T0416

tRNA delta(2)-isopentenylpyrophosphate transferase from Staphylococcus epidermidis

Target sequence:

>T0416 tRNA delta(2)-isopentenylpyrophosphate transferase, Staphylococcus epidermidis, 332 residues
MTEMTKPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEDESISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRSSNHDCKRKHPRPSTREL

Structure:

Method: X-ray, res=2.7Å, R/Rfree=0.23/0.27

Determined by: NESG

PDB ID: 3d3q

3d3q_A cartoon
Cartoon diagram of 416: 3d3q chain A residues

PyMOL of 3d3q

Domains: PyMOL of domains

Three domains. Residue ranges in PDB: 6-114,194-205,280-315; 115-193 and 206-279. Residue ranges in target: 6-114,194-205,280-315; 115-193 and 206-279.

416 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Larger domain: P-loop-containing nucleoside triphosphate hydrolase fold. Insertion domain is a LEM/SAP HeH motif.

CASP category:

Whole chain: Comparative modeling:hard.

1st domain (merge ranges in PDB: 6-114,194-205,280-315 and 206-279 for evaluation): Comparative modeling:easy. 2nd domain: Fold recognition.

Closest templates:

2qgn.

Target sequence - PDB file inconsistencies:

T0416 3d3q.pdb T0416.pdb PyMOL PyMOL of domains

T0416    1 MTEMTKPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEDESISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRSSNHDCKRKHPRPSTREL 332
           ~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~
3d3qA    6 -----KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFE---ISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS----------------- 315

Residue change log: change 41, 47, 59, 66, 128, 205, 221, 244, 262, 288, 298, 302, 303, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 6-114, 194-315 ; pdb 6-114, 194-315

2nd domain: target 115-119, 123-193 ; pdb 115-119, 123-193

T0416 3d3q.pdb T0416.pdb PyMOL PyMOL of domains

T0416    1 MTEMTKPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFEDESISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRSSNHDCKRKHPRPSTREL 332
           ~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~
3d3qA    6 -----KPFLIVIVGPTASGKTELSIEVAKKFNGEIISGDSMQVYQGMDIGTAKVTTEEMEGIPHYMIDILPPDASFSAYEFKKRAEKYIKDITRRGKVPIIAGGTGLYIQSLLYNYAFE---ISEDKMKQVKLKLKELEHLNNNKLHEYLASFDKESAKDIHPNNRKRVLRAIEYYLKTKKLLSSRKKVQQFTENYDTLLIGIEMSRETLYLRINKRVDIMLGHGLFNEVQHLVEQGFEASQSMQAIGYKELVPVIKGNISMENAVEKLKQHSRQYAKRQLTWFKNKMNVHWLNKERMSLQMMLDEITTQINKRS----------------- 315

Residue change log: change 41, 47, 59, 66, 128, 205, 221, 244, 262, 288, 298, 302, 303, MSE to MET;

2-domain protein, both domains used in evaluation:

1st domain: target 6-114, 194-315 ; pdb 6-114, 194-315

2nd domain: target 115-119, 123-193 ; pdb 115-119, 123-193

Sequence classification:

IPP transferase family (IPPT) in Pfam.

Server predictions:

T0416:pdb 6-315:seq 6-315:CM_hard; alignment

distribution of
first scores
First models for T0416: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

416_1:pdb 6-114,194-315:seq 6-114,194-315:CM_easy; alignment

distribution of
first scores
First models for T0416_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

416_2:pdb 115-193:seq 115-193:FR; alignment

distribution of
first scores
First models for T0416_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

