T0476

Human/Server Targets
387 389 391 393
395 396 397 399
401 403 405 407
409 411 413 415
417 419 421 423
425 427 429 431
434 437 440 443
446 449 451 454
457 460 462 464
465 466 467 468
469 471 473 474
476 480 482 484
487 489 492 493
495 496 498 499
500

T0476

protein PF0385 from Pyrococcus furiosus

Target type: Human/Server

Target sequence:

>T0476 PfG1, Pyrococcus furiosus, 108 residues
SAKCPICGSPLKWEELIEEMLIIENFEEIVKDRERFLAQVEEFVFKCPVCGEEFYGKTLPRREAEKVFELLNDFKGGIDWENKRVKLKLNDLLALETMLEEWDRRVKR

Structure:
Method: NMR
Determined by: NESG
PDB ID: 2k5c

jumping through 476 NMR models
Jumping through 10 NMR models of 2k5c

all 10 476 NMR models
All 10 superimposed NMR models of 2k5c

PyMOL of 2k5c

Domains:  PyMOL of domains

Single domain protein. Impressive NMR structure with all residues modeled well.

Structure classification:

Rubredoxin-like zinc-ribbon elaborated by the insertion of 3 α-helices (blue-cyan-green) between the two zinc-knuckles and a C-terminal α-helix (orange) followed by a β-hairpin (red). Zinc ion is shown in magenta and side chains of its ligands (four Cys) are displayed.

2k5c_1 cartoon
Cartoon diagram of T0476: 2k5c model 1

CASP category:

Fold recognition. This protein is a "hybrid" of fold recongnition and de-novo modeling. The zinc-ribbon is possible to detect, although care needs to be taken to distinguish it from spurious HHsearch hits to C2H2 zinc-fingers. However, no homologus template existis to model α-helical insertion and C-terminal extension, which are quite long and essential to produce a good model.

Closest templates:

Rubredoxin-like zinc-ribbon proteins, e.g. 2q5h, 1ma3: 

T0476    -----SAKCPICGSPLKWEELIEEMLIIE-----------------NFEEIVKDRERFLAQVEEFVFKCPVCGEE-FYGKTLPRREAEKVFELLNDFKGGIDWENKRVKLKLNDLLALETMLEEWDRRVKR
1MA3_A   HGSMDKLDCLDCHETYDWSEFVEDFNKGEI------------------------------------PRCRKCGSYYVKPR---------------------------------------------------
2Q5H_A   ----FMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGND-LSPP---------------------------------------------------

No homologous template exists for the α-helical parts, however the following non-homologous segment can be found by sequence methods and is structurally similar: 

T0476    KWEELIEEMLIIENFEEIVKDRERFLAQVEE

2c3n_A   DLVAITELMHPVGAGCQVFEGRPKLATWRQR

Target sequence - PDB file inconsistencies:

The first residue is Met in the target, but Ser in PDB. 20 C-terminal residues of the target 89-LNDLLALETMLEEWDRRVKR-108 are not present in NMR structure. PDN numbering starts from 8, so residue 1 in the target corresponds to residue 8 in PDB.

T0476    2k5c.pdb    T0476.pdb    PyMOL    PyMOL of domains    

T0476    1 SAKCPICGSPLKWEELIEEMLIIENFEEIVKDRERFLAQVEEFVFKCPVCGEEFYGKTLPRREAEKVFELLNDFKGGIDWENKRVKLKLNDLLALETMLEEWDRRVKR 108
           :|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~
2k5cA    8 MAKCPICGSPLKWEELIEEMLIIENFEEIVKDRERFLAQVEEFVFKCPVCGEEFYGKTLPRREAEKVFELLNDFKGGIDWENKRVKLK-------------------- 95

Residue change log: change 8 M to S;

Single domain protein: target 1-88 ; pdb 8-95

Sequence classification:

Apparently a prototype for a new small undescribed domain family of archaeal proteins: 

