T0428

Server only Targets
388 390 392 394
398 400 402 404
406 408 410 412
414 416 418 420
422 424 426 428
430 432 433 435
436 438 439 441
442 444 445 447
448 450 452 453
455 456 458 459
461 463 470 472
475 477 478 479
481 483 485 486
488 490 491 494
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514  

T0428

phosphoglycerate mutase from Cryptosporidium parvum

Target type: Server only

Target sequence:

>T0428 Cp_pf11_0208, Cryptosporidium parvum, 267 residues
MGSSHHHHHHSSGLVPRGSTYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLKELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTACPLVLELDDYLKVTKKYYLISEEELKAKMEAVANQGKAK

Structure:
Method: X-ray, res=2.01Å, R/Rfree=0.23/0.26
Determined by: SGC
PDB ID: 3d8h

3d8h_A cartoon
Cartoon diagram of 428: 3d8h chain A

PyMOL of 3d8h

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 20-107,172-248 and 108-171. Residue ranges in target: 20-107,172-248 and 108-171.

428 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Phosphoglycerate mutase fold.

CASP category:

Whole chain: Comparative modeling:easy.

1st domain: Comparative modeling:easy. 2nd domain: Comparative modeling:easy. As the target is very similar to the template, domain evlaluation is not necessary.

Closest templates:

1xq9, 1e58, 1rii, 1qhf, 1yfk, 1h2e.

Target sequence - PDB file inconsistencies:

T0428    3d8h.pdb    T0428.pdb    PyMOL    PyMOL of domains    

T0428    1 MGSSHHHHHHSSGLVPRGSTYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLKELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTACPLVLELDDYLKVTKKYYLISEEELKAKMEAVANQGKAK 267
           ~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~
3d8hA   20 -------------------TYKLTLIRHGESEWNKENRFTGWTDVSLSEQGVSEAIEAGRMLLEKGFKFDVVYTSVLKRAIMTTWTVLKELGNINCPIINHWRLNERHYGALQGLNKSETASKFGEDQVKIWRRSFDVPPPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVSAHGNSLRALLYLLEGMTPEQILEVNIPTACPLVLELDDYLKVTKKYYLI------------------- 248

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 20-107, 172-248 ; pdb 20-107, 172-248

2nd domain: target 108-171 ; pdb 108-171

Sequence classification:

Phosphoglycerate mutase family (PGAM) in Pfam.

Comments:

This protein is a close homolog of T0394.

Server predictions:

T0428:pdb 20-248:seq 20-248:CM_easy;   alignment

distribution of first scores
First models for T0428: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

428_1:pdb 20-107,172-248:seq 20-107,172-248:CM_easy;   alignment

distribution of first scores
First models for T0428_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