#	GROUP ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	↓ GROUP	#
		T0416			416_1			416_2			T0416			416_1			416_2			T0416			416_1			416_2			T0416			416_1			416_2
		First score									First Z-score									Best score									Best Z-score
1	keasar−server	66.61	57.27	66.14	87.01	85.14	88.09	19.41	16.89	-4.42	0.85	0.37	1.16	0.81	0.94	1.02	-0.11	-0.06	-0.10	67.83	65.74	67.07	87.12	85.53	88.36	22.70	18.64	-0.91	0.95	1.05	0.88	0.78	0.98	0.93	-0.53	-0.72	-0.79	keasar−server	1
2	Zhang−Server	66.53	62.13	70.06	85.71	81.53	85.43	25.33	17.43	21.68	0.85	0.77	1.51	0.72	0.72	0.84	0.64	0.02	0.87	67.83	65.28	79.04	87.99	85.17	87.71	55.92	41.89	62.52	0.95	0.99	2.06	0.89	0.94	0.86	2.93	2.24	1.86	Zhang−Server	2
3	HHpred2	66.37	65.28	63.05	87.12	85.46	88.21	14.14	12.72	-20.21	0.83	1.02	0.88	0.82	0.96	1.03	-0.77	-0.65	-0.68	66.37	65.28	63.05	87.12	85.46	88.21	14.14	12.72	-20.21	0.75	0.99	0.48	0.78	0.97	0.91	-1.43	-1.48	-1.60	HHpred2	3
4	SAM−T06−server	66.12	64.77	74.82	86.91	85.25	86.95	31.25	26.64	38.52	0.81	0.98	1.94	0.81	0.95	0.94	1.39	1.33	1.50	66.12	64.77	74.82	86.91	85.25	86.95	31.25	26.64	38.52	0.71	0.92	1.64	0.76	0.95	0.79	0.36	0.30	0.86	SAM−T06−server	4
5	FAMSD	65.96	64.66	67.12	86.04	85.17	86.72	21.38	17.00	4.35	0.80	0.97	1.24	0.75	0.95	0.93	0.14	-0.04	0.23	65.96	64.66	67.12	86.04	85.17	86.72	31.58	30.81	36.07	0.69	0.91	0.89	0.65	0.94	0.77	0.39	0.83	0.76	FAMSD	5
6	LEE−SERVER	65.96	64.60	65.18	87.01	85.35	87.07	17.43	13.49	-5.21	0.80	0.97	1.07	0.81	0.96	0.95	-0.36	-0.54	-0.12	66.20	64.69	65.95	87.01	85.35	87.07	20.39	18.86	-1.41	0.72	0.91	0.77	0.77	0.96	0.80	-0.78	-0.69	-0.81	LEE−SERVER	6
7	BAKER−ROBETTA	65.96	64.55	77.12	86.47	85.53	87.96	34.54	32.02	45.65	0.80	0.97	2.15	0.78	0.97	1.01	1.80	2.10	1.76	67.02	65.55	80.51	86.80	85.53	88.43	56.58	41.67	59.63	0.84	1.03	2.21	0.74	0.98	0.94	3.00	2.21	1.74	BAKER−ROBETTA	7
8	forecast	65.96	64.17	63.57	86.91	85.39	88.43	16.78	13.93	-18.09	0.80	0.93	0.92	0.81	0.96	1.04	-0.44	-0.48	-0.60	66.53	65.12	64.63	87.34	85.68	88.45	17.11	15.24	-13.23	0.77	0.97	0.64	0.81	1.00	0.94	-1.12	-1.15	-1.31	forecast	8
9	circle	65.80	64.77	67.67	86.36	85.14	86.18	22.37	18.86	8.78	0.78	0.98	1.29	0.77	0.94	0.89	0.27	0.22	0.39	65.96	64.77	67.67	86.36	85.17	86.72	22.37	19.74	8.78	0.69	0.92	0.94	0.69	0.94	0.77	-0.57	-0.58	-0.39	circle	9
10	Pushchino	65.72	64.47	57.17	86.58	85.28	87.71	8.55	8.11	-45.84	0.78	0.96	0.35	0.78	0.95	0.99	-1.48	-1.31	-1.63	65.72	64.47	57.17	86.58	85.28	87.71	8.55	8.11	-45.84	0.65	0.88	-0.09	0.72	0.95	0.86	-2.01	-2.06	-2.67	Pushchino	10
