.17 29.07 33.74 37.28 30.04 33.39 1.04 0.28 -0.13 0.03 -0.25 -0.06 1.16 0.96 -0.28 FAMSD 5
6 circle 21.38 15.58 27.79 29.36 28.78 30.23 37.28 26.90 33.61 1.49 0.50 0.15 -0.51 0.20 -0.01 1.73 1.05 0.14 21.62 17.83 28.31 29.65 29.07 31.31 37.50 30.85 33.90 1.08 0.78 -0.07 -0.98 -0.25 -0.25 1.19 1.10 -0.22 circle 6
7 DBAKER 21.12 18.88 39.49 29.36 26.16 43.73 37.28 31.87 45.75 1.40 1.83 1.21 -0.51 -0.31 0.88 1.73 1.95 1.47 21.12 18.88 40.19 36.34 32.27 47.28 37.28 31.87 45.75 0.92 1.18 1.15 0.25 0.44 0.98 1.16 1.27 1.18 DBAKER 7
8 BAKER−ROBETTA 21.00 19.33 42.13 41.86 37.40 45.93 36.40 31.73 48.88 1.36 2.02 1.44 1.65 1.90 1.02 1.61 1.92 1.81 22.88 21.46 42.13 41.86 37.40 52.02 39.47 36.99 48.88 1.50 2.17 1.35 1.26 1.54 1.34 1.47 2.14 1.55 BAKER−ROBETTA 8
9 Zico 21.00 19.25 42.10 41.86 37.21 46.32 36.18 30.56 48.65 1.36 1.98 1.44 1.65 1.86 1.05 1.58 1.71 1.78 21.00 19.25 42.10 41.86 37.21 46.91 36.18 30.56 48.65 0.88 1.32 1.35 1.26 1.49 0.95 1.01 1.05 1.52 Zico 9
10 ZicoFullSTP 21.00 19.25 42.10 41.86 37.21 46.32 36.18 30.56 48.65 1.36 1.98 1.44 1.65 1.86 1.05 1.58 1.71 1.78 21.00 19.25 42.10 41.86 37.21 46.91 36.18 30.56 48.65 0.88 1.32 1.35 1.26 1.49 0.95 1.01 1.05 1.52 ZicoFullSTP 10
11 SAM−T08−human 21.00 17.00 41.42 41.86 36.63 46.16 37.06 31.07 47.60 1.36 1.07 1.38 1.65 1.75 1.04 1.70 1.80 1.67 21.25 19.88 43.62 42.15 37.40 49.24 37.06 31.36 49.52 0.96 1.56 1.50 1.31 1.54 1.13 1.13 1.19 1.63 SAM−T08−human 11
12 PSI 21.00 16.00 38.97 37.21 34.50 48.33 36.18 29.75 42.64 1.36 0.67 1.16 0.85 1.33 1.18 1.58 1.56 1.13 24.62 19.58 39.77 37.79 34.50 48.78 41.67 32.16 44.69 2.07 1.45 1.11 0.51 0.91 1.09 1.78 1.32 1.06 PSI 12
13 fams−ace2 20.88 15.88 38.09 36.34 33.62 45.89 36.40 27.05 42.45 1.32 0.62 1.08 0.70 1.16 1.02 1.61 1.07 1.11 20.88 17.04 38.09 40.70 37.02 45.89 36.40 27.05 42.45 0.84 0.47 0.94 1.05 1.45 0.87 1.04 0.45 0.79 fams−ace2 13
14 FAMS−multi 20.75 18.83 27.52 28.78 28.78 30.45 36.18 32.82 33.16 1.28 1.81 0.13 -0.61 0.20 0.01 1.58 2.12 0.09 21.25 19.83 27.52 37.79 31.30 30.45 36.84 34.06 33.77 0.96 1.54 -0.15 0.51 0.23 -0.31 1.10 1.64 -0.23 FAMS−multi 14
15 IBT_LT 20.62 18.21 16.25 40.99 32.46 17.16 35.97 31.73 22.22 1.24 1.56 -0.89 1.50 0.93 -0.86 1.55 1.92 -1.11 20.62 18.21 16.25 40.99 32.46 17.16 35.97 31.73 22.22 0.75 0.92 -1.30 1.10 0.48 -1.33 0.98 1.25 -1.60 IBT_LT 15
16 ABIpro 20.62 17.67 40.19 39.24 34.01 40.75 36.40 31.87 48.39 1.24 1.34 1.27 1.20 1.23 0.68 1.61 1.95 1.75 24.62 19.33 40.19 39.24 34.01 48.78 40.57 31.87 48.39 2.07 1.35 1.15 0.78 0.81 1.09 1.63 1.27 1.49 ABIpro 16
17 Bilab−UT 20.50 17.75 35.75 36.92 30.52 43.07 35.53 30.70 40.12 1.20 1.38 0.87 0.80 0.55 0.83 1.48 1.73 0.85 23.62 19.33 42.13 41.86 37.40 48.33 41.67 31.73 48.88 1.74 1.35 1.35 1.26 1.54 1.06 1.78 1.25 1.55 Bilab−UT 17
18 Jiang_Zhu 20.25 17.00 27.94 47.09 39.73 40.09 24.56 17.98 29.10 1.11 1.07 0.17 2.56 2.36 0.64 -0.09 -0.57 -0.35 20.25 17.00 27.94 47.09 39.73 40.09 24.56 20.39 31.12 0.63 0.46 -0.10 2.22 2.03 0.43 -0.62 -0.68 -0.55 Jiang_Zhu 18
19 FALCON_CONSENSUS 20.00 15.46 39.54 44.48 35.17 43.00 22.81 19.74 45.67 1.03 0.45 1.21 2.10 1.46 0.83 -0.34 -0.25 1.46 20.00 15.46 39.54 44.48 35.17 45.59 24.56 21.13 45.67 0.55 -0.13 1.09 1.74 1.06 0.85 -0.62 -0.55 1.17 FALCON_CONSENSUS 19
20 FALCON 20.00 15.46 39.54 44.48 35.17 43.00 22.81 19.74 45.67 1.03 0.45 1.21 2.10 1.46 0.83 -0.34 -0.25 1.46 20.50 17.75 39.54 44.48 35.17 45.59 35.53 30.70 46.12 0.71 0.75 1.09 1.74 1.06 0.85 0.92 1.07 1.23 FALCON 20
21 SAINT1 19.88 16.83 38.66 46.22 40.50 50.50 28.07 20.61 40.93 0.99 1.01 1.13 2.41 2.51 1.32 0.42 -0.09 0.94 19.88 16.83 38.66 46.22 40.50 50.50 28.07 20.61 40.93 0.51 0.39 0.99 2.06 2.20 1.22 -0.13 -0.64 0.61 SAINT1 21
22 METATASSER 19.75 17.42 37.51 40.12 35.47 44.85 23.90 21.13 40.23 0.95 1.24 1.03 1.35 1.52 0.95 -0.18 0.00 0.86 19.75 17.42 37.51 40.12 35.47 44.85 23.90 21.13 40.42 0.46 0.62 0.88 0.94 1.12 0.79 -0.72 -0.55 0.55 METATASSER 22
23 MULTICOM−CLUSTER 19.62 17.46 27.06 31.39 27.13 20.89 34.43 30.63 37.08 0.90 1.26 0.09 -0.16 -0.12 -0.62 1.33 1.72 0.52 19.62 17.46 27.06 33.14 28.49 24.25 34.43 30.63 37.08 0.42 0.64 -0.19 -0.34 -0.37 -0.79 0.76 1.06 0.16 MULTICOM−CLUSTER 23