428_2:pdb 108-171:seq 108-171:CM_easy;   alignment

distribution of first scores
First models for T0428_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0428 428_1 428_2 T0428 428_1 428_2 T0428 428_1 428_2 T0428 428_1 428_2
First score First Z-score Best score Best Z-score
1 3Dpro 97.38 96.07 94.86 97.58 95.96 95.43 96.88 96.35 93.66 1.68 1.56 0.86 0.70 0.69 0.52 1.77 1.64 1.10 97.38 96.07 94.88 97.58 95.96 95.44 96.88 96.35 93.66 1.70 1.45 0.53 0.24 0.21 0.02 1.90 1.85 0.92 3Dpro 1
2 Pushchino 96.72 95.56 94.92 97.73 96.31 95.48 96.48 95.96 93.62 1.42 1.43 0.89 0.79 0.86 0.55 1.68 1.58 1.09 96.72 95.56 94.92 97.73 96.31 95.48 96.48 95.96 93.62 1.31 1.27 0.56 0.36 0.44 0.06 1.75 1.74 0.91 Pushchino 2
3 HHpred5 95.96 94.50 95.76 98.64 97.02 96.99 91.41 89.58 92.40 1.12 1.18 1.25 1.31 1.20 1.35 0.51 0.56 0.82 95.96 94.50 95.76 98.64 97.02 96.99 91.41 89.58 92.40 0.87 0.90 1.11 1.07 0.89 1.46 -0.04 0.04 0.49 HHpred5 3
4 FEIG 95.85 94.54 95.89 98.48 97.27 96.98 91.41 90.36 92.86 1.08 1.19 1.30 1.22 1.33 1.35 0.51 0.68 0.92 95.85 94.54 95.89 98.48 97.27 96.98 91.41 90.36 92.86 0.81 0.91 1.20 0.95 1.04 1.45 -0.04 0.25 0.65 FEIG 4
5 RAPTOR 95.74 94.29 95.63 98.64 97.42 96.99 90.62 88.80 91.82 1.04 1.13 1.19 1.31 1.40 1.35 0.33 0.43 0.69 95.74 94.29 95.72 98.64 97.42 96.99 93.75 91.67 92.85 0.74 0.83 1.08 1.07 1.14 1.46 0.79 0.60 0.64 RAPTOR 5
6 FFASstandard 95.74 94.00 95.10 97.88 96.26 96.00 93.36 92.32 92.74 1.04 1.06 0.97 0.87 0.83 0.83 0.96 1.00 0.89 95.74 94.00 95.10 98.03 96.62 96.00 93.36 92.32 92.74 0.74 0.72 0.68 0.60 0.63 0.54 0.65 0.77 0.60 FFASstandard 6
7 BioSerf 95.74 93.27 94.30 97.73 95.81 95.12 93.36 90.75 92.16 1.04 0.88 0.63 0.79 0.62 0.36 0.96 0.75 0.76 95.74 93.27 94.30 97.73 95.81 95.12 93.36 90.75 92.16 0.74 0.46 0.15 0.36 0.12 -0.27 0.65 0.35 0.40 BioSerf 7
8 Zhang−Server 95.63 94.18 93.95 97.88 96.26 94.75 91.80 89.97 91.92 1.00 1.10 0.48 0.87 0.83 0.16 0.60 0.62 0.71 95.63 94.18 94.24 97.88 96.52 95.46 92.58 90.75 91.92 0.68 0.79 0.12 0.48 0.57 0.04 0.38 0.35 0.32 Zhang−Server 8
9 keasar−server 95.63 94.03 94.90 97.88 96.47 95.71 92.97 91.41 92.89 1.00 1.07 0.88 0.87 0.94 0.67 0.87 0.85 0.93 95.85 94.11 95.07 98.03 96.82 95.87 93.36 91.80 93.15 0.81 0.76 0.66 0.60 0.76 0.42 0.65 0.63 0.75 keasar−server 9
10 PS2−server 95.63 93.45 95.00 98.03 96.62 95.79 93.75 91.67 92.89 1.00 0.93 0.92 0.96 1.01 0.71 1.05 0.89 0.93 95.63 93.45 95.00 98.03 96.62 95.79 93.75 91.67 92.89 0.68 0.53 0.61 0.60 0.63 0.35 0.79 0.60 0.66 PS2−server 10