11	3D−JIGSAW_V3	65.72	64.36	57.29	86.80	85.50	88.00	6.58	6.36	-46.43	0.78	0.95	0.36	0.80	0.97	1.01	-1.73	-1.56	-1.65	65.72	64.47	57.29	86.80	85.50	88.00	6.58	6.36	-46.43	0.65	0.88	-0.08	0.74	0.98	0.89	-2.21	-2.29	-2.69	3D−JIGSAW_V3	11
12	3D−JIGSAW_AEP	65.72	64.09	57.44	86.91	85.17	88.18	6.58	6.36	-46.41	0.78	0.93	0.37	0.81	0.95	1.03	-1.73	-1.56	-1.65	65.80	64.17	57.48	86.91	85.17	88.23	6.58	6.36	-46.41	0.67	0.84	-0.06	0.76	0.94	0.92	-2.21	-2.29	-2.69	3D−JIGSAW_AEP	12
13	COMA−M	65.64	63.19	59.08	85.93	83.69	83.30	13.49	11.84	-20.70	0.77	0.85	0.52	0.74	0.85	0.69	-0.86	-0.78	-0.70	65.64	63.19	59.08	85.93	83.69	83.30	13.82	11.84	-20.70	0.64	0.72	0.09	0.64	0.79	0.43	-1.46	-1.59	-1.62	COMA−M	13
14	nFOLD3	65.47	63.95	57.25	86.58	85.35	87.93	7.57	6.25	-46.26	0.76	0.92	0.35	0.78	0.96	1.01	-1.60	-1.58	-1.65	65.47	63.95	57.25	86.58	85.35	87.93	31.58	27.63	13.81	0.62	0.82	-0.09	0.72	0.96	0.89	0.39	0.42	-0.18	nFOLD3	14
15	SAM−T02−server	65.39	64.25	56.54	86.04	84.60	86.95	8.55	8.11	-45.84	0.75	0.94	0.29	0.75	0.91	0.94	-1.48	-1.31	-1.63	65.39	64.25	56.54	86.04	84.60	86.95	18.42	17.76	-24.87	0.61	0.86	-0.16	0.65	0.88	0.79	-0.98	-0.83	-1.79	SAM−T02−server	15
16	GS−KudlatyPred	65.06	61.10	56.65	86.04	84.23	87.83	5.92	5.92	-46.46	0.72	0.68	0.30	0.75	0.89	1.00	-1.81	-1.62	-1.65	65.06	61.10	56.65	86.04	84.23	87.83	5.92	5.92	-46.46	0.56	0.44	-0.15	0.65	0.84	0.88	-2.28	-2.34	-2.70	GS−KudlatyPred	16
17	OLGAFS	64.90	60.67	56.25	85.93	78.21	86.85	6.91	6.47	-46.79	0.71	0.65	0.26	0.74	0.51	0.93	-1.69	-1.55	-1.67	64.90	60.67	56.25	85.93	78.21	86.85	8.88	6.47	-43.73	0.54	0.39	-0.19	0.64	0.21	0.78	-1.98	-2.27	-2.58	OLGAFS	17
18	HHpred5	64.90	58.77	60.65	85.50	79.80	85.47	13.16	12.28	-20.73	0.71	0.49	0.66	0.71	0.61	0.84	-0.90	-0.72	-0.70	64.90	58.77	60.65	85.50	79.80	85.47	13.16	12.28	-20.73	0.54	0.14	0.25	0.58	0.38	0.64	-1.53	-1.53	-1.62	HHpred5	18
19	YASARA	64.82	56.76	74.50	85.50	74.71	88.87	26.64	26.21	31.41	0.70	0.33	1.91	0.71	0.29	1.07	0.81	1.27	1.23	64.82	57.06	74.50	85.50	75.40	88.87	28.29	27.63	31.41	0.53	-0.09	1.61	0.58	-0.09	0.98	0.05	0.42	0.56	YASARA	19
20	MUFOLD−Server	64.66	61.40	60.03	84.63	83.12	85.23	14.80	11.29	-22.62	0.69	0.71	0.61	0.65	0.82	0.82	-0.69	-0.86	-0.77	64.66	61.40	60.03	84.63	83.12	85.23	14.80	11.29	-22.62	0.50	0.48	0.19	0.48	0.73	0.62	-1.36	-1.66	-1.70	MUFOLD−Server	20
21	HHpred4	64.58	60.61	60.41	85.50	79.15	86.09	12.83	12.39	-24.04	0.68	0.64	0.64	0.71	0.57	0.88	-0.94	-0.70	-0.82	64.58	60.61	60.41	85.50	79.15	86.09	12.83	12.39	-24.04	0.49	0.38	0.22	0.58	0.31	0.70	-1.56	-1.52	-1.76	HHpred4	21