24 pro−sp3−TASSER 19.62 14.21 36.66 38.08 25.10 44.03 22.37 21.56 40.01 0.90 -0.05 0.95 1.00 -0.52 0.90 -0.40 0.08 0.84 19.62 16.79 38.90 38.95 34.69 51.31 32.24 27.12 40.90 0.42 0.38 1.02 0.73 0.96 1.29 0.46 0.47 0.61 pro−sp3−TASSER 24
25 TASSER 19.50 16.21 37.12 36.63 31.98 46.25 22.59 21.27 39.83 0.86 0.75 0.99 0.75 0.83 1.04 -0.37 0.03 0.82 21.12 19.54 40.92 43.02 40.50 50.72 36.84 24.85 44.71 0.92 1.43 1.23 1.47 2.20 1.24 1.10 0.08 1.06 TASSER 25
26 Phyre2 19.50 15.25 26.96 27.62 22.19 12.20 34.65 24.85 41.66 0.86 0.37 0.08 -0.81 -1.09 -1.18 1.36 0.67 1.02 19.50 16.71 26.96 28.49 26.26 24.36 34.65 27.19 41.66 0.38 0.35 -0.20 -1.19 -0.85 -0.78 0.79 0.48 0.70 Phyre2 26
27 GS−MetaServer2 19.25 17.42 -14.26 0.00 0.00 -78.55 33.77 30.56 21.72 0.78 1.24 -3.64 -5.58 -5.46 -7.12 1.23 1.71 -1.16 19.62 17.42 18.74 34.01 27.81 18.22 34.43 30.56 25.29 0.42 0.62 -1.05 -0.18 -0.52 -1.25 0.76 1.05 -1.23 GS−MetaServer2 27
28 GeneSilicoMetaServer 19.25 17.42 -14.26 0.00 0.00 -78.55 33.77 30.56 21.72 0.78 1.24 -3.64 -5.58 -5.46 -7.12 1.23 1.71 -1.16 19.62 17.42 18.74 34.01 27.81 18.22 34.43 30.56 25.29 0.42 0.62 -1.05 -0.18 -0.52 -1.25 0.76 1.05 -1.23 GeneSilicoMetaServer 28
29 HHpred4 19.25 15.50 4.52 9.30 8.14 -46.72 34.21 27.78 35.28 0.78 0.47 -1.94 -3.97 -3.86 -5.04 1.29 1.21 0.32 19.25 15.50 4.52 9.30 8.14 -46.72 34.21 27.78 35.28 0.30 -0.12 -2.50 -4.70 -4.72 -6.22 0.73 0.58 -0.05 HHpred4 29
30 Zhang 19.25 14.92 40.54 36.34 31.88 49.78 32.90 25.15 44.38 0.78 0.23 1.30 0.70 0.81 1.27 1.11 0.73 1.32 21.50 20.00 40.80 44.19 36.53 53.36 37.28 34.65 45.63 1.04 1.61 1.21 1.69 1.35 1.44 1.16 1.74 1.17 Zhang 30
31 Chicken_George 19.25 14.58 35.03 34.88 30.23 42.86 33.55 25.36 38.83 0.78 0.10 0.80 0.45 0.49 0.82 1.20 0.77 0.71 19.25 15.04 38.56 37.79 34.98 49.15 33.55 25.36 44.41 0.30 -0.29 0.98 0.51 1.02 1.12 0.64 0.17 1.02 Chicken_George 31
32 Bates_BMM 19.12 17.62 36.00 38.95 34.30 43.33 30.92 26.39 40.05 0.74 1.32 0.89 1.15 1.29 0.85 0.82 0.95 0.84 24.12 18.75 39.29 38.95 34.30 43.58 42.76 35.82 46.28 1.91 1.13 1.06 0.73 0.87 0.69 1.93 1.94 1.24 Bates_BMM 32
33 MULTICOM−RANK 19.12 16.75 24.24 39.24 32.66 26.73 17.76 16.59 28.83 0.74 0.97 -0.17 1.20 0.97 -0.23 -1.06 -0.82 -0.38 19.12 16.75 24.36 39.24 32.66 26.73 23.46 19.37 32.56 0.26 0.36 -0.47 0.78 0.52 -0.60 -0.78 -0.85 -0.38 MULTICOM−RANK 33
34 McGuffin 19.00 17.29 35.26 36.63 32.85 49.72 25.44 15.50 34.47 0.70 1.19 0.82 0.75 1.00 1.27 0.04 -1.02 0.23 21.75 17.29 37.00 36.63 32.85 49.72 36.62 30.56 45.37 1.12 0.57 0.82 0.30 0.56 1.16 1.07 1.05 1.14 McGuffin 34
35 MUFOLD−Server 19.00 16.38 29.42 34.59 29.75 40.55 22.15 17.18 30.76 0.70 0.82 0.30 0.40 0.39 0.67 -0.43 -0.72 -0.17 19.00 17.08 29.42 34.59 30.91 40.55 22.15 17.18 30.77 0.22 0.49 0.05 -0.07 0.15 0.46 -0.96 -1.22 -0.59 MUFOLD−Server 35
36 Elofsson 18.88 16.67 23.96 38.66 33.82 26.92 17.76 16.52 28.22 0.66 0.94 -0.19 1.10 1.20 -0.22 -1.06 -0.83 -0.45 18.88 17.21 24.11 39.24 34.40 26.92 17.76 16.52 28.52 0.18 0.54 -0.50 0.78 0.89 -0.58 -1.58 -1.33 -0.85 Elofsson 36
37 MULTICOM−CMFR 18.75 16.54 23.83 38.95 33.72 26.55 17.32 16.37 28.20 0.61 0.89 -0.20 1.15 1.18 -0.25 -1.12 -0.86 -0.45 18.75 16.54 28.15 38.95 33.72 31.29 23.46 18.93 36.50 0.13 0.28 -0.08 0.73 0.75 -0.25 -0.78 -0.92 0.09 MULTICOM−CMFR 37
38 MULTICOM−REFINE 18.75 16.50 23.99 38.66 33.43 26.46 17.54 16.16 28.53 0.61 0.87 -0.19 1.10 1.12 -0.25 -1.09 -0.90 -0.42 19.38 17.38 28.28 38.66 33.82 27.59 34.65 31.43 37.11 0.34 0.60 -0.07 0.67 0.77 -0.53 0.79 1.20 0.16 MULTICOM−REFINE 38
39 MUProt 18.75 16.46 23.97 38.66 33.82 27.00 17.54 16.16 28.22 0.61 0.86 -0.19 1.10 1.20 -0.22 -1.09 -0.90 -0.45 19.75 16.50 28.28 38.66 33.82 27.00 34.65 27.27 37.20 0.46 0.27 -0.07 0.67 0.77 -0.58 0.79 0.49 0.17 MUProt 39
40 HHpred5 18.75 15.92 6.44 9.30 8.14 -47.08 32.90 26.46 38.58 0.61 0.64 -1.77 -3.97 -3.86 -5.06 1.11 0.97 0.68 18.75 15.92 6.44 9.30 8.14 -47.08 32.90 26.46 38.58 0.13 0.04 -2.31 -4.70 -4.72 -6.25 0.55 0.35 0.34 HHpred5 40