11 Frankenstein 95.52 93.63 94.97 98.03 96.52 95.78 93.36 91.54 92.81 0.95 0.97 0.91 0.96 0.96 0.71 0.96 0.87 0.91 95.52 93.63 94.97 98.03 96.52 95.78 93.36 91.54 92.81 0.61 0.59 0.59 0.60 0.57 0.34 0.65 0.56 0.63 Frankenstein 11
12 mGenTHREADER 95.42 93.81 94.87 98.03 96.62 95.73 93.36 91.80 92.50 0.91 1.01 0.87 0.96 1.01 0.68 0.96 0.91 0.84 95.42 93.81 94.87 98.03 96.62 95.73 93.36 91.80 92.50 0.56 0.66 0.53 0.60 0.63 0.29 0.65 0.63 0.52 mGenTHREADER 12
13 BAKER−ROBETTA 95.42 93.81 94.87 98.03 96.62 95.73 93.36 91.80 92.50 0.91 1.01 0.87 0.96 1.01 0.68 0.96 0.91 0.84 95.42 93.81 94.87 98.03 96.62 95.73 93.36 92.32 92.50 0.56 0.66 0.53 0.60 0.63 0.29 0.65 0.77 0.52 BAKER−ROBETTA 13
14 FFASsuboptimal 95.42 93.81 94.87 98.03 96.62 95.73 93.36 91.80 92.50 0.91 1.01 0.87 0.96 1.01 0.68 0.96 0.91 0.84 95.42 93.81 94.87 98.03 96.62 95.73 93.36 91.80 92.50 0.56 0.66 0.53 0.60 0.63 0.29 0.65 0.63 0.52 FFASsuboptimal 14
15 OLGAFS 95.42 93.81 94.87 98.03 96.62 95.73 93.36 91.80 92.50 0.91 1.01 0.87 0.96 1.01 0.68 0.96 0.91 0.84 95.42 93.81 94.87 98.03 96.62 95.73 93.36 91.80 92.50 0.56 0.66 0.53 0.60 0.63 0.29 0.65 0.63 0.52 OLGAFS 15
16 huber−torda−server 95.42 93.74 94.87 98.03 96.52 95.73 93.36 91.80 92.50 0.91 1.00 0.87 0.96 0.96 0.68 0.96 0.91 0.84 95.42 93.74 94.87 98.03 96.52 95.73 93.36 91.80 92.50 0.56 0.63 0.53 0.60 0.57 0.29 0.65 0.63 0.52 huber−torda−server 16
17 GS−KudlatyPred 95.42 93.45 94.39 98.03 96.41 95.20 91.41 90.10 92.19 0.91 0.93 0.66 0.96 0.91 0.40 0.51 0.64 0.77 95.42 93.45 94.39 98.03 96.41 95.20 91.41 90.10 92.19 0.56 0.53 0.21 0.60 0.50 -0.20 -0.04 0.18 0.42 GS−KudlatyPred 17
18 MULTICOM−RANK 95.31 93.85 95.53 98.33 96.72 96.88 90.62 88.80 91.87 0.87 1.02 1.15 1.13 1.06 1.29 0.33 0.43 0.70 95.31 93.85 95.53 99.70 98.89 96.88 90.62 89.06 91.87 0.49 0.67 0.96 1.90 2.07 1.35 -0.32 -0.10 0.30 MULTICOM−RANK 18
19 MUFOLD−Server 95.31 93.56 94.72 97.88 96.26 95.57 92.97 91.93 92.44 0.87 0.95 0.81 0.87 0.83 0.60 0.87 0.94 0.82 95.42 93.67 94.72 98.03 96.41 95.57 92.97 91.93 92.44 0.56 0.61 0.43 0.60 0.50 0.14 0.51 0.67 0.50 MUFOLD−Server 19
20 CpHModels 95.31 93.27 93.21 96.52 94.19 93.83 96.09 94.53 92.25 0.87 0.88 0.16 0.09 -0.17 -0.33 1.59 1.35 0.78 95.31 93.27 93.21 96.52 94.19 93.83 96.09 94.53 92.25 0.49 0.46 -0.56 -0.58 -0.91 -1.46 1.62 1.36 0.44 CpHModels 20
21 Phyre_de_novo 95.20 93.81 95.19 98.48 97.47 96.41 89.84 87.50 92.06 0.83 1.01 1.01 1.22 1.42 1.04 0.15 0.22 0.74 95.52 93.92 95.19 98.48 97.47 96.41 93.75 92.71 93.11 0.61 0.69 0.74 0.95 1.17 0.92 0.79 0.87 0.73 Phyre_de_novo 21