22	panther_server	63.52	60.53	53.33	83.55	79.29	83.03	10.53	10.31	-45.58	0.59	0.64	0.00	0.58	0.58	0.67	-1.23	-1.00	-1.62	63.52	60.53	53.33	83.55	79.29	83.03	21.05	18.42	8.73	0.34	0.37	-0.47	0.34	0.32	0.40	-0.71	-0.75	-0.39	panther_server	22
23	METATASSER	63.52	57.93	66.86	82.79	79.91	75.77	33.88	31.03	45.61	0.59	0.43	1.22	0.53	0.62	0.17	1.72	1.96	1.76	64.74	61.43	71.80	84.74	80.77	82.66	41.45	37.50	45.61	0.51	0.48	1.35	0.49	0.48	0.36	1.42	1.68	1.15	METATASSER	23
24	SAM−T08−server	62.30	60.23	73.37	82.03	79.65	84.94	31.25	29.28	40.15	0.48	0.61	1.81	0.47	0.60	0.80	1.39	1.71	1.56	65.96	64.44	76.18	86.69	85.46	88.11	31.25	29.28	40.72	0.69	0.88	1.78	0.73	0.97	0.90	0.36	0.63	0.95	SAM−T08−server	24
25	Phyre_de_novo	61.89	55.65	66.23	80.30	72.51	76.97	27.30	25.44	36.44	0.45	0.24	1.16	0.36	0.16	0.25	0.89	1.16	1.42	61.89	56.11	66.23	81.71	74.57	78.74	27.30	26.64	36.44	0.11	-0.21	0.80	0.12	-0.17	-0.02	-0.05	0.30	0.77	Phyre_de_novo	25
26	PS2−server	61.56	56.35	48.81	81.82	74.89	79.26	0.00	0.00	-47.75	0.42	0.30	-0.41	0.46	0.31	0.41	-2.56	-2.47	-1.70	61.56	56.35	48.81	81.82	74.89	79.26	33.22	31.47	39.09	0.06	-0.18	-0.92	0.13	-0.14	0.03	0.56	0.91	0.88	PS2−server	26
27	Poing	61.08	59.50	46.93	80.95	76.12	76.45	3.95	3.95	-47.30	0.38	0.55	-0.58	0.40	0.38	0.22	-2.06	-1.91	-1.68	61.08	59.50	61.46	80.95	76.12	77.33	29.28	28.84	35.96	-0.00	0.23	0.33	0.03	-0.01	-0.16	0.15	0.58	0.75	Poing	27
28	Phyre2	61.08	59.50	46.93	80.95	76.12	76.45	3.95	3.95	-47.30	0.38	0.55	-0.58	0.40	0.38	0.22	-2.06	-1.91	-1.68	61.08	59.50	63.83	80.95	76.12	77.48	34.87	33.99	38.39	-0.00	0.23	0.56	0.03	-0.01	-0.15	0.73	1.23	0.85	Phyre2	28
29	Phragment	61.08	59.50	46.93	80.95	76.12	76.45	3.95	3.95	-47.30	0.38	0.55	-0.58	0.40	0.38	0.22	-2.06	-1.91	-1.68	61.08	59.50	60.02	80.95	76.12	77.80	28.29	27.19	38.63	-0.00	0.23	0.19	0.03	-0.01	-0.12	0.05	0.37	0.86	Phragment	29
30	3DShot2	60.99	57.47	55.07	80.41	76.01	78.52	16.45	14.36	-18.81	0.37	0.39	0.16	0.36	0.38	0.36	-0.48	-0.42	-0.63	60.99	57.47	55.07	80.41	76.01	78.52	16.45	14.36	-18.81	-0.02	-0.04	-0.30	-0.04	-0.02	-0.05	-1.19	-1.27	-1.54	3DShot2	30
31	RAPTOR	60.51	57.36	48.65	80.09	75.18	75.80	8.88	8.22	-37.39	0.33	0.38	-0.42	0.34	0.32	0.17	-1.44	-1.30	-1.32	60.51	57.36	48.65	80.09	75.18	75.80	18.42	17.11	-5.15	-0.08	-0.05	-0.93	-0.08	-0.11	-0.31	-0.98	-0.92	-0.97	RAPTOR	31