1: NP_578114 hypothetical protein PF0385 [Pyrococcus furiosus DSM 3638] gi|18976757|ref|NP_578114.1|[18976757]
2: YP_183059 hypothetical protein TK0646 [Thermococcus kodakarensis KOD1] gi|57640581|ref|YP_183059.1|[57640581]
3: NP_142504 hypothetical protein PH0535 [Pyrococcus horikoshii OT3] gi|14590436|ref|NP_142504.1|[14590436]
4: NP_127185 hypothetical protein PAB1367 [Pyrococcus abyssi GE5] gi|33356798|ref|NP_127185.2|[33356798]
5: CAB50415 Hypothetical protein [Pyrococcus abyssi GE5] gi|5458928|emb|CAB50415.1|[5458928]


Conservation:                      99599 99  959 5995599  55 5 555955 95    5959999599999595 99  9 9999999999995999 555955599 99595 9995999555 555 
gi_18976757_ref_NP_578114    1  ---MAKCPICGSPLKWEELIEEMLIIENFEEIVKDRERFLAQVEEFVFKCPVCGEEFYGKTLPRREAEKVFELLNDFKGGIDWENKRVKLKLNDLLALETMLEEWDRRVKR----  108
gi_57640581_ref_YP_183059    1  ---MARCPLCGKALDWAELINQMLEKGVGEDVFKDRDKFMETFNDFVFKCPHCGEEFYGRNLPASETEKVFELLNDFKGSIDWDNKRVRLRLNSLLALDSMLENWDRKMSQKRS-  111
gi_14590436_ref_NP_142504    1  MLGMAKCPVCGSTLDWRELIEQMLSMENAREVFSDKERFLKELEEFTFKCPVCGEEFLGKYLPREEGEKVFELLNDFKGSIDWERRKVRIRLNQLLVLDKMLEEWDRRVKNVGHK  115
gi_33356798_ref_NP_127185    1  MLGMAKCPVCGASLDWRDLIEQMLTLENAEDIFKDREEFLGKLKEFTFKCPVCGEEFLGKYLPMDEAEKVFELLNDFKGSIDWDNRKVRIRLNQLLALDKMLEEWDRRVKNVGHK  115
gi_5458928_emb_CAB50415.1    1  ---MAKCPVCGASLDWRDLIEQMLTLENAEDIFKDREEFLGKLKEFTFKCPVCGEEFLGKYLPMDEAEKVFELLNDFKGSIDWDNRKVRIRLNQLLALDKMLEEWDRRVKNVGHK  112
Consensus_aa:                   ...MA+CPlCG.sLcW.-LIppML.b.s.E-lhKDR-cFh.php-FhFKCPhCGEEFhG+.LP.pEhEKVFELLNDFKGtIDW-N++V+l+LNpLLAL-pMLEpWDR+hpp..p.
Consensus_ss:                                  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh      hhhhhh   hhhhhhhhhhhhhh         eehhhhhhhhhhhhhhhhhhhhhhhh

Comments:

Server predictions:

