T0424

Server only Targets
388 390 392 394
398 400 402 404
406 408 410 412
414 416 418 420
422 424 426 428
430 432 433 435
436 438 439 441
442 444 445 447
448 450 452 453
455 456 458 459
461 463 470 472
475 477 478 479
481 483 485 486
488 490 491 494
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514  

T0424

the tail protein AAF41501 from Neisseria meningitidis MC58

Target type: Server only

Target sequence:

>T0424 AAF41501, Neisseria meningitidis MC58, 381 residues
MQNNSYGYAVSVRVGGKEHRHWERYDIDSDFLIPADSFDFVIGRLGPEAAIPDLSGESCEVVIDGQIVMTGIIGSQRHGKSKGSRELSLSGRDLAGFLVDCSAPQLNVKGMTVLDAAKKLAAPWPQIKAVVLKAENNPALGKIDIEPGETVWQALTHIANSVGLHPWLEPDGTLVVGGADYSSPPVATLCWSRTDSRCNIERMDIEWDTDNRFSEVTFLAQSHGRSGDSAKHDLKWVYKDPTMTLHRPKTVVVSDADNLAALQKQAKKQLADWRLEGFTLTITVGGHKTRDGVLWQPGLRVHVIDDEHGIDAVFFLMGRRFMLSRMDGTQTELRLKEDGIWTPDAYPKKAEAARKRKGKRKGVSHKGKKGGKKQAETAVFE

Structure:
Method: X-ray, res=2.1Å, R/Rfree=0.22/0.27
Determined by: MCSG
PDB ID: 3d37

3d37_A cartoon
Cartoon diagram of 424: 3d37 chain A

PyMOL of 3d37

Domains:  PyMOL of domains

Four domains, a duplication of a β-barrel, each duplicate contains a smaller inserted domain. Residue ranges in PDB: 6-93; 94-178; 179-207,278-347 and 208-277. Residue ranges in target: 6-93; 94-178; 179-207,278-347 and 208-277.

424 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

A duplication of Phage tail proteins fold.

CASP category:

Whole chain: Comparative modeling:medium.

1st domain: Comparative modeling:easy. 2nd domain: Comparative modeling:medium. 3rd domain: Comparative modeling:medium. 4th domain: Comparative modeling:medium. As a very close template existis in PDB with essentially the same domain arrangement, domain partitioning may not be necessary for evaluation of predictions.

Closest templates:

1wru, 3cdd.

Target sequence - PDB file inconsistencies:

T0424    3d37.pdb    T0424.pdb    PyMOL    PyMOL of domains    

T0424    1 MQNNSYGYAVSVRVGGKEHRHWERYDIDSDFLIPADSFDFVIGRLGPEAAIPDLSGESCEVVIDGQIVMTGIIGSQRHGKSKGSRELSLSGRDLAGFLVDCSAPQLNVKGMTVLDAAKKLAAPWPQIKAVVLKAENNPALGKIDIEPGETVWQALTHIANSVGLHPWLEPDGTLVVGGADYSSPPVATLCWSRTDSRCNIERMDIEWDTDNRFSEVTFLAQSHGRSGDSAKHDLKWVYKDPTMTLHRPKTVVVSDADNLAALQKQAKKQLADWRLEGFTLTITVGGHKTRDGVLWQPGLRVHVIDDEHGIDAVFFLMGRRFMLSRMDGTQTELRLKEDGIWTPDAYPKKAEAARKRKGKRKGVSHKGKKGGKKQAETAVFE 381
           ~~~~~|||||||||||||||||||||||||||||||||||||||~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~|||||||||||||||||||||||~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
3d37A    6 -----YGYAVSVRVGGKEHRHWERYDIDSDFLIPADSFDFVIGR-------PDLSGESCEVVIDGQIVMTGIIGSQRHGKSKGSRELSLSGRDLAGFLVDCSAPQLNVKGMTVLDAAKKLAAPWPQIKAVVLKAENNPALGKIDIEPGETVWQALTHIANSVGLHPWLEPDGTLVVGGADYSSPPVATLCWSRTDSRCNIERMDIEWDTDNRFSEVTFLAQSHG-------HDLKWVYKDPTMTLHRPKTVVVS--DNLAALQKQAKKQLADWRLEGFTLTITVGGHKTRDGVLWQPGLRVHVIDDEHGIDAVFFLMGRRFMLSRMDGTQTELRLKEDGIWTPDAYP---------------------------------- 347