32	rehtnap	60.34	53.23	55.97	79.11	69.23	76.97	18.42	12.83	-9.65	0.31	0.04	0.24	0.28	-0.05	0.25	-0.23	-0.64	-0.29	60.34	53.23	60.24	79.11	69.23	76.97	29.61	25.88	18.66	-0.11	-0.59	0.21	-0.20	-0.74	-0.20	0.19	0.20	0.03	rehtnap	32
33	COMA	60.10	55.86	48.96	78.90	75.58	72.08	11.84	11.84	-22.81	0.29	0.26	-0.39	0.26	0.35	-0.08	-1.06	-0.78	-0.78	65.72	64.41	61.02	86.47	84.81	85.74	13.16	11.84	-20.70	0.65	0.88	0.28	0.70	0.90	0.67	-1.53	-1.59	-1.62	COMA	33
34	MUSTER	60.02	55.95	53.28	79.55	74.13	73.18	18.09	12.83	-5.92	0.29	0.26	-0.00	0.31	0.26	-0.01	-0.27	-0.64	-0.15	60.26	55.95	59.77	79.55	74.13	81.77	31.58	28.29	39.00	-0.12	-0.24	0.16	-0.15	-0.22	0.28	0.39	0.51	0.88	MUSTER	34
35	GS−MetaServer2	59.69	56.38	56.70	79.11	74.35	81.90	18.09	15.35	-22.84	0.26	0.30	0.31	0.28	0.27	0.59	-0.27	-0.28	-0.78	59.69	56.38	56.70	79.11	74.35	81.90	26.64	24.78	22.12	-0.20	-0.18	-0.14	-0.20	-0.20	0.29	-0.12	0.06	0.17	GS−MetaServer2	35
36	GeneSilicoMetaServer	59.28	53.39	58.08	78.57	71.14	82.41	18.42	15.57	-21.28	0.22	0.06	0.43	0.24	0.07	0.63	-0.23	-0.25	-0.72	64.74	62.73	58.68	85.71	83.41	86.77	18.42	15.57	-21.28	0.51	0.66	0.05	0.61	0.76	0.77	-0.98	-1.11	-1.64	GeneSilicoMetaServer	36
37	BioSerf	58.96	51.09	60.93	77.71	68.04	77.14	27.96	18.86	14.86	0.19	-0.13	0.69	0.18	-0.12	0.27	0.97	0.22	0.62	58.96	51.09	60.93	77.71	68.04	77.14	27.96	18.86	14.86	-0.30	-0.87	0.28	-0.37	-0.86	-0.18	0.01	-0.69	-0.13	BioSerf	37
38	pro−sp3−TASSER	58.71	56.05	60.19	77.81	74.64	73.40	26.32	24.01	24.92	0.17	0.27	0.62	0.19	0.29	0.01	0.77	0.96	0.99	60.26	57.06	63.18	79.55	75.00	75.34	31.91	28.62	34.74	-0.12	-0.09	0.50	-0.15	-0.13	-0.36	0.43	0.55	0.70	pro−sp3−TASSER	38
39	Pcons_local	58.31	51.55	40.29	77.06	68.07	65.43	8.88	8.44	-37.13	0.14	-0.09	-1.17	0.14	-0.12	-0.54	-1.44	-1.27	-1.31	58.31	51.55	40.29	77.06	68.07	65.43	8.88	8.44	-36.90	-0.40	-0.81	-1.76	-0.45	-0.86	-1.34	-1.98	-2.02	-2.30	Pcons_local	39
40	Pcons_dot_net	58.31	51.55	40.29	77.06	68.07	65.43	8.88	8.44	-37.13	0.14	-0.09	-1.17	0.14	-0.12	-0.54	-1.44	-1.27	-1.31	66.37	64.96	78.28	86.69	85.53	88.11	41.12	38.49	49.58	0.75	0.95	1.99	0.73	0.98	0.90	1.39	1.81	1.32	Pcons_dot_net	40
41	CpHModels	57.09	52.71	45.44	74.67	64.50	67.10	19.08	16.45	-21.35	0.03	0.00	-0.71	-0.03	-0.34	-0.43	-0.15	-0.12	-0.72	57.09	52.71	45.44	74.67	64.50	67.10	19.08	16.45	-21.35	-0.57	-0.66	-1.25	-0.74	-1.24	-1.18	-0.91	-1.00	-1.65	CpHModels	41
42	FFASsuboptimal	54.23	52.39	50.61	71.21	69.12	65.18	20.39	17.43	9.55	-0.21	-0.03	-0.24	-0.26	-0.05	-0.56	0.02	0.02	0.42	54.23	52.39	50.61	71.21	69.12	65.18	20.39	17.43	9.55	-0.97	-0.70	-0.74	-1.17	-0.75	-1.37	-0.78	-0.88	-0.35	FFASsuboptimal	42