T0476:pdb 8-95:seq 1-88:FR;   alignment

distribution of first scores
First models for T0476: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0476 T0476 T0476 T0476
First score First Z-score Best score Best Z-score
1 DBAKER 50.00 41.76 61.84 4.56 4.02 2.26 50.00 41.76 61.84 3.31 3.10 2.16 DBAKER 1
2 fleil 41.95 35.82 43.46 2.89 2.64 0.18 43.39 35.82 44.82 2.14 1.82 0.04 fleil 2
3 3D−JIGSAW_AEP 39.37 33.05 49.74 2.36 1.99 0.89 40.52 35.54 49.74 1.63 1.76 0.65 3D−JIGSAW_AEP 3
4 IBT_LT 38.22 30.36 49.16 2.12 1.37 0.82 38.22 30.36 49.16 1.23 0.64 0.58 IBT_LT 4
5 SAM−T08−human 37.93 35.25 50.95 2.06 2.50 1.03 38.22 35.25 51.00 1.23 1.70 0.81 SAM−T08−human 5
6 Jones−UCL 37.36 29.31 50.86 1.94 1.12 1.02 37.36 32.09 52.85 1.08 1.01 1.04 Jones−UCL 6
7 POEMQA 37.07 34.58 51.43 1.88 2.35 1.08 42.24 35.15 52.20 1.94 1.67 0.96 POEMQA 7
8 Zico 36.78 33.33 50.32 1.82 2.06 0.95 36.78 33.33 50.32 0.97 1.28 0.72 Zico 8
9 ZicoFullSTP 36.78 33.33 50.32 1.82 2.06 0.95 36.78 33.33 50.32 0.97 1.28 0.72 ZicoFullSTP 9
10 ZicoFullSTPFullData 36.78 33.33 50.32 1.82 2.06 0.95 36.78 33.33 50.32 0.97 1.28 0.72 ZicoFullSTPFullData 10
11 HHpred5 36.49 32.85 41.86 1.76 1.95 -0.00 36.49 32.85 41.86 0.92 1.18 -0.33 HHpred5 11
12 fams−ace2 35.92 29.60 55.78 1.64 1.19 1.57 35.92 29.60 55.78 0.82 0.48 1.40 fams−ace2 12
13 MUFOLD−MD 35.92 29.41 56.74 1.64 1.15 1.68 48.28 37.16 56.74 3.00 2.11 1.52 MUFOLD−MD 13
14 LevittGroup 35.34 31.13 47.31 1.52 1.55 0.61 41.95 34.48 53.95 1.89 1.53 1.18 LevittGroup 14
15 PSI 35.34 31.13 45.04 1.52 1.55 0.36 35.92 31.70 46.87 0.82 0.93 0.29 PSI 15
16 Wolynes 35.34 30.17 41.32 1.52 1.32 -0.07 40.52 35.92 42.51 1.63 1.84 -0.25 Wolynes 16
17 3D−JIGSAW_V3 35.06 30.08 43.84 1.46 1.30 0.22 37.64 34.58 43.84 1.13 1.55 -0.08 3D−JIGSAW_V3 17
18 GeneSilico 35.06 29.98 55.35 1.46 1.28 1.52 36.21 29.98 55.95 0.87 0.56 1.42 GeneSilico 18
19 Phyre2 34.20 32.66 49.13 1.29 1.90 0.82 34.20 32.66 49.13 0.52 1.14 0.58 Phyre2 19
20 METATASSER 34.20 31.32 47.25 1.29 1.59 0.61 34.20 31.32 51.93 0.52 0.85 0.92 METATASSER 20
21 HHpred4 34.20 31.32 39.82 1.29 1.59 -0.24 34.20 31.32 39.82 0.52 0.85 -0.58 HHpred4 21
22 HHpred2 34.20 31.32 39.82 1.29 1.59 -0.24 34.20 31.32 39.82 0.52 0.85 -0.58 HHpred2 22
23 Sternberg 33.91 28.16 55.66 1.23 0.86 1.56 37.07 35.92 56.31 1.02 1.84 1.47 Sternberg 23
24 Handl−Lovell 33.05 28.83 55.26 1.05 1.01 1.51 37.64 28.83 55.26 1.13 0.31 1.34 Handl−Lovell 24
25 SHORTLE 32.47 27.49 37.79 0.93 0.70 -0.47 36.21 35.25 41.65 0.87 1.70 -0.35 SHORTLE 25
26 Zhang 32.18 26.44 52.47 0.87 0.46 1.20 42.24 34.39 55.38 1.94 1.51 1.35 Zhang 26
27 mufold 31.61 27.78 52.20 0.75 0.77 1.17 42.82 33.81 53.53 2.04 1.38 1.12 mufold 27
28 FALCON 31.61 27.20 45.58 0.75 0.63 0.42 31.61 27.78 45.62 0.06 0.08 0.14 FALCON 28