22 MULTICOM−CLUSTER 95.20 93.59 95.24 98.48 96.87 96.67 90.62 89.06 91.30 0.83 0.96 1.03 1.22 1.13 1.18 0.33 0.48 0.57 95.31 93.85 95.53 98.48 98.28 97.13 90.62 89.06 91.87 0.49 0.67 0.96 0.95 1.68 1.58 -0.32 -0.10 0.30 MULTICOM−CLUSTER 22
23 MULTICOM−REFINE 95.20 91.27 95.14 98.33 96.52 96.72 90.23 85.81 90.78 0.83 0.40 0.98 1.13 0.96 1.21 0.24 -0.05 0.45 95.20 91.27 95.14 98.48 97.12 96.72 90.23 85.81 90.78 0.43 -0.24 0.70 0.95 0.95 1.21 -0.46 -0.97 -0.07 MULTICOM−REFINE 23
24 panther_server 94.98 93.52 93.26 97.42 96.21 93.89 92.58 91.54 92.24 0.74 0.94 0.18 0.61 0.81 -0.30 0.78 0.87 0.78 94.98 93.52 93.26 97.42 96.21 93.89 92.58 91.54 92.24 0.30 0.55 -0.53 0.12 0.37 -1.41 0.38 0.56 0.43 panther_server 24
25 FAMSD 94.98 93.30 93.27 97.73 95.71 95.08 91.02 88.67 87.87 0.74 0.89 0.19 0.79 0.57 0.34 0.43 0.41 -0.20 94.98 93.30 93.27 97.73 95.71 95.08 91.02 88.67 89.52 0.30 0.48 -0.52 0.36 0.06 -0.31 -0.18 -0.21 -0.51 FAMSD 25
26 GS−MetaServer2 94.98 93.09 94.29 97.73 96.11 95.22 92.19 90.89 91.95 0.74 0.84 0.62 0.79 0.76 0.41 0.69 0.77 0.71 94.98 93.09 94.29 97.73 96.11 95.22 92.19 90.89 91.95 0.30 0.40 0.15 0.36 0.31 -0.18 0.24 0.39 0.33 GS−MetaServer2 26
27 MUProt 94.11 91.92 93.65 98.33 96.72 96.43 86.72 83.07 85.27 0.40 0.56 0.35 1.13 1.06 1.05 -0.56 -0.49 -0.79 94.11 91.92 93.69 98.48 97.37 96.70 86.72 83.07 85.27 -0.21 -0.01 -0.25 0.95 1.11 1.19 -1.70 -1.70 -1.97 MUProt 27
28 COMA 94.11 91.78 92.75 97.58 95.56 95.17 89.06 87.50 85.20 0.40 0.52 -0.03 0.70 0.49 0.38 -0.03 0.22 -0.80 95.42 93.01 94.58 97.73 95.91 96.67 93.36 91.02 92.93 0.56 0.37 0.34 0.36 0.18 1.16 0.65 0.42 0.67 COMA 28
29 Fiser−M4T 94.00 91.74 95.15 96.52 94.50 96.17 90.23 88.93 92.49 0.36 0.51 0.99 0.09 -0.02 0.92 0.24 0.45 0.84 94.00 91.74 95.15 96.52 94.50 96.17 90.23 88.93 92.49 -0.27 -0.08 0.71 -0.58 -0.71 0.70 -0.46 -0.14 0.52 Fiser−M4T 29
30 YASARA 93.45 90.32 93.45 96.21 93.69 94.97 89.45 87.63 89.31 0.15 0.17 0.26 -0.09 -0.42 0.28 0.06 0.25 0.12 96.62 95.31 94.76 97.27 95.86 95.42 96.48 95.96 93.04 1.25 1.19 0.46 0.00 0.15 0.01 1.75 1.74 0.71 YASARA 30
31 LEE−SERVER 93.45 85.30 93.99 97.73 96.62 95.20 89.84 82.55 90.78 0.15 -1.04 0.49 0.79 1.01 0.40 0.15 -0.57 0.45 93.78 91.74 95.06 98.33 97.02 96.61 90.23 88.41 91.88 -0.40 -0.08 0.65 0.83 0.89 1.10 -0.46 -0.28 0.31 LEE−SERVER 31
32 COMA−M 93.34 87.81 92.91 97.88 96.47 96.11 85.55 81.90 83.01 0.10 -0.43 0.03 0.87 0.94 0.88 -0.83 -0.67 -1.29 94.21 92.47 93.58 98.48 96.67 96.67 85.55 84.50 84.19 -0.15 0.18 -0.32 0.95 0.66 1.16 -2.11 -1.32 -2.34 COMA−M 32