43	FFASstandard	54.23	52.28	51.47	71.75	68.94	65.78	20.72	18.09	11.94	-0.21	-0.03	-0.17	-0.23	-0.07	-0.52	0.06	0.11	0.51	54.23	52.28	51.47	71.75	68.94	65.78	20.72	18.09	11.94	-0.97	-0.72	-0.66	-1.10	-0.77	-1.31	-0.74	-0.79	-0.25	FFASstandard	43
44	FFASflextemplate	53.66	51.49	42.69	70.24	67.35	59.83	18.75	18.09	-6.88	-0.26	-0.10	-0.96	-0.33	-0.16	-0.93	-0.19	0.11	-0.19	53.99	51.49	43.40	70.24	68.18	60.80	21.05	18.09	-3.22	-1.01	-0.82	-1.45	-1.28	-0.85	-1.80	-0.71	-0.79	-0.89	FFASflextemplate	44
45	Fiser−M4T	52.77	49.35	28.62	70.02	63.67	53.66	5.59	4.93	-46.29	-0.34	-0.27	-2.23	-0.34	-0.39	-1.35	-1.85	-1.77	-1.65	52.77	49.35	28.62	70.02	63.67	53.66	5.59	4.93	-46.29	-1.18	-1.10	-2.91	-1.31	-1.32	-2.51	-2.32	-2.47	-2.69	Fiser−M4T	45
46	MULTICOM−CLUSTER	51.95	47.12	50.82	68.94	62.52	61.66	28.95	24.01	25.14	-0.41	-0.46	-0.23	-0.42	-0.47	-0.80	1.10	0.96	1.00	62.62	56.54	56.90	81.71	74.13	80.25	28.95	24.01	25.14	0.21	-0.16	-0.12	0.12	-0.22	0.13	0.12	-0.04	0.30	MULTICOM−CLUSTER	46
47	MUProt	50.90	45.58	46.04	67.53	60.82	60.18	21.38	16.34	9.51	-0.50	-0.58	-0.66	-0.51	-0.57	-0.90	0.14	-0.14	0.42	59.85	52.42	59.12	79.00	69.12	77.93	25.99	18.09	16.91	-0.18	-0.70	0.10	-0.21	-0.75	-0.10	-0.19	-0.79	-0.05	MUProt	47
48	MULTICOM−REFINE	50.65	46.69	45.93	67.21	59.42	60.11	21.38	16.56	9.28	-0.52	-0.49	-0.67	-0.53	-0.66	-0.91	0.14	-0.11	0.41	59.69	51.82	59.18	78.68	68.65	77.99	30.92	28.18	39.32	-0.20	-0.78	0.10	-0.25	-0.80	-0.10	0.32	0.49	0.89	MULTICOM−REFINE	48
49	MULTICOM−CMFR	50.65	44.44	45.87	67.21	60.28	59.91	21.05	16.01	9.75	-0.52	-0.67	-0.67	-0.53	-0.60	-0.92	0.10	-0.19	0.43	53.66	50.38	51.37	71.10	66.41	67.09	26.32	18.42	17.74	-1.06	-0.97	-0.67	-1.18	-1.03	-1.18	-0.16	-0.75	-0.01	MULTICOM−CMFR	49
50	FALCON	49.67	43.43	38.74	65.69	57.40	55.87	18.09	13.82	-8.38	-0.61	-0.76	-1.31	-0.64	-0.78	-1.20	-0.27	-0.50	-0.24	60.18	56.65	43.00	79.55	74.93	71.16	29.28	26.75	14.45	-0.13	-0.14	-1.49	-0.15	-0.14	-0.77	0.15	0.31	-0.15	FALCON	50
51	3Dpro	49.43	42.53	40.60	65.26	59.92	56.67	20.07	17.43	-2.76	-0.63	-0.83	-1.15	-0.67	-0.63	-1.14	-0.02	0.02	-0.03	61.73	53.91	53.59	81.39	71.14	77.42	25.99	22.92	18.07	0.09	-0.50	-0.45	0.08	-0.54	-0.15	-0.19	-0.18	0.00	3Dpro	51
52	MULTICOM−RANK	49.10	42.97	42.99	65.15	57.00	56.64	21.38	17.32	8.62	-0.66	-0.79	-0.93	-0.67	-0.81	-1.15	0.14	0.00	0.39	62.62	56.54	56.90	81.71	74.13	80.25	31.58	26.54	39.69	0.21	-0.16	-0.12	0.12	-0.22	0.13	0.39	0.28	0.91	MULTICOM−RANK	52