29 MULTICOM 31.61 25.77 49.16 0.75 0.30 0.82 43.10 34.96 52.54 2.09 1.63 1.00 MULTICOM 29
30 BAKER−ROBETTA 31.32 29.02 52.35 0.69 1.06 1.18 41.67 34.00 53.07 1.84 1.43 1.07 BAKER−ROBETTA 30
31 Bates_BMM 31.32 29.02 47.33 0.69 1.06 0.62 31.32 29.02 47.33 0.01 0.35 0.35 Bates_BMM 31
32 KudlatyPredHuman 31.32 28.83 46.07 0.69 1.01 0.47 31.32 28.83 46.07 0.01 0.31 0.20 KudlatyPredHuman 32
33 Zhang−Server 31.32 26.44 48.46 0.69 0.46 0.74 43.10 33.91 52.27 2.09 1.41 0.97 Zhang−Server 33
34 Sasaki−Cetin−Sasai 30.75 24.33 59.16 0.57 -0.03 1.96 35.63 33.52 61.17 0.77 1.32 2.07 Sasaki−Cetin−Sasai 34
35 fais@hgc 30.17 26.53 48.14 0.45 0.48 0.71 32.76 28.16 51.04 0.26 0.17 0.81 fais@hgc 35
36 FALCON_CONSENSUS 30.17 24.43 43.67 0.45 -0.01 0.20 31.61 27.20 45.58 0.06 -0.04 0.13 FALCON_CONSENSUS 36
37 Phragment 29.89 28.74 51.11 0.39 0.99 1.04 29.89 28.74 55.29 -0.24 0.29 1.34 Phragment 37
38 TASSER 29.89 25.86 50.49 0.39 0.32 0.97 34.48 29.50 51.38 0.57 0.45 0.86 TASSER 38
39 ABIpro 29.60 22.70 47.28 0.33 -0.41 0.61 29.89 25.19 50.02 -0.24 -0.48 0.69 ABIpro 39
40 MidwayFolding 29.60 22.13 45.46 0.33 -0.54 0.40 29.60 22.61 45.67 -0.29 -1.03 0.15 MidwayFolding 40
41 POEM 29.02 28.07 50.69 0.21 0.84 1.00 35.63 31.23 56.42 0.77 0.83 1.48 POEM 41
42 Bilab−UT 29.02 27.49 43.97 0.21 0.70 0.23 34.20 29.21 52.56 0.52 0.39 1.00 Bilab−UT 42
43 taylor 29.02 26.15 42.99 0.21 0.39 0.12 29.02 26.15 42.99 -0.39 -0.27 -0.19 taylor 43
44 BioSerf 28.74 23.37 43.72 0.15 -0.26 0.21 29.31 27.39 46.80 -0.34 -0.00 0.29 BioSerf 44
45 Jiang_Zhu 28.45 24.23 39.01 0.09 -0.06 -0.33 28.45 24.43 39.01 -0.50 -0.64 -0.68 Jiang_Zhu 45
46 RPFM 28.45 20.59 38.04 0.09 -0.90 -0.44 30.46 24.14 42.13 -0.14 -0.70 -0.29 RPFM 46
47 A−TASSER 28.16 25.48 47.81 0.03 0.23 0.67 39.08 34.67 50.57 1.38 1.57 0.75 A−TASSER 47
48 Poing 28.16 23.18 43.60 0.03 -0.30 0.19 28.16 23.47 44.44 -0.55 -0.85 -0.01 Poing 48
49 FEIG 27.87 24.04 47.42 -0.03 -0.10 0.63 35.06 31.42 47.42 0.67 0.87 0.36 FEIG 49
50 Softberry 27.87 23.95 40.01 -0.03 -0.12 -0.21 27.87 23.95 40.01 -0.60 -0.74 -0.56 Softberry 50
51 forecast 27.59 25.29 38.37 -0.09 0.19 -0.40 28.16 25.96 40.51 -0.55 -0.31 -0.50 forecast 51
52 RAPTOR 27.59 24.52 46.56 -0.09 0.01 0.53 37.64 34.00 53.31 1.13 1.43 1.10 RAPTOR 52
53 Hao_Kihara 27.59 24.14 30.85 -0.09 -0.08 -1.25 29.31 27.59 40.51 -0.34 0.04 -0.50 Hao_Kihara 53
54 Kolinski 27.59 23.18 43.93 -0.09 -0.30 0.23 27.59 25.57 43.93 -0.65 -0.39 -0.07 Kolinski 54
55 pipe_int 27.30 25.29 36.32 -0.15 0.19 -0.63 28.16 25.29 42.49 -0.55 -0.45 -0.25 pipe_int 55
56 MUSTER 27.30 24.23 47.29 -0.15 -0.06 0.61 33.62 29.41 47.29 0.42 0.43 0.35 MUSTER 56
57 xianmingpan 27.30 23.08 42.02 -0.15 -0.32 0.01 27.30 23.08 42.02 -0.70 -0.93 -0.31 xianmingpan 57