41 FFASsuboptimal 18.75 13.62 -12.80 0.00 0.00 -78.55 32.90 23.90 24.08 0.61 -0.29 -3.50 -5.58 -5.46 -7.12 1.11 0.50 -0.90 19.25 16.75 -11.32 0.00 0.00 -78.55 33.77 29.39 26.48 0.30 0.36 -4.13 -6.40 -6.47 -8.66 0.67 0.85 -1.09 FFASsuboptimal 41
42 mufold 18.62 17.62 32.12 36.34 33.62 42.46 24.34 17.91 33.17 0.57 1.32 0.54 0.70 1.16 0.79 -0.12 -0.58 0.09 21.00 19.33 42.30 41.86 37.40 46.05 36.18 30.56 49.07 0.88 1.35 1.37 1.26 1.54 0.88 1.01 1.05 1.57 mufold 42
43 FFASstandard 18.62 15.79 -14.71 0.00 0.00 -78.55 32.67 27.70 20.99 0.57 0.59 -3.68 -5.58 -5.46 -7.12 1.07 1.19 -1.24 18.62 15.79 -14.71 0.00 0.00 -78.55 32.67 27.70 20.99 0.09 -0.01 -4.47 -6.40 -6.47 -8.66 0.52 0.56 -1.74 FFASstandard 43
44 FFASflextemplate 18.62 15.79 -14.71 0.00 0.00 -78.55 32.67 27.70 20.99 0.57 0.59 -3.68 -5.58 -5.46 -7.12 1.07 1.19 -1.24 18.62 15.79 -14.71 0.00 0.00 -78.55 32.67 27.70 20.99 0.09 -0.01 -4.47 -6.40 -6.47 -8.66 0.52 0.56 -1.74 FFASflextemplate 44
45 RBO−Proteus 18.50 15.88 35.57 27.33 23.26 33.45 30.48 25.66 42.23 0.53 0.62 0.85 -0.86 -0.88 0.20 0.76 0.82 1.08 19.62 17.12 37.97 36.92 34.40 43.24 30.48 26.10 43.63 0.42 0.50 0.92 0.35 0.89 0.67 0.21 0.29 0.93 RBO−Proteus 45
46 3DShot2 18.38 15.29 21.94 31.11 26.07 18.12 29.17 23.10 30.44 0.49 0.38 -0.38 -0.20 -0.33 -0.80 0.57 0.36 -0.21 18.38 15.29 21.94 31.11 26.07 18.12 29.17 23.10 30.44 0.01 -0.20 -0.72 -0.71 -0.89 -1.26 0.02 -0.22 -0.63 3DShot2 46
47 Jones−UCL 18.12 15.46 40.29 35.47 30.81 52.16 29.61 24.93 42.87 0.40 0.45 1.28 0.55 0.60 1.43 0.64 0.69 1.15 18.50 16.50 40.29 36.34 31.88 52.16 29.61 25.22 43.08 0.05 0.27 1.16 0.25 0.35 1.35 0.09 0.14 0.87 Jones−UCL 47
48 TJ_Jiang 18.00 13.58 41.04 33.43 29.17 51.35 30.70 22.95 43.60 0.36 -0.31 1.35 0.20 0.28 1.38 0.79 0.33 1.23 21.25 16.58 41.20 40.70 30.62 51.35 30.70 24.64 44.21 0.96 0.30 1.26 1.05 0.08 1.29 0.24 0.05 1.00 TJ_Jiang 48
49 Zhang−Server 17.88 13.79 38.22 37.50 31.11 48.79 28.95 21.64 41.15 0.32 -0.22 1.09 0.90 0.66 1.21 0.54 0.09 0.96 20.88 18.92 38.22 40.99 34.98 52.27 35.09 31.43 41.15 0.84 1.20 0.95 1.10 1.02 1.36 0.86 1.20 0.64 Zhang−Server 49
50 keasar 17.62 15.79 37.45 34.01 29.55 47.37 23.68 21.56 40.54 0.24 0.59 1.02 0.30 0.36 1.11 -0.21 0.08 0.90 21.75 19.58 43.43 44.48 38.47 48.89 36.84 32.02 49.59 1.12 1.45 1.48 1.74 1.76 1.10 1.10 1.30 1.64 keasar 50
51 MUFOLD−MD 17.62 15.29 38.39 40.12 34.69 44.54 21.71 20.47 43.63 0.24 0.38 1.11 1.35 1.37 0.93 -0.49 -0.12 1.23 20.12 19.75 41.03 45.35 44.38 49.17 30.26 22.81 45.54 0.59 1.51 1.24 1.90 3.03 1.12 0.18 -0.27 1.16 MUFOLD−MD 51
52 COMA 17.62 14.38 7.87 40.99 32.46 18.60 12.50 9.43 7.93 0.24 0.02 -1.64 1.50 0.93 -0.77 -1.81 -2.12 -2.67 17.62 14.38 17.03 40.99 32.46 24.68 19.08 16.01 22.29 -0.24 -0.55 -1.22 1.10 0.48 -0.75 -1.39 -1.42 -1.59 COMA 52
53 3DShotMQ 17.62 14.29 24.08 31.98 22.87 23.77 28.29 22.30 31.26 0.24 -0.02 -0.18 -0.05 -0.96 -0.43 0.45 0.21 -0.12 17.62 14.29 24.08 31.98 22.87 23.77 28.29 22.30 31.26 -0.24 -0.58 -0.50 -0.55 -1.57 -0.82 -0.10 -0.35 -0.53 3DShotMQ 53
54 COMA−M 17.50 14.17 17.03 40.99 32.46 17.57 19.08 16.01 22.29 0.20 -0.07 -0.82 1.50 0.93 -0.83 -0.87 -0.93 -1.10 17.62 14.17 17.03 40.99 32.46 24.68 19.08 16.01 22.29 -0.24 -0.63 -1.22 1.10 0.48 -0.75 -1.39 -1.42 -1.59 COMA−M 54
55 fais−server 17.38 15.83 31.03 34.30 31.11 40.53 23.90 19.08 33.75 0.16 0.60 0.44 0.35 0.66 0.67 -0.18 -0.37 0.15 19.12 15.83 35.88 43.31 33.33 47.48 24.56 23.10 39.09 0.26 0.01 0.71 1.52 0.66 0.99 -0.62 -0.22 0.40 fais−server 55
56 A−TASSER 17.38 15.83 33.61 37.50 33.43 43.49 26.32 23.83 36.35 0.16 0.60 0.68 0.90 1.12 0.86 0.17 0.49 0.44 22.50 19.38 36.66 50.00 35.76 43.94 37.94 33.55 42.55 1.37 1.37 0.79 2.75 1.18 0.72 1.26 1.56 0.80 A−TASSER 56
57 HHpred2 17.38 15.25 19.05 38.95 33.91 20.04 20.39 16.74 23.35 0.16 0.37 -0.64 1.15 1.21 -0.67 -0.68 -0.79 -0.98 17.38 15.25 19.05 38.95 33.91 20.04 20.39 16.74 23.35 -0.32 -0.21 -1.01 0.73 0.79 -1.11 -1.21 -1.29 -1.46 HHpred2 57