33 GeneSilicoMetaServer 93.01 87.12 93.60 95.76 93.74 94.85 90.62 88.28 90.38 -0.03 -0.60 0.33 -0.36 -0.39 0.21 0.33 0.35 0.36 95.09 93.05 94.68 97.58 95.96 95.82 92.58 91.28 91.88 0.36 0.39 0.40 0.24 0.21 0.38 0.38 0.49 0.31 GeneSilicoMetaServer 33
34 FFASflextemplate 92.80 90.76 92.31 96.67 95.05 94.13 91.80 90.23 87.93 -0.11 0.28 -0.22 0.17 0.25 -0.17 0.60 0.66 -0.19 93.67 91.85 92.35 97.42 96.21 94.13 91.80 90.89 89.24 -0.46 -0.04 -1.12 0.12 0.37 -1.19 0.10 0.39 -0.60 FFASflextemplate 34
35 3D−JIGSAW_V3 92.69 86.35 93.89 95.45 93.43 95.15 89.84 86.98 90.56 -0.15 -0.79 0.45 -0.54 -0.54 0.37 0.15 0.14 0.40 92.90 86.35 93.89 95.45 93.43 95.15 89.84 87.50 90.71 -0.91 -1.98 -0.11 -1.42 -1.39 -0.24 -0.59 -0.52 -0.10 3D−JIGSAW_V3 35
36 nFOLD3 92.58 88.72 93.67 94.85 92.83 95.02 89.84 86.98 90.14 -0.19 -0.21 0.36 -0.88 -0.84 0.30 0.15 0.14 0.31 95.42 93.81 94.87 98.03 96.62 95.73 93.36 91.80 92.50 0.56 0.66 0.53 0.60 0.63 0.29 0.65 0.63 0.52 nFOLD3 36
37 mariner1 92.58 87.19 93.54 95.15 92.93 94.85 89.45 86.59 90.04 -0.19 -0.58 0.30 -0.71 -0.79 0.21 0.06 0.08 0.29 92.90 90.21 93.67 96.21 95.00 95.02 90.23 86.59 90.12 -0.91 -0.62 -0.26 -0.83 -0.39 -0.36 -0.46 -0.76 -0.30 mariner1 37
38 HHpred4 92.58 86.97 93.75 95.45 93.64 95.09 89.84 86.20 90.26 -0.19 -0.64 0.39 -0.54 -0.44 0.34 0.15 0.02 0.34 92.58 86.97 93.75 95.45 93.64 95.09 89.84 86.20 90.26 -1.10 -1.76 -0.21 -1.42 -1.25 -0.30 -0.59 -0.87 -0.25 HHpred4 38
39 pro−sp3−TASSER 92.58 86.32 93.41 95.00 92.98 94.73 89.84 86.98 89.93 -0.19 -0.79 0.25 -0.80 -0.76 0.15 0.15 0.14 0.26 92.69 88.25 93.41 95.30 93.28 94.73 90.23 87.89 89.99 -1.03 -1.31 -0.43 -1.54 -1.48 -0.63 -0.46 -0.41 -0.34 pro−sp3−TASSER 39
40 MUSTER 92.58 85.59 93.52 94.85 91.01 94.80 89.84 86.98 90.23 -0.19 -0.97 0.29 -0.88 -1.72 0.19 0.15 0.14 0.33 97.05 95.60 95.14 98.33 97.12 96.01 96.09 95.05 93.94 1.50 1.29 0.70 0.83 0.95 0.55 1.62 1.50 1.02 MUSTER 40
41 Pcons_local 92.58 85.44 93.70 95.00 92.98 95.05 89.84 86.98 90.16 -0.19 -1.00 0.37 -0.80 -0.76 0.32 0.15 0.14 0.31 92.58 89.52 93.70 95.00 92.98 95.05 89.84 86.98 90.21 -1.10 -0.86 -0.24 -1.77 -1.67 -0.34 -0.59 -0.66 -0.27 Pcons_local 41
42 3D−JIGSAW_AEP 92.58 85.23 93.42 95.30 93.18 94.48 89.84 87.50 90.66 -0.19 -1.06 0.25 -0.62 -0.66 0.02 0.15 0.22 0.42 92.90 88.03 93.70 95.61 93.43 94.85 90.23 87.50 90.77 -0.91 -1.39 -0.24 -1.29 -1.39 -0.52 -0.46 -0.52 -0.07 3D−JIGSAW_AEP 42
43 pipe_int 92.36 84.64 93.50 95.00 92.98 94.84 89.84 86.98 89.97 -0.28 -1.20 0.29 -0.80 -0.76 0.21 0.15 0.14 0.27 95.42 93.74 94.87 98.03 96.52 95.74 93.36 91.80 92.50 0.56 0.63 0.53 0.60 0.57 0.30 0.65 0.63 0.52 pipe_int 43