58 SAINT1 27.01 22.80 46.70 -0.21 -0.39 0.54 27.01 22.80 46.70 -0.75 -0.99 0.27 SAINT1 58
59 FAMSD 27.01 22.03 44.09 -0.21 -0.57 0.25 28.45 23.28 44.09 -0.50 -0.89 -0.05 FAMSD 59
60 McGuffin 27.01 22.03 44.09 -0.21 -0.57 0.25 33.91 28.54 47.97 0.47 0.25 0.43 McGuffin 60
61 FAMS−multi 26.72 25.19 40.01 -0.27 0.17 -0.21 26.72 25.19 42.65 -0.80 -0.48 -0.23 FAMS−multi 61
62 PHAISTOS 26.72 23.95 42.12 -0.27 -0.12 0.02 27.01 25.38 42.35 -0.75 -0.43 -0.27 PHAISTOS 62
63 MUFOLD−Server 26.44 23.47 41.48 -0.32 -0.23 -0.05 27.87 24.90 41.64 -0.60 -0.54 -0.36 MUFOLD−Server 63
64 3DShot1 26.44 22.89 32.58 -0.32 -0.37 -1.06 26.44 22.89 32.58 -0.85 -0.97 -1.48 3DShot1 64
65 3DShot2 26.44 21.84 23.90 -0.32 -0.61 -2.04 26.44 21.84 23.90 -0.85 -1.20 -2.56 3DShot2 65
66 RBO−Proteus 26.15 23.47 41.50 -0.38 -0.23 -0.05 26.44 23.56 41.50 -0.85 -0.83 -0.37 RBO−Proteus 66
67 Ozkan−Shell 26.15 21.55 42.50 -0.38 -0.68 0.07 31.32 28.07 49.51 0.01 0.15 0.62 Ozkan−Shell 67
68 SAM−T06−server 25.86 23.75 61.39 -0.44 -0.17 2.21 34.20 30.17 61.39 0.52 0.60 2.10 SAM−T06−server 68
69 keasar 25.86 23.28 42.58 -0.44 -0.28 0.08 37.93 33.72 49.89 1.18 1.37 0.67 keasar 69
70 PRI−Yang−KiharA 25.86 22.51 18.52 -0.44 -0.46 -2.65 25.86 22.51 18.52 -0.95 -1.05 -3.23 PRI−Yang−KiharA 70
71 Distill 25.86 21.84 40.13 -0.44 -0.61 -0.20 25.86 21.84 41.84 -0.95 -1.20 -0.33 Distill 71
72 FOLDpro 25.57 22.99 19.30 -0.51 -0.34 -2.56 25.57 22.99 44.93 -1.00 -0.95 0.05 FOLDpro 72
73 Scheraga 25.57 22.13 38.61 -0.51 -0.54 -0.37 28.16 25.10 42.70 -0.55 -0.50 -0.22 Scheraga 73
74 nFOLD3 25.57 21.36 38.44 -0.51 -0.72 -0.39 27.59 23.75 42.48 -0.65 -0.79 -0.25 nFOLD3 74
75 Chicken_George 25.29 22.80 42.27 -0.56 -0.39 0.04 30.75 26.63 51.17 -0.09 -0.17 0.83 Chicken_George 75
76 EB_AMU_Physics 25.00 23.66 45.15 -0.62 -0.19 0.37 25.00 23.66 45.15 -1.10 -0.81 0.08 EB_AMU_Physics 76
77 pro−sp3−TASSER 25.00 22.89 47.74 -0.62 -0.37 0.66 37.36 32.18 52.67 1.08 1.03 1.02 pro−sp3−TASSER 77
78 FUGUE_KM 25.00 22.32 16.99 -0.62 -0.50 -2.82 29.31 25.10 34.89 -0.34 -0.50 -1.20 FUGUE_KM 78
79 SMEG−CCP 25.00 18.10 42.15 -0.62 -1.48 0.03 25.00 18.10 42.15 -1.10 -2.01 -0.29 SMEG−CCP 79
80 DelCLab 24.71 23.18 22.89 -0.68 -0.30 -2.16 24.71 23.18 22.89 -1.16 -0.91 -2.69 DelCLab 80
81 3DShotMQ 24.71 21.55 24.85 -0.68 -0.68 -1.93 24.71 21.55 24.85 -1.16 -1.26 -2.44 3DShotMQ 81
82 mariner1 24.71 20.69 37.03 -0.68 -0.88 -0.55 36.49 31.13 37.03 0.92 0.81 -0.93 mariner1 82
83 Phyre_de_novo 24.43 23.08 38.23 -0.74 -0.32 -0.42 24.43 23.08 38.43 -1.20 -0.93 -0.75 Phyre_de_novo 83
84 LEE 24.43 22.03 42.42 -0.74 -0.57 0.06 32.47 27.78 42.42 0.21 0.08 -0.26 LEE 84
85 Pcons_dot_net 24.43 21.55 34.85 -0.74 -0.68 -0.80 28.16 23.37 37.65 -0.55 -0.87 -0.85 Pcons_dot_net 85