53	FUGUE_KM	47.80	45.03	26.62	62.99	59.31	46.49	14.47	12.06	-28.53	-0.77	-0.63	-2.41	-0.82	-0.67	-1.85	-0.73	-0.75	-0.99	47.80	45.03	26.62	62.99	59.31	46.49	24.67	23.14	8.05	-1.89	-1.67	-3.10	-2.17	-1.78	-3.22	-0.33	-0.15	-0.42	FUGUE_KM	53
54	Pcons_multi	44.62	35.75	48.73	58.98	46.72	65.31	22.04	19.08	1.90	-1.04	-1.38	-0.41	-1.09	-1.45	-0.55	0.22	0.25	0.14	58.31	51.55	50.30	77.06	68.07	67.11	23.03	19.08	5.52	-0.40	-0.81	-0.77	-0.45	-0.86	-1.18	-0.50	-0.67	-0.52	Pcons_multi	54
55	fais−server	43.24	32.74	51.53	57.47	42.97	67.79	22.37	12.83	5.96	-1.16	-1.63	-0.16	-1.20	-1.68	-0.38	0.27	-0.64	0.29	66.86	65.66	62.41	87.34	85.97	87.85	39.80	30.81	51.75	0.82	1.04	0.42	0.81	1.03	0.88	1.25	0.83	1.41	fais−server	55
56	mGenTHREADER	32.57	30.57	63.84	62.34	53.97	77.48	32.24	29.17	26.70	-2.08	-1.80	0.95	-0.87	-1.00	0.29	1.51	1.69	1.06	32.57	30.57	63.84	62.34	53.97	77.48	32.24	29.17	26.70	-4.04	-3.57	0.56	-2.25	-2.35	-0.15	0.46	0.62	0.36	mGenTHREADER	56
57	Distill	28.34	25.81	40.97	36.69	33.66	46.87	31.91	27.96	36.01	-2.45	-2.19	-1.11	-2.61	-2.26	-1.82	1.47	1.52	1.40	29.15	25.81	40.97	37.88	33.66	47.60	33.22	30.81	36.01	-4.53	-4.20	-1.69	-5.25	-4.49	-3.11	0.56	0.83	0.75	Distill	57
58	FEIG	23.37	20.28	36.82	31.17	27.06	40.12	32.57	30.59	41.17	-2.88	-2.64	-1.49	-2.99	-2.68	-2.28	1.56	1.90	1.59	65.88	64.47	76.98	86.15	84.78	86.15	53.29	42.76	52.37	0.68	0.88	1.86	0.66	0.90	0.71	2.65	2.35	1.44	FEIG	58
59	PSI	20.20	13.90	-3.29	26.84	18.47	11.87	14.14	10.86	-35.97	-3.15	-3.16	-5.10	-3.28	-3.21	-4.23	-0.77	-0.92	-1.26	60.18	56.65	45.03	79.55	74.93	71.16	29.28	26.75	14.45	-0.13	-0.14	-1.29	-0.15	-0.14	-0.77	0.15	0.31	-0.15	PSI	59
60	ACOMPMOD	18.57	14.93	11.81	24.46	19.70	17.51	23.36	18.53	12.66	-3.29	-3.08	-3.74	-3.44	-3.13	-3.84	0.39	0.17	0.54	18.57	14.93	12.28	24.46	19.70	19.01	30.26	27.74	28.96	-6.03	-5.62	-4.52	-6.89	-5.96	-5.94	0.25	0.44	0.46	ACOMPMOD	60
61	FOLDpro	16.12	13.46	18.64	21.43	17.89	27.07	23.36	21.38	7.83	-3.50	-3.20	-3.13	-3.65	-3.25	-3.18	0.39	0.58	0.36	20.11	17.67	23.78	26.62	23.38	30.42	28.29	25.22	21.25	-5.81	-5.26	-3.38	-6.62	-5.57	-4.81	0.05	0.12	0.14	FOLDpro	61
62	MUFOLD−MD	13.19	12.62	37.53	15.80	15.04	35.39	44.74	35.75	62.48	-3.75	-3.27	-1.42	-4.03	-3.43	-2.61	3.09	2.63	2.38	15.88	13.36	37.53	21.10	17.57	35.39	57.24	50.22	63.50	-6.41	-5.83	-2.03	-7.30	-6.18	-4.32	3.07	3.30	1.90	MUFOLD−MD	62
63	RBO−Proteus	12.62	10.18	31.08	16.23	14.94	31.88	42.10	33.11	46.00	-3.80	-3.47	-2.01	-4.00	-3.43	-2.85	2.76	2.25	1.77	14.25	11.59	31.45	16.23	14.94	32.22	42.10	33.11	47.48	-6.64	-6.06	-2.63	-7.90	-6.46	-4.63	1.49	1.12	1.23	RBO−Proteus	63