58 ZicoFullSTPFullData 17.25 15.88 37.61 33.72 30.43 46.91 23.68 21.56 41.00 0.11 0.62 1.04 0.25 0.53 1.08 -0.21 0.08 0.95 21.00 19.25 42.10 41.86 37.21 46.91 36.18 30.56 48.65 0.88 1.32 1.35 1.26 1.49 0.95 1.01 1.05 1.52 ZicoFullSTPFullData 58
59 POEM 17.12 15.04 38.18 35.47 30.81 43.70 23.25 20.25 42.37 0.07 0.28 1.09 0.55 0.60 0.87 -0.27 -0.16 1.10 17.88 15.83 39.65 37.21 32.95 52.09 29.82 25.66 42.98 -0.15 0.01 1.10 0.41 0.58 1.35 0.12 0.22 0.86 POEM 59
60 GeneSilico 17.00 15.42 34.63 31.11 25.10 44.03 29.82 27.05 37.83 0.03 0.44 0.77 -0.20 -0.52 0.90 0.67 1.07 0.60 19.25 16.25 38.29 34.01 29.36 44.03 33.77 28.07 44.66 0.30 0.17 0.96 -0.18 -0.18 0.73 0.67 0.63 1.05 GeneSilico 60
61 huber−torda−server 16.88 14.46 14.70 35.47 28.49 31.27 18.42 15.50 11.48 -0.01 0.05 -1.03 0.55 0.15 0.06 -0.96 -1.02 -2.28 16.88 14.46 14.70 35.47 28.49 31.27 22.59 17.76 15.61 -0.48 -0.52 -1.46 0.09 -0.37 -0.25 -0.90 -1.12 -2.38 huber−torda−server 61
62 Kolinski 16.62 13.54 28.30 35.76 29.17 43.56 19.30 18.35 27.72 -0.10 -0.32 0.20 0.60 0.28 0.87 -0.84 -0.50 -0.50 16.62 14.12 32.04 35.76 29.17 43.56 23.90 19.30 37.86 -0.57 -0.65 0.32 0.14 -0.23 0.69 -0.72 -0.86 0.25 Kolinski 62
63 Distill 16.62 13.54 30.14 31.98 16.67 44.69 21.49 19.52 29.04 -0.10 -0.32 0.36 -0.05 -2.18 0.94 -0.52 -0.29 -0.36 17.12 16.00 31.89 34.01 24.61 47.45 21.71 19.52 30.93 -0.40 0.07 0.30 -0.18 -1.20 0.99 -1.02 -0.82 -0.57 Distill 63
64 MidwayFolding 16.25 14.04 30.68 33.72 28.49 43.89 18.42 15.06 30.07 -0.22 -0.12 0.41 0.25 0.15 0.89 -0.96 -1.10 -0.25 16.38 14.04 32.85 33.72 28.49 43.89 24.34 20.69 34.94 -0.65 -0.68 0.40 -0.23 -0.37 0.72 -0.65 -0.62 -0.09 MidwayFolding 64
65 RAPTOR 16.25 13.58 38.34 38.08 31.49 48.37 23.90 21.71 41.56 -0.22 -0.31 1.10 1.00 0.74 1.18 -0.18 0.11 1.01 18.38 13.58 39.57 38.08 31.49 48.37 26.97 23.90 44.70 0.01 -0.85 1.09 0.57 0.27 1.06 -0.29 -0.08 1.06 RAPTOR 65
66 fleil 16.12 13.79 18.07 30.81 25.97 20.07 17.11 14.04 23.09 -0.26 -0.22 -0.72 -0.26 -0.35 -0.67 -1.15 -1.28 -1.01 16.12 15.04 18.66 31.69 30.72 21.90 18.42 15.06 24.18 -0.73 -0.29 -1.05 -0.60 0.11 -0.97 -1.49 -1.58 -1.36 fleil 66
67 Poing 16.00 13.25 23.49 27.91 26.55 29.86 28.07 23.25 27.02 -0.30 -0.44 -0.24 -0.76 -0.23 -0.03 0.42 0.38 -0.58 21.00 17.42 27.16 29.36 26.65 33.38 31.36 26.39 30.89 0.88 0.62 -0.18 -1.03 -0.76 -0.09 0.33 0.34 -0.57 Poing 67
68 FrankensteinLong 15.88 13.67 29.10 30.23 27.33 21.89 26.54 22.66 40.05 -0.34 -0.27 0.27 -0.36 -0.08 -0.55 0.20 0.28 0.84 15.88 14.04 29.10 33.72 30.52 29.41 26.54 22.66 40.05 -0.81 -0.68 0.02 -0.23 0.06 -0.39 -0.35 -0.29 0.51 FrankensteinLong 68
69 mGenTHREADER 15.88 12.62 23.95 30.52 26.45 20.35 28.07 23.39 32.47 -0.34 -0.70 -0.19 -0.31 -0.25 -0.65 0.42 0.41 0.01 15.88 12.62 23.95 30.52 26.45 20.35 28.07 23.39 32.47 -0.81 -1.22 -0.51 -0.82 -0.81 -1.09 -0.13 -0.17 -0.39 mGenTHREADER 69
70 SHORTLE 15.75 14.25 32.15 32.56 29.07 38.66 22.59 21.13 34.60 -0.38 -0.04 0.54 0.05 0.26 0.55 -0.37 0.00 0.25 15.75 14.25 32.15 35.47 33.14 43.42 22.59 21.13 34.60 -0.86 -0.60 0.33 0.09 0.62 0.68 -0.90 -0.55 -0.13 SHORTLE 70
71 EB_AMU_Physics 15.75 13.62 22.73 27.04 22.48 19.81 25.88 22.30 30.92 -0.38 -0.29 -0.30 -0.91 -1.04 -0.69 0.10 0.21 -0.15 15.75 13.62 22.73 27.04 22.48 19.81 25.88 22.30 30.92 -0.86 -0.84 -0.64 -1.45 -1.66 -1.13 -0.44 -0.35 -0.57 EB_AMU_Physics 71
72 Phragment 15.62 12.67 23.37 25.87 22.77 17.58 26.32 21.34 31.49 -0.43 -0.68 -0.25 -1.11 -0.98 -0.83 0.17 0.04 -0.09 15.75 13.42 25.47 27.91 22.77 29.47 26.75 22.66 31.49 -0.86 -0.92 -0.36 -1.29 -1.59 -0.39 -0.32 -0.29 -0.50 Phragment 72
73 Sasaki−Cetin−Sasai 15.62 11.62 39.24 34.30 27.52 39.13 21.49 21.34 47.27 -0.43 -1.10 1.18 0.35 -0.04 0.58 -0.52 0.04 1.63 16.25 15.54 41.55 34.88 33.14 45.30 25.22 23.61 48.05 -0.69 -0.10 1.29 -0.02 0.62 0.83 -0.53 -0.13 1.45 Sasaki−Cetin−Sasai 73
74 FEIG 15.50 12.83 18.27 28.78 26.07 22.58 16.67 13.74 21.68 -0.47 -0.61 -0.71 -0.61 -0.33 -0.51 -1.21 -1.34 -1.16 15.50 13.46 25.44 29.65 26.36 35.24 22.15 17.47 26.99 -0.94 -0.90 -0.36 -0.98 -0.83 0.05 -0.96 -1.17 -1.03 FEIG 74