86 Pcons_multi 24.43 21.55 34.85 -0.74 -0.68 -0.80 24.71 21.84 47.97 -1.16 -1.20 0.43 Pcons_multi 86
87 mGenTHREADER 24.43 17.15 12.56 -0.74 -1.70 -3.33 24.43 17.15 12.56 -1.20 -2.21 -3.97 mGenTHREADER 87
88 mumssp 24.14 23.18 35.55 -0.80 -0.30 -0.72 24.14 23.18 35.55 -1.26 -0.91 -1.11 mumssp 88
89 POISE 24.14 22.13 37.15 -0.80 -0.54 -0.54 25.57 23.37 39.99 -1.00 -0.87 -0.56 POISE 89
90 MeilerLabRene 24.14 22.03 40.61 -0.80 -0.57 -0.15 25.29 22.99 40.61 -1.05 -0.95 -0.48 MeilerLabRene 90
91 PS2−server 24.14 21.93 32.25 -0.80 -0.59 -1.09 25.57 24.43 41.60 -1.00 -0.64 -0.36 PS2−server 91
92 PS2−manual 24.14 21.93 32.25 -0.80 -0.59 -1.09 25.57 24.43 41.60 -1.00 -0.64 -0.36 PS2−manual 92
93 SAM−T08−server 24.14 21.07 50.53 -0.80 -0.79 0.98 29.60 28.45 56.43 -0.29 0.23 1.48 SAM−T08−server 93
94 FLOUDAS 23.85 22.80 41.97 -0.86 -0.39 0.01 31.03 22.80 44.19 -0.04 -0.99 -0.04 FLOUDAS 94
95 keasar−server 23.85 17.34 36.33 -0.86 -1.66 -0.63 27.59 23.56 37.07 -0.65 -0.83 -0.92 keasar−server 95
96 igor 23.56 22.22 39.00 -0.92 -0.52 -0.33 23.56 22.22 39.00 -1.36 -1.12 -0.68 igor 96
97 FFASflextemplate 23.56 21.36 12.02 -0.92 -0.72 -3.39 23.56 21.36 12.18 -1.36 -1.30 -4.02 FFASflextemplate 97
98 FFASstandard 23.56 20.69 12.18 -0.92 -0.88 -3.37 23.56 21.36 12.18 -1.36 -1.30 -4.02 FFASstandard 98
99 COMA−M 23.56 20.50 21.45 -0.92 -0.92 -2.32 23.56 20.69 21.45 -1.36 -1.45 -2.87 COMA−M 99
100 COMA 23.56 20.50 21.45 -0.92 -0.92 -2.32 23.56 20.69 21.45 -1.36 -1.45 -2.87 COMA 100
101 FFASsuboptimal 23.28 21.17 17.05 -0.98 -0.77 -2.82 24.14 21.46 19.04 -1.26 -1.28 -3.17 FFASsuboptimal 101
102 DistillSN 23.28 20.69 41.92 -0.98 -0.88 0.00 28.16 23.47 41.92 -0.55 -0.85 -0.32 DistillSN 102
103 Elofsson 23.28 20.59 43.37 -0.98 -0.90 0.17 23.56 21.46 43.99 -1.36 -1.28 -0.06 Elofsson 103
104 fais−server 23.28 20.40 43.35 -0.98 -0.95 0.16 30.75 27.30 48.39 -0.09 -0.02 0.48 fais−server 104
105 GS−KudlatyPred 23.28 19.83 43.58 -0.98 -1.08 0.19 24.43 21.55 43.58 -1.20 -1.26 -0.11 GS−KudlatyPred 105
106 huber−torda−server 23.28 17.91 11.06 -0.98 -1.52 -3.50 28.16 23.75 30.40 -0.55 -0.79 -1.75 huber−torda−server 106
107 3Dpro 22.99 20.40 46.26 -1.04 -0.95 0.49 23.56 21.46 46.26 -1.36 -1.28 0.22 3Dpro 107
108 Frankenstein 22.70 20.69 43.60 -1.10 -0.88 0.19 27.87 25.10 43.60 -0.60 -0.50 -0.11 Frankenstein 108
109 FrankensteinLong 22.70 20.69 43.60 -1.10 -0.88 0.19 27.87 25.10 43.60 -0.60 -0.50 -0.11 FrankensteinLong 109
110 GS−MetaServer2 22.70 18.39 40.04 -1.10 -1.41 -0.21 27.01 23.18 40.04 -0.75 -0.91 -0.55 GS−MetaServer2 110
111 GeneSilicoMetaServer 22.70 18.39 40.04 -1.10 -1.41 -0.21 27.01 23.18 40.04 -0.75 -0.91 -0.55 GeneSilicoMetaServer 111