64	FALCON_CONSENSUS	12.46	11.48	7.70	16.45	15.30	12.16	28.95	26.75	14.45	-3.82	-3.36	-4.11	-3.99	-3.41	-4.21	1.10	1.35	0.60	60.18	56.65	43.00	79.55	74.93	71.16	29.28	26.75	14.45	-0.13	-0.14	-1.49	-0.15	-0.14	-0.77	0.15	0.31	-0.15	FALCON_CONSENSUS	64
65	LOOPP_Server	11.24	10.64	-9.95	14.72	13.82	-8.93	25.66	23.90	12.44	-3.92	-3.43	-5.71	-4.11	-3.50	-5.66	0.68	0.94	0.53	15.72	13.00	15.17	20.78	16.23	21.07	33.22	32.13	37.23	-6.43	-5.88	-4.23	-7.34	-6.32	-5.73	0.56	1.00	0.80	LOOPP_Server	65
66	mariner1	9.85	7.63	4.20	12.77	9.81	7.25	25.00	21.60	16.72	-4.04	-3.67	-4.43	-4.24	-3.75	-4.55	0.60	0.61	0.69	22.31	19.05	17.12	29.76	25.43	22.35	31.58	25.99	26.63	-5.50	-5.08	-4.04	-6.24	-5.35	-5.61	0.39	0.21	0.36	mariner1	66
67	RANDOM	9.52	8.30	9.52	12.39	10.83	12.39	26.96	22.46	26.96	-4.07	-3.62	-3.95	-4.26	-3.69	-4.19	0.85	0.74	1.07	9.52	8.30	9.52	12.39	10.83	12.39	26.96	22.46	26.96	-7.31	-6.50	-4.79	-8.37	-6.89	-6.59	-0.09	-0.24	0.37	RANDOM	67
68	schenk−torda−server	7.57	6.76	-4.64	10.28	8.98	-0.31	19.08	16.56	2.63	-4.24	-3.74	-5.23	-4.41	-3.80	-5.07	-0.15	-0.11	0.17	7.66	6.76	4.64	10.28	8.98	5.54	24.34	21.49	24.72	-7.58	-6.70	-5.27	-8.62	-7.09	-7.27	-0.36	-0.36	0.28	schenk−torda−server	68
69	BHAGEERATH										-4.07	-3.62	-3.95	-4.26	-3.69	-4.19	0.85	0.74	1.07										-7.31	-6.50	-4.79	-8.37	-6.89	-6.59	-0.09	-0.24	0.37	BHAGEERATH	69
70	Frankenstein										-4.07	-3.62	-3.95	-4.26	-3.69	-4.19	0.85	0.74	1.07										-7.31	-6.50	-4.79	-8.37	-6.89	-6.59	-0.09	-0.24	0.37	Frankenstein	70
71	huber−torda−server										-4.07	-3.62	-3.95	-4.26	-3.69	-4.19	0.85	0.74	1.07										-7.31	-6.50	-4.79	-8.37	-6.89	-6.59	-0.09	-0.24	0.37	huber−torda−server	71
72	mahmood−torda−server										-4.07	-3.62	-3.95	-4.26	-3.69	-4.19	0.85	0.74	1.07										-7.31	-6.50	-4.79	-8.37	-6.89	-6.59	-0.09	-0.24	0.37	mahmood−torda−server	72
73	pipe_int										-4.07	-3.62	-3.95	-4.26	-3.69	-4.19	0.85	0.74	1.07										-7.31	-6.50	-4.79	-8.37	-6.89	-6.59	-0.09	-0.24	0.37	pipe_int	73
74	test_http_server_01										-4.07	-3.62	-3.95	-4.26	-3.69	-4.19	0.85	0.74	1.07										-7.31	-6.50	-4.79	-8.37	-6.89	-6.59	-0.09	-0.24	0.37	test_http_server_01	74

Server only Targets
388	390	392	394
398	400	402	404
406	408	410	412
414	416	418	420
422	424	426	428
430	432	433	435
436	438	439	441
442	444	445	447
448	450	452	453
455	456	458	459
461	463	470	472
475	477	478	479
481	483	485	486
488	490	491	494
497	501	502	503
504	505	506	507
508	509	510	511
512	513	514