44 METATASSER 92.14 88.28 91.59 95.00 92.98 93.03 89.06 87.24 88.00 -0.36 -0.32 -0.53 -0.80 -0.76 -0.75 -0.03 0.18 -0.17 92.58 88.28 91.66 95.45 93.43 93.12 89.84 88.02 88.00 -1.10 -1.30 -1.58 -1.42 -1.39 -2.12 -0.59 -0.38 -1.03 METATASSER 44
45 MULTICOM−CMFR 92.14 82.61 94.93 98.18 97.58 96.56 89.06 83.33 91.26 -0.36 -1.69 0.89 1.05 1.48 1.12 -0.03 -0.44 0.56 92.14 82.64 95.09 98.48 98.28 97.06 89.06 83.33 91.26 -1.35 -3.29 0.67 0.95 1.68 1.52 -0.87 -1.63 0.09 MULTICOM−CMFR 45
46 LOOPP_Server 91.92 88.65 90.73 97.12 94.80 94.13 82.42 76.69 80.69 -0.45 -0.23 -0.89 0.43 0.12 -0.17 -1.55 -1.51 -1.81 95.42 93.52 94.54 97.88 96.06 95.58 91.80 90.23 92.55 0.56 0.55 0.31 0.48 0.28 0.15 0.10 0.21 0.54 LOOPP_Server 46
47 SAM−T06−server 91.16 87.95 92.97 95.00 92.98 94.84 87.89 85.55 87.77 -0.75 -0.40 0.06 -0.80 -0.76 0.21 -0.29 -0.09 -0.22 91.16 87.95 92.97 95.15 93.13 95.02 87.89 85.55 87.77 -1.92 -1.42 -0.72 -1.65 -1.58 -0.36 -1.28 -1.04 -1.11 SAM−T06−server 47
48 circle 91.16 85.92 89.67 96.36 94.24 93.29 82.42 75.91 78.99 -0.75 -0.89 -1.35 -0.01 -0.15 -0.62 -1.55 -1.63 -2.20 91.59 87.44 89.90 96.67 94.24 93.55 82.81 76.95 79.47 -1.67 -1.60 -2.73 -0.47 -0.87 -1.72 -3.08 -3.34 -3.97 circle 48
49 Poing 91.05 88.14 88.62 93.03 91.01 88.37 89.84 86.98 89.97 -0.79 -0.35 -1.79 -1.94 -1.72 -3.23 0.15 0.14 0.27 95.42 93.67 94.87 98.03 96.41 95.73 93.36 91.80 92.50 0.56 0.61 0.53 0.60 0.50 0.29 0.65 0.63 0.52 Poing 49
50 Phyre2 91.05 88.14 88.66 93.03 91.41 88.42 89.84 86.98 89.97 -0.79 -0.35 -1.78 -1.94 -1.53 -3.21 0.15 0.14 0.27 95.42 93.81 94.87 98.03 96.62 95.73 93.36 91.80 92.50 0.56 0.66 0.53 0.60 0.63 0.29 0.65 0.63 0.52 Phyre2 50
51 Phragment 91.05 88.14 88.66 93.03 91.21 88.42 89.84 86.98 89.97 -0.79 -0.35 -1.78 -1.94 -1.62 -3.21 0.15 0.14 0.27 95.42 93.74 94.87 98.03 96.41 95.73 93.36 91.80 92.50 0.56 0.63 0.53 0.60 0.50 0.29 0.65 0.63 0.52 Phragment 51
52 FALCON_CONSENSUS 90.61 87.26 89.76 94.24 91.62 91.89 84.38 79.69 83.40 -0.96 -0.57 -1.31 -1.24 -1.42 -1.36 -1.10 -1.03 -1.21 92.58 88.72 93.67 94.85 92.83 95.02 89.84 86.98 90.14 -1.10 -1.14 -0.26 -1.89 -1.77 -0.36 -0.59 -0.66 -0.29 FALCON_CONSENSUS 52
53 FALCON 90.61 87.26 89.76 94.24 91.62 91.89 84.38 79.69 83.40 -0.96 -0.57 -1.31 -1.24 -1.42 -1.36 -1.10 -1.03 -1.21 92.58 88.72 93.67 94.85 92.83 95.02 89.84 86.98 90.14 -1.10 -1.14 -0.26 -1.89 -1.77 -0.36 -0.59 -0.66 -0.29 FALCON 53
54 Pcons_dot_net 90.61 87.19 89.08 93.94 91.62 90.97 85.94 82.03 83.46 -0.96 -0.58 -1.60 -1.41 -1.42 -1.85 -0.74 -0.65 -1.19 95.52 92.32 94.09 97.88 94.34 95.08 92.97 91.41 93.02 0.61 0.13 0.02 0.48 -0.81 -0.31 0.51 0.53 0.70 Pcons_dot_net 54