112 RANDOM 22.48 19.71 22.48 -1.15 -1.11 -2.20 22.48 19.71 22.48 -1.55 -1.66 -2.74 RANDOM 112
113 circle 22.41 21.07 34.98 -1.16 -0.79 -0.78 25.57 22.32 38.27 -1.00 -1.10 -0.77 circle 113
114 CpHModels 22.41 18.77 37.45 -1.16 -1.32 -0.50 22.41 18.77 37.45 -1.56 -1.86 -0.88 CpHModels 114
115 MULTICOM−CMFR 22.13 19.73 45.37 -1.22 -1.10 0.39 27.01 24.52 45.72 -0.75 -0.62 0.15 MULTICOM−CMFR 115
116 Pushchino 22.13 19.44 19.58 -1.22 -1.17 -2.53 22.13 19.44 19.58 -1.61 -1.72 -3.10 Pushchino 116
117 MULTICOM−CLUSTER 22.13 18.10 41.48 -1.22 -1.48 -0.05 29.89 27.01 41.48 -0.24 -0.08 -0.38 MULTICOM−CLUSTER 117
118 JIVE08 21.84 21.46 32.82 -1.28 -0.70 -1.03 37.64 33.24 51.14 1.13 1.26 0.83 JIVE08 118
119 MULTICOM−REFINE 21.84 20.21 45.60 -1.28 -0.99 0.42 29.89 27.20 46.09 -0.24 -0.04 0.20 MULTICOM−REFINE 119
120 ACOMPMOD 21.84 19.54 42.37 -1.28 -1.14 0.05 26.72 24.23 43.59 -0.80 -0.68 -0.11 ACOMPMOD 120
121 MUProt 21.84 18.97 45.88 -1.28 -1.28 0.45 29.89 27.39 46.09 -0.24 -0.00 0.20 MUProt 121
122 SAM−T02−server 21.55 19.83 21.01 -1.34 -1.08 -2.37 21.55 19.83 21.01 -1.71 -1.63 -2.92 SAM−T02−server 122
123 NIM2 21.55 19.06 17.62 -1.34 -1.26 -2.75 21.55 19.06 17.62 -1.71 -1.80 -3.34 NIM2 123
124 TJ_Jiang 21.26 18.30 40.73 -1.40 -1.43 -0.13 28.74 25.67 45.14 -0.44 -0.37 0.08 TJ_Jiang 124
125 Linnolt−UH−CMB 20.98 18.10 22.49 -1.46 -1.48 -2.20 20.98 18.10 22.49 -1.81 -2.01 -2.74 Linnolt−UH−CMB 125
126 MULTICOM−RANK 20.98 17.34 39.88 -1.46 -1.66 -0.23 22.99 19.83 42.76 -1.46 -1.63 -0.22 MULTICOM−RANK 126
127 TWPPLAB 20.40 14.85 13.98 -1.58 -2.23 -3.17 20.40 14.85 13.98 -1.92 -2.71 -3.80 TWPPLAB 127
128 StruPPi 20.11 17.43 17.30 -1.64 -1.63 -2.79 20.11 17.43 17.52 -1.97 -2.15 -3.36 StruPPi 128
129 mahmood−torda−server 19.25 15.23 34.29 -1.82 -2.15 -0.86 29.02 24.62 39.24 -0.39 -0.60 -0.65 mahmood−torda−server 129
130 Pcons_local 18.97 18.01 16.52 -1.87 -1.50 -2.88 18.97 18.01 16.52 -2.17 -2.03 -3.48 Pcons_local 130
131 LOOPP_Server 18.39 13.22 3.93 -1.99 -2.61 -4.30 29.02 25.77 40.48 -0.39 -0.35 -0.50 LOOPP_Server 131
132 panther_server 14.94 13.60 0.00 -2.71 -2.52 -4.75 16.67 16.09 0.00 -2.57 -2.44 -5.53 panther_server 132
133 OLGAFS 14.08 12.74 0.00 -2.89 -2.72 -4.75 20.11 18.01 11.25 -1.97 -2.03 -4.14 OLGAFS 133
134 rehtnap 10.35 9.96 0.00 -3.66 -3.37 -4.75 10.35 9.96 0.00 -3.69 -3.76 -5.53 rehtnap 134
135 AMU−Biology                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 AMU−Biology 135
136 Abagyan                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 Abagyan 136
137 BHAGEERATH                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 BHAGEERATH 137
138 CBSU                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 CBSU 138