75 POEMQA 15.38 13.46 39.28 30.52 27.81 48.13 25.44 21.93 42.98 -0.51 -0.36 1.19 -0.31 0.01 1.16 0.04 0.15 1.16 23.12 20.54 39.65 36.34 29.84 52.09 39.91 35.38 42.98 1.58 1.82 1.10 0.25 -0.08 1.35 1.53 1.87 0.86 POEMQA 75
76 Pcons_multi 15.25 13.75 26.14 32.56 29.07 31.62 19.30 18.06 30.01 -0.55 -0.24 0.00 0.05 0.26 0.09 -0.84 -0.56 -0.25 15.25 13.75 26.22 32.56 29.07 32.21 19.30 18.06 30.01 -1.02 -0.79 -0.28 -0.44 -0.25 -0.18 -1.36 -1.07 -0.68 Pcons_multi 76
77 PRI−Yang−KiharA 15.25 13.67 26.55 32.56 28.88 33.33 19.30 18.35 29.84 -0.55 -0.27 0.04 0.05 0.22 0.20 -0.84 -0.50 -0.27 15.25 13.67 26.55 32.56 28.88 33.33 19.30 18.35 29.84 -1.02 -0.82 -0.25 -0.44 -0.29 -0.09 -1.36 -1.02 -0.70 PRI−Yang−KiharA 77
78 MULTICOM 15.25 13.62 38.97 30.23 27.52 48.15 25.66 22.15 42.67 -0.55 -0.29 1.16 -0.36 -0.04 1.17 0.07 0.19 1.13 20.88 19.04 42.18 41.86 36.82 48.15 36.18 30.26 48.74 0.84 1.24 1.36 1.26 1.41 1.04 1.01 1.00 1.54 MULTICOM 78
79 Sternberg 15.25 12.50 13.32 33.72 28.39 36.11 26.10 21.86 7.82 -0.55 -0.74 -1.15 0.25 0.13 0.38 0.13 0.13 -2.68 22.88 21.46 39.57 35.76 28.39 52.11 39.69 37.21 41.68 1.50 2.17 1.09 0.14 -0.39 1.35 1.50 2.18 0.70 Sternberg 79
80 AMU−Biology 15.25 11.42 34.89 32.27 27.23 40.57 24.34 19.37 36.79 -0.55 -1.18 0.79 -0.00 -0.10 0.67 -0.12 -0.32 0.49 21.12 16.79 37.13 32.56 30.81 46.74 38.16 30.56 44.20 0.92 0.38 0.84 -0.44 0.13 0.94 1.29 1.05 1.00 AMU−Biology 80
81 Pcons_local 14.88 14.12 27.36 31.39 29.65 34.55 19.52 17.18 30.76 -0.67 -0.09 0.11 -0.16 0.38 0.28 -0.81 -0.72 -0.17 15.50 14.12 30.62 31.39 29.65 34.55 27.41 22.30 40.09 -0.94 -0.65 0.17 -0.66 -0.12 0.00 -0.22 -0.35 0.51 Pcons_local 81
82 Pcons_dot_net 14.88 13.29 26.22 31.69 27.62 32.21 19.08 17.69 29.83 -0.67 -0.42 0.01 -0.10 -0.02 0.12 -0.87 -0.62 -0.27 15.75 14.12 27.36 34.30 29.65 34.55 26.32 23.54 30.76 -0.86 -0.65 -0.16 -0.12 -0.12 0.00 -0.38 -0.14 -0.59 Pcons_dot_net 82
83 MUSTER 14.62 13.46 28.28 29.94 25.97 34.14 23.25 18.27 32.01 -0.76 -0.36 0.20 -0.41 -0.35 0.25 -0.27 -0.52 -0.04 18.88 15.00 28.98 36.34 31.01 38.34 23.25 20.32 32.01 0.18 -0.31 0.00 0.25 0.17 0.29 -0.81 -0.69 -0.44 MUSTER 83
84 Phyre_de_novo 14.38 12.88 19.64 22.96 18.80 11.62 25.22 22.59 30.08 -0.84 -0.59 -0.58 -1.61 -1.76 -1.22 0.01 0.27 -0.25 16.12 13.12 28.40 26.16 24.23 23.38 28.29 23.03 37.93 -0.73 -1.03 -0.06 -1.61 -1.28 -0.85 -0.10 -0.23 0.26 Phyre_de_novo 84
85 SMEG−CCP 14.25 9.96 23.38 32.85 23.26 26.14 17.32 14.62 28.82 -0.88 -1.77 -0.25 0.10 -0.88 -0.27 -1.12 -1.18 -0.38 14.25 9.96 23.38 32.85 23.26 26.14 17.32 14.62 28.82 -1.35 -2.24 -0.57 -0.39 -1.49 -0.64 -1.64 -1.65 -0.82 SMEG−CCP 85
86 BioSerf 14.12 13.12 36.85 31.69 27.62 46.27 23.03 21.34 40.09 -0.93 -0.49 0.97 -0.10 -0.02 1.04 -0.30 0.04 0.85 14.12 13.12 36.85 31.69 27.62 46.27 23.03 21.34 40.09 -1.39 -1.03 0.81 -0.60 -0.56 0.90 -0.84 -0.51 0.51 BioSerf 86
87 Frankenstein 14.00 10.21 19.91 30.81 22.09 27.50 18.64 15.72 21.69 -0.97 -1.67 -0.56 -0.26 -1.11 -0.18 -0.93 -0.98 -1.16 15.38 13.92 29.39 33.14 30.33 34.70 26.10 21.71 40.63 -0.98 -0.72 0.05 -0.34 0.02 0.01 -0.41 -0.45 0.58 Frankenstein 87
88 FOLDpro 13.88 12.29 6.53 30.52 27.52 3.94 14.69 12.43 12.63 -1.01 -0.83 -1.76 -0.31 -0.04 -1.72 -1.50 -1.58 -2.15 13.88 12.29 13.49 30.52 27.52 14.96 17.11 15.94 18.22 -1.47 -1.35 -1.58 -0.82 -0.58 -1.50 -1.67 -1.43 -2.07 FOLDpro 88
89 Hao_Kihara 13.88 11.62 22.59 31.98 27.62 12.40 22.59 17.25 34.51 -1.01 -1.10 -0.32 -0.05 -0.02 -1.17 -0.37 -0.70 0.24 16.88 14.33 22.59 33.14 27.62 19.21 22.59 17.25 34.51 -0.48 -0.57 -0.65 -0.34 -0.56 -1.17 -0.90 -1.21 -0.15 Hao_Kihara 89
90 SAMUDRALA 13.75 13.25 19.16 30.81 23.64 32.03 14.91 13.30 18.75 -1.05 -0.44 -0.63 -0.26 -0.81 0.11 -1.47 -1.42 -1.48 16.75 14.96 23.27 35.17 30.33 34.38 17.54 16.81 24.69 -0.53 -0.32 -0.58 0.03 0.02 -0.01 -1.61 -1.28 -1.30 SAMUDRALA 90
91 SAM−T06−server 13.62 12.21 28.72 30.23 26.94 35.75 22.37 17.11 32.26 -1.09 -0.86 0.24 -0.36 -0.16 0.36 -0.40 -0.73 -0.01 14.00 13.67 28.72 30.23 26.94 35.75 24.12 19.08 32.26 -1.43 -0.82 -0.02 -0.87 -0.70 0.09 -0.69 -0.90 -0.41 SAM−T06−server 91