55 Pcons_multi 90.61 87.19 89.08 93.94 91.62 90.97 85.94 82.03 83.46 -0.96 -0.58 -1.60 -1.41 -1.42 -1.85 -0.74 -0.65 -1.19 94.65 91.23 94.65 97.58 94.55 95.76 91.02 89.19 91.66 0.11 -0.26 0.38 0.24 -0.68 0.32 -0.18 -0.07 0.23 Pcons_multi 55
56 rehtnap 90.50 87.74 90.59 93.33 90.71 91.09 87.89 85.03 89.50 -1.00 -0.45 -0.95 -1.76 -1.87 -1.79 -0.29 -0.17 0.16 90.83 88.72 91.04 93.94 90.91 91.54 88.67 87.37 90.20 -2.12 -1.14 -1.98 -2.60 -2.98 -3.58 -1.01 -0.55 -0.27 rehtnap 56
57 FUGUE_KM 90.50 87.66 88.98 93.79 91.67 90.92 85.55 81.12 83.23 -1.00 -0.47 -1.64 -1.50 -1.40 -1.88 -0.83 -0.80 -1.24 90.50 87.66 88.98 93.79 91.67 90.92 85.55 81.12 83.23 -2.31 -1.52 -3.33 -2.72 -2.50 -4.15 -2.11 -2.22 -2.67 FUGUE_KM 57
58 3DShot2 89.85 86.14 88.81 96.21 94.39 92.19 79.30 72.00 78.20 -1.26 -0.84 -1.71 -0.09 -0.08 -1.20 -2.27 -2.26 -2.37 89.85 86.14 88.81 96.21 94.39 92.19 79.30 72.00 78.20 -2.69 -2.05 -3.44 -0.83 -0.78 -2.98 -4.32 -4.66 -4.41 3DShot2 58
59 ACOMPMOD 89.74 86.46 89.18 93.48 91.16 90.97 85.55 81.12 83.97 -1.30 -0.76 -1.55 -1.68 -1.65 -1.85 -0.83 -0.80 -1.08 89.74 86.46 89.18 93.48 91.16 90.97 85.55 81.12 83.97 -2.75 -1.94 -3.20 -2.96 -2.82 -4.10 -2.11 -2.22 -2.42 ACOMPMOD 59
60 SAM−T08−server 89.19 85.84 89.32 93.18 91.06 91.50 85.55 81.38 83.10 -1.52 -0.91 -1.50 -1.85 -1.70 -1.57 -0.83 -0.76 -1.27 90.72 87.66 89.50 95.15 93.13 95.02 85.55 81.38 83.23 -2.18 -1.52 -2.99 -1.65 -1.58 -0.36 -2.11 -2.15 -2.67 SAM−T08−server 60
61 fais−server 88.65 84.13 88.65 94.85 92.63 90.92 78.91 70.83 81.69 -1.73 -1.32 -1.78 -0.88 -0.93 -1.88 -2.36 -2.45 -1.59 95.96 93.92 95.06 98.18 96.67 95.92 92.97 91.15 92.58 0.87 0.69 0.65 0.71 0.66 0.47 0.51 0.46 0.55 fais−server 61
62 forecast 85.48 78.49 89.39 94.70 93.38 93.86 73.44 61.46 77.04 -2.96 -2.68 -1.47 -0.97 -0.57 -0.31 -3.61 -3.95 -2.63 96.94 95.71 94.91 97.88 96.26 95.40 96.48 95.96 93.91 1.44 1.33 0.55 0.48 0.40 -0.01 1.75 1.74 1.01 forecast 62
63 SAM−T02−server 84.17 73.33 88.06 93.94 89.80 92.23 75.78 66.15 76.65 -3.47 -3.92 -2.03 -1.41 -2.31 -1.18 -3.08 -3.20 -2.72 92.47 84.32 93.64 95.15 93.13 95.02 89.84 86.98 89.97 -1.16 -2.70 -0.28 -1.65 -1.58 -0.36 -0.59 -0.66 -0.35 SAM−T02−server 63
64 HHpred2 84.06 76.20 88.66 94.09 92.58 93.23 74.61 62.11 76.06 -3.52 -3.23 -1.78 -1.32 -0.96 -0.65 -3.34 -3.85 -2.85 84.06 76.20 88.66 94.09 92.58 93.23 74.61 62.11 76.06 -6.06 -5.57 -3.54 -2.48 -1.92 -2.02 -5.98 -7.31 -5.15 HHpred2 64