139 FEIG_REFINE                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 FEIG_REFINE 139
140 Fiser−M4T                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 Fiser−M4T 140
141 HCA                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 HCA 141
142 LEE−SERVER                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 LEE−SERVER 142
143 Nano_team                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 Nano_team 143
144 NirBenTal                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 NirBenTal 144
145 PZ−UAM                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 PZ−UAM 145
146 ProtAnG                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 ProtAnG 146
147 ProteinShop                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 ProteinShop 147
148 SAMUDRALA                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 SAMUDRALA 148
149 ShakAbInitio                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 ShakAbInitio 149
150 TsaiLab                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 TsaiLab 150
151 UCDavisGenome                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 UCDavisGenome 151
152 Wolfson−FOBIA                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 Wolfson−FOBIA 152
153 YASARA                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 YASARA 153
154 YASARARefine                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 YASARARefine 154
155 Zhou−SPARKS                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 Zhou−SPARKS 155
156 dill_ucsf                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 dill_ucsf 156
157 dill_ucsf_extended                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 dill_ucsf_extended 157
158 jacobson                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 jacobson 158
159 mti                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 mti 159
160 psiphifoldings                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 psiphifoldings 160
161 ricardo                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 ricardo 161
162 rivilo                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 rivilo 162
163 schenk−torda−server                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 schenk−torda−server 163
164 sessions                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 sessions 164
165 test_http_server_01                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 test_http_server_01 165
166 tripos_08                   -1.15 -1.11 -2.20                   -1.55 -1.66 -2.74 tripos_08 166