92 CpHModels 13.62 12.12 -8.26 31.69 28.20 27.15 0.00 0.00 -22.52 -1.09 -0.90 -3.10 -0.10 0.09 -0.21 -3.60 -3.83 -5.99 13.62 12.12 -8.26 31.69 28.20 27.15 0.00 0.00 -22.52 -1.56 -1.41 -3.81 -0.60 -0.43 -0.56 -4.07 -4.13 -6.88 CpHModels 92
93 Scheraga 13.50 12.04 22.64 27.91 21.32 30.30 18.20 14.40 25.41 -1.13 -0.93 -0.31 -0.76 -1.26 -0.00 -0.99 -1.22 -0.76 15.12 13.96 25.77 32.56 29.75 33.91 23.46 19.96 31.50 -1.06 -0.71 -0.33 -0.44 -0.10 -0.05 -0.78 -0.75 -0.50 Scheraga 93
94 GS−KudlatyPred 13.50 11.12 17.75 30.52 24.81 28.59 20.61 19.01 18.39 -1.13 -1.30 -0.75 -0.31 -0.58 -0.11 -0.65 -0.38 -1.52 14.88 13.29 17.75 32.27 28.00 28.59 24.78 22.00 18.88 -1.14 -0.97 -1.15 -0.50 -0.48 -0.45 -0.59 -0.40 -1.99 GS−KudlatyPred 94
95 3Dpro 13.25 11.92 19.64 26.45 20.83 15.93 23.68 19.74 27.89 -1.22 -0.98 -0.58 -1.01 -1.36 -0.94 -0.21 -0.25 -0.49 15.38 12.96 19.64 31.39 28.68 19.91 23.68 19.74 27.89 -0.98 -1.09 -0.95 -0.66 -0.33 -1.12 -0.75 -0.79 -0.93 3Dpro 95
96 pipe_int 13.12 11.38 23.93 27.91 26.26 19.07 19.08 16.52 32.33 -1.26 -1.20 -0.20 -0.76 -0.29 -0.74 -0.87 -0.83 -0.00 13.12 11.38 23.93 27.91 26.26 19.07 19.08 16.52 32.33 -1.72 -1.70 -0.51 -1.29 -0.85 -1.18 -1.39 -1.33 -0.40 pipe_int 96
97 RANDOM 12.96 10.74 12.96 28.13 24.39 28.13 16.42 14.10 16.42 -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74 12.96 10.74 12.96 28.13 24.39 28.13 16.42 14.10 16.42 -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 RANDOM 97
98 POISE 12.88 12.46 31.90 26.74 25.77 36.38 20.83 19.08 37.03 -1.34 -0.76 0.52 -0.96 -0.39 0.40 -0.62 -0.37 0.51 16.12 13.71 31.90 31.39 28.68 36.38 25.44 20.76 37.03 -0.73 -0.80 0.30 -0.66 -0.33 0.14 -0.50 -0.61 0.15 POISE 98
99 LEE 12.88 10.71 23.93 29.65 24.42 28.18 20.39 17.76 28.74 -1.34 -1.47 -0.20 -0.46 -0.65 -0.14 -0.68 -0.61 -0.39 14.25 12.25 24.74 29.65 25.97 30.69 24.78 21.27 28.81 -1.35 -1.36 -0.43 -0.98 -0.91 -0.29 -0.59 -0.53 -0.82 LEE 99
100 CBSU 12.88 10.67 20.78 29.07 23.93 19.80 18.42 17.84 27.73 -1.34 -1.48 -0.48 -0.56 -0.75 -0.69 -0.96 -0.60 -0.50 12.88 10.67 20.78 29.07 23.93 19.80 18.42 17.84 27.73 -1.80 -1.97 -0.84 -1.08 -1.35 -1.13 -1.49 -1.11 -0.95 CBSU 100
101 tripos_08 12.75 10.33 10.21 26.45 22.19 7.94 15.13 13.09 16.60 -1.38 -1.62 -1.43 -1.01 -1.09 -1.46 -1.43 -1.46 -1.72 12.75 10.33 10.87 26.45 22.19 7.94 16.67 15.57 17.67 -1.85 -2.10 -1.85 -1.56 -1.72 -2.04 -1.73 -1.49 -2.13 tripos_08 101
102 Softberry 12.50 11.12 28.18 24.71 23.45 31.69 19.52 16.45 33.63 -1.47 -1.30 0.19 -1.31 -0.84 0.09 -0.81 -0.85 0.14 12.50 11.12 28.18 24.71 23.45 31.69 19.52 16.45 33.63 -1.93 -1.80 -0.08 -1.88 -1.45 -0.22 -1.33 -1.34 -0.25 Softberry 102
103 forecast 12.50 10.21 19.04 28.20 23.45 25.97 20.18 16.23 21.14 -1.47 -1.67 -0.64 -0.71 -0.84 -0.28 -0.71 -0.89 -1.22 13.50 11.21 19.65 28.20 23.84 26.49 20.18 17.40 22.83 -1.60 -1.76 -0.95 -1.24 -1.37 -0.62 -1.24 -1.18 -1.52 forecast 103
104 DistillSN 12.38 11.75 17.16 26.74 25.19 14.98 19.74 15.64 24.22 -1.51 -1.05 -0.81 -0.96 -0.50 -1.00 -0.77 -0.99 -0.89 12.88 11.75 17.16 26.74 25.19 14.98 20.61 18.06 25.81 -1.80 -1.56 -1.21 -1.51 -1.08 -1.50 -1.18 -1.07 -1.17 DistillSN 104
105 StruPPi 11.88 8.58 6.04 16.28 13.57 -23.54 20.18 13.30 24.74 -1.67 -2.33 -1.81 -2.76 -2.79 -3.52 -0.71 -1.42 -0.83 11.88 8.58 6.04 16.28 13.57 -23.54 20.18 13.30 24.74 -2.13 -2.77 -2.35 -3.42 -3.56 -4.45 -1.24 -1.88 -1.30 StruPPi 105
106 3D−JIGSAW_AEP 11.75 10.71 -10.79 27.33 24.90 18.74 0.00 0.00 -22.52 -1.72 -1.47 -3.32 -0.86 -0.56 -0.76 -3.60 -3.83 -5.99 12.12 11.42 -10.35 28.20 26.55 20.12 0.00 0.00 -22.52 -2.05 -1.68 -4.03 -1.24 -0.79 -1.10 -4.07 -4.13 -6.88 3D−JIGSAW_AEP 106
107 ProtAnG 11.62 9.92 14.19 22.96 19.09 -3.15 19.30 17.98 28.80 -1.76 -1.79 -1.07 -1.61 -1.70 -2.19 -0.84 -0.57 -0.39 11.62 9.92 14.19 22.96 19.09 -3.15 19.30 17.98 28.80 -2.22 -2.26 -1.51 -2.20 -2.38 -2.89 -1.36 -1.08 -0.82 ProtAnG 107
108 psiphifoldings 11.50 11.21 21.27 25.29 24.61 22.86 14.69 12.21 26.90 -1.80 -1.27 -0.44 -1.21 -0.62 -0.49 -1.50 -1.62 -0.59 11.50 11.21 21.27 25.29 24.61 22.86 14.69 12.21 26.90 -2.26 -1.76 -0.79 -1.77 -1.20 -0.89 -2.01 -2.06 -1.04 psiphifoldings 108