65 PSI 83.52 75.58 88.78 94.85 94.14 93.71 73.83 64.97 75.40 -3.73 -3.38 -1.73 -0.88 -0.20 -0.39 -3.52 -3.39 -3.00 95.85 93.96 95.14 98.03 96.21 96.01 93.36 90.50 92.78 0.81 0.71 0.70 0.60 0.37 0.55 0.65 0.28 0.62 PSI 65
66 Distill 76.75 69.29 68.74 80.76 74.85 71.44 71.48 64.45 63.81 -6.37 -4.90 -10.26 -9.05 -9.59 -12.24 -4.06 -3.47 -5.60 76.75 69.29 68.74 80.76 74.85 71.44 71.48 66.28 63.81 -10.31 -8.01 -16.59 -12.89 -13.14 -22.13 -7.09 -6.19 -9.37 Distill 66
67 FOLDpro 25.44 21.07 20.72 35.30 29.24 28.89 21.48 19.40 16.41 -26.37 -16.52 -30.72 -35.41 -31.79 -34.88 -15.55 -10.70 -16.25 39.52 36.97 33.21 43.79 41.36 37.17 36.72 30.99 27.79 -31.98 -19.43 -39.87 -41.77 -34.34 -53.77 -19.38 -15.62 -21.79 FOLDpro 67
68 MUFOLD−MD 19.87 16.89 34.85 26.82 22.88 39.33 33.98 32.42 40.23 -28.54 -17.53 -24.70 -40.32 -34.89 -29.32 -12.68 -8.61 -10.90 24.45 20.96 41.46 33.79 31.26 48.56 39.84 36.72 49.08 -40.76 -25.09 -34.47 -49.58 -40.73 -43.26 -18.28 -14.09 -14.45 MUFOLD−MD 68
69 RBO−Proteus 15.39 14.27 26.57 20.15 17.12 29.97 28.12 24.48 36.90 -30.29 -18.16 -28.23 -44.19 -37.70 -34.30 -14.02 -9.89 -11.65 15.39 14.52 27.17 21.52 20.56 30.15 29.30 25.78 39.28 -46.03 -27.36 -43.83 -59.16 -47.50 -60.26 -22.01 -17.02 -17.83 RBO−Proteus 69
70 RANDOM 10.51 8.89 10.51 15.44 12.49 15.44 24.56 20.43 24.56 -32.19 -19.45 -35.07 -46.92 -39.95 -42.03 -14.84 -10.54 -14.42 10.51 8.89 10.51 15.44 12.49 15.44 24.56 20.43 24.56 -48.87 -29.35 -54.75 -63.91 -52.61 -73.84 -23.68 -18.45 -22.90 RANDOM 70
71 schenk−torda−server 8.84 7.82 10.89 11.06 10.15 13.41 19.92 19.66 23.53 -32.84 -19.71 -34.91 -49.46 -41.09 -43.11 -15.91 -10.66 -14.65 10.15 9.61 11.28 12.88 10.76 13.41 24.22 22.79 26.81 -49.08 -29.10 -54.24 -65.91 -53.70 -75.71 -23.80 -17.82 -22.13 schenk−torda−server 71
72 BHAGEERATH                                                       -32.19 -19.45 -35.07 -46.92 -39.95 -42.03 -14.84 -10.54 -14.42                                                       -48.87 -29.35 -54.75 -63.91 -52.61 -73.84 -23.68 -18.45 -22.90 BHAGEERATH 72
73 mahmood−torda−server                                                       -32.19 -19.45 -35.07 -46.92 -39.95 -42.03 -14.84 -10.54 -14.42                                                       -48.87 -29.35 -54.75 -63.91 -52.61 -73.84 -23.68 -18.45 -22.90 mahmood−torda−server 73
74 test_http_server_01                                                       -32.19 -19.45 -35.07 -46.92 -39.95 -42.03 -14.84 -10.54 -14.42                                                       -48.87 -29.35 -54.75 -63.91 -52.61 -73.84 -23.68 -18.45 -22.90 test_http_server_01 74