109 ACOMPMOD 11.50 11.00 16.08 25.00 24.03 7.92 19.52 18.64 26.14 -1.80 -1.35 -0.90 -1.26 -0.73 -1.46 -0.81 -0.45 -0.68 14.25 12.83 16.50 29.65 25.39 22.68 21.71 18.64 26.14 -1.35 -1.14 -1.28 -0.98 -1.03 -0.91 -1.02 -0.97 -1.13 ACOMPMOD 109
110 FUGUE_KM 11.12 9.67 9.25 24.13 23.35 6.91 16.67 15.06 15.40 -1.93 -1.89 -1.52 -1.41 -0.86 -1.53 -1.21 -1.10 -1.85 13.62 13.04 9.69 27.62 24.71 10.69 20.61 16.08 16.63 -1.56 -1.06 -1.97 -1.35 -1.18 -1.83 -1.18 -1.41 -2.26 FUGUE_KM 110
111 SAM−T02−server 11.12 9.54 -27.84 25.87 22.38 -34.90 0.00 0.00 -22.52 -1.93 -1.94 -4.86 -1.11 -1.06 -4.26 -3.60 -3.83 -5.99 11.50 10.17 -25.29 26.74 23.64 -26.79 0.00 0.00 -22.52 -2.26 -2.16 -5.56 -1.51 -1.41 -4.70 -4.07 -4.13 -6.88 SAM−T02−server 111
112 PS2−server 11.00 9.33 2.31 25.58 21.61 24.61 12.28 10.53 -4.62 -1.97 -2.02 -2.14 -1.16 -1.21 -0.37 -1.84 -1.92 -4.04 15.38 13.00 27.03 32.56 27.23 43.41 26.54 20.83 30.64 -0.98 -1.08 -0.20 -0.44 -0.64 0.68 -0.35 -0.60 -0.60 PS2−server 112
113 PS2−manual 11.00 9.33 2.31 25.58 21.61 24.61 12.28 10.53 -4.62 -1.97 -2.02 -2.14 -1.16 -1.21 -0.37 -1.84 -1.92 -4.04 15.38 13.00 27.03 32.56 27.23 43.41 26.54 20.83 35.26 -0.98 -1.08 -0.20 -0.44 -0.64 0.68 -0.35 -0.60 -0.06 PS2−manual 113
114 nFOLD3 10.88 9.54 26.87 24.42 20.54 34.41 16.23 14.91 30.15 -2.01 -1.94 0.07 -1.36 -1.42 0.27 -1.28 -1.13 -0.24 18.25 14.29 27.84 36.34 26.55 34.41 24.78 20.39 33.37 -0.03 -0.58 -0.11 0.25 -0.79 -0.01 -0.59 -0.68 -0.28 nFOLD3 114
115 TWPPLAB 10.75 10.04 9.77 23.84 21.90 -1.74 16.23 13.45 20.40 -2.05 -1.74 -1.47 -1.46 -1.15 -2.10 -1.28 -1.39 -1.30 10.75 10.04 9.77 23.84 21.90 -1.74 16.23 13.45 20.40 -2.51 -2.21 -1.97 -2.04 -1.78 -2.78 -1.79 -1.85 -1.81 TWPPLAB 115
116 panther_server 10.75 8.79 -4.81 17.73 13.47 -15.25 15.79 12.13 3.43 -2.05 -2.24 -2.78 -2.51 -2.81 -2.98 -1.34 -1.63 -3.16 10.75 8.79 -4.81 17.73 13.47 -15.25 15.79 12.13 3.43 -2.51 -2.69 -3.46 -3.16 -3.58 -3.81 -1.86 -2.08 -3.82 panther_server 116
117 DelCLab 10.38 8.71 12.38 22.09 20.06 26.64 14.47 11.40 10.65 -2.17 -2.28 -1.24 -1.76 -1.51 -0.24 -1.53 -1.76 -2.37 11.88 10.25 12.38 26.45 23.06 26.64 14.47 12.28 15.28 -2.13 -2.13 -1.70 -1.56 -1.53 -0.60 -2.04 -2.05 -2.42 DelCLab 117
118 3D−JIGSAW_V3 10.00 9.12 -11.12 23.26 21.22 17.67 0.00 0.00 -22.52 -2.30 -2.11 -3.35 -1.56 -1.28 -0.83 -3.60 -3.83 -5.99 12.25 9.46 -9.12 28.49 22.00 24.02 0.00 0.00 -22.52 -2.01 -2.44 -3.90 -1.19 -1.76 -0.80 -4.07 -4.13 -6.88 3D−JIGSAW_V3 118
119 OLGAFS 9.88 8.58 -27.40 0.00 0.00 -78.55 17.32 15.06 0.48 -2.34 -2.33 -4.82 -5.58 -5.46 -7.12 -1.12 -1.10 -3.48 11.62 9.88 -12.12 24.71 20.83 -12.49 17.32 15.06 0.48 -2.22 -2.27 -4.21 -1.88 -2.01 -3.60 -1.64 -1.58 -4.16 OLGAFS 119
120 mariner1 9.88 7.96 8.77 20.93 16.38 -0.94 16.45 13.09 18.05 -2.34 -2.58 -1.56 -1.96 -2.24 -2.04 -1.25 -1.46 -1.56 19.88 17.29 31.69 28.20 24.23 26.55 35.09 30.56 42.69 0.51 0.57 0.28 -1.24 -1.28 -0.61 0.86 1.05 0.82 mariner1 120
121 keasar−server 9.75 8.17 -1.22 17.15 15.70 -22.53 13.16 11.84 12.48 -2.38 -2.49 -2.46 -2.61 -2.37 -3.46 -1.72 -1.68 -2.17 18.12 14.50 15.54 28.78 26.16 19.16 32.02 25.66 35.96 -0.07 -0.50 -1.37 -1.13 -0.87 -1.18 0.42 0.22 0.03 keasar−server 121
122 schenk−torda−server 9.62 8.29 8.41 20.64 17.54 -6.66 13.82 12.35 21.31 -2.43 -2.45 -1.59 -2.01 -2.01 -2.42 -1.62 -1.59 -1.21 9.88 8.62 8.41 20.64 17.54 -6.66 17.54 15.21 21.33 -2.79 -2.76 -2.10 -2.62 -2.71 -3.15 -1.61 -1.55 -1.70 schenk−torda−server 122
123 rehtnap 8.00 7.33 -33.43 0.00 0.00 -78.55 14.04 12.87 -9.29 -2.97 -2.83 -5.36 -5.58 -5.46 -7.12 -1.59 -1.50 -4.55 8.00 7.67 -33.23 0.00 0.00 -78.55 14.04 13.45 -8.96 -3.41 -3.12 -6.37 -6.40 -6.47 -8.66 -2.10 -1.85 -5.28 rehtnap 123
124 Pushchino 6.12 5.62 -35.62 0.00 0.00 -78.55 10.75 9.87 -12.81 -3.59 -3.52 -5.56 -5.58 -5.46 -7.12 -2.06 -2.04 -4.93 6.12 5.62 -35.62 0.00 0.00 -78.55 10.75 9.87 -12.81 -4.03 -3.91 -6.62 -6.40 -6.47 -8.66 -2.56 -2.46 -5.73 Pushchino 124
125 Abagyan                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 Abagyan 125
126 BHAGEERATH                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 BHAGEERATH 126
127 FEIG_REFINE                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 FEIG_REFINE 127
128 FLOUDAS                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 FLOUDAS 128
129 Fiser−M4T                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 Fiser−M4T 129
130 HCA                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 HCA 130
131 Handl−Lovell                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 Handl−Lovell 131
132 JIVE08                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 JIVE08 132
133 KudlatyPredHuman                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 KudlatyPredHuman 133
134 LEE−SERVER                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 LEE−SERVER 134
135 LOOPP_Server                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 LOOPP_Server 135
136 Linnolt−UH−CMB                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 Linnolt−UH−CMB 136
137 MeilerLabRene                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 MeilerLabRene 137
138 NIM2                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 NIM2 138
139 Nano_team                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 Nano_team 139
140 NirBenTal                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 NirBenTal 140
141 Ozkan−Shell                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 Ozkan−Shell 141
142 PHAISTOS                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 PHAISTOS 142
143 PZ−UAM                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 PZ−UAM 143
144 ProteinShop                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 ProteinShop 144
145 RPFM                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 RPFM 145
146 ShakAbInitio                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 ShakAbInitio 146
147 TsaiLab                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 TsaiLab 147
148 UCDavisGenome                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 UCDavisGenome 148
149 Wolfson−FOBIA                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 Wolfson−FOBIA 149
150 Wolynes                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 Wolynes 150
151 YASARA                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 YASARA 151
152 YASARARefine                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 YASARARefine 152
153 Zhou−SPARKS                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 Zhou−SPARKS 153
154 dill_ucsf                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 dill_ucsf 154
155 dill_ucsf_extended                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 dill_ucsf_extended 155
156 igor                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 igor 156
157 jacobson                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 jacobson 157
158 mahmood−torda−server                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 mahmood−torda−server 158
159 mti                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 mti 159
160 mumssp                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 mumssp 160
161 ricardo                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 ricardo 161
162 rivilo                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 rivilo 162
163 sessions                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 sessions 163
164 taylor                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 taylor 164
165 test_http_server_01                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 test_http_server_01 165
166 xianmingpan                                                       -1.31 -1.46 -1.18 -0.72 -0.66 -0.14 -1.25 -1.27 -1.74                                                       -1.78 -1.94 -1.64 -1.25 -1.25 -0.49 -1.77 -1.74 -2.28 xianmingpan 166