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily, this is a 4-domain protein (a duplication of a β-barrel, each duplicate contains a smaller inserted domain):

1st domain: target 6-44, 52-93 ; pdb 6-44, 52-93

2nd domain: target 94-178 ; pdb 94-178

3rd domain: target 179-207, 278-347 ; pdb 179-207, 278-347

4th domain: target 208-224, 232-254, 257-277 ; pdb 208-224, 232-254, 257-277

Sequence classification:

Bacteriophage Mu P protein (Phage_Mu_P) in Pfam.

Server predictions:

T0424:pdb 6-347:seq 6-347:CM_medium;   alignment

distribution of first scores
First models for T0424: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

424_1:pdb 6-93:seq 6-93:CM_easy;   alignment

distribution of first scores
First models for T0424_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

424_2:pdb 94-178:seq 94-178:CM_medium;   alignment

distribution of first scores
First models for T0424_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

424_3:pdb 179-207,278-347:seq 179-207,278-347:CM_medium;   alignment

distribution of first scores
First models for T0424_3: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

424_4:pdb 208-277:seq 208-277:CM_medium;   alignment

distribution of first scores
First models for T0424_4: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0424 424_1 424_2 424_3 424_4 T0424 424_1 424_2 424_3 424_4 T0424 424_1 424_2 424_3 424_4 T0424 424_1 424_2 424_3 424_4
First score First Z-score Best score Best Z-score
1 pipe_int 72.01 64.85 78.08 94.44 93.42 94.33 77.94 68.92 75.76 73.23 67.00 74.97 79.10 77.46 83.70 1.00 1.20 0.88 1.63 1.93 0.38 0.68 0.77 1.06 0.46 0.37 0.97 0.78 1.05 0.77 72.01 64.85 78.08 94.44 93.42 94.33 77.94 68.92 75.76 73.23 67.00 74.97 79.10 77.46 83.70 1.41 1.57 0.95 2.03 1.92 0.33 0.35 0.17 0.70 0.28 0.06 0.79 0.61 0.81 0.60 pipe_int 1
2 LEE−SERVER 71.32 62.06 78.48 91.97 88.89 95.82 78.23 69.22 76.37 74.75 70.88 74.45 78.28 76.91 81.55 0.90 0.78 0.92 1.11 1.11 0.62 0.75 0.84 1.19 0.64 0.80 0.93 0.69 0.99 0.57 71.70 64.44 79.28 92.28 88.89 96.00 79.12 69.41 77.39 75.76 72.56 75.99 81.15 80.06 84.37 1.32 1.45 1.16 1.24 0.77 0.93 0.75 0.31 1.12 0.73 0.98 0.90 0.93 1.16 0.69 LEE−SERVER 2
3 MULTICOM−CMFR 70.17 61.48 72.36 91.67 88.17 92.68 77.94 65.98 73.98 72.73 68.86 62.60 81.15 79.23 84.87 0.73 0.69 0.23 1.04 0.97 0.11 0.68 0.05 0.69 0.40 0.58 -0.12 1.00 1.23 0.88 70.17 61.48 72.75 91.67 88.17 92.68 77.94 69.80 76.91 72.73 68.86 63.28 82.38 79.23 86.91 0.87 0.64 0.02 1.01 0.59 -0.27 0.35 0.42 1.00 0.19 0.37 -0.45 1.13 1.05 1.01 MULTICOM−CMFR 3
4 FFASflextemplate 70.09 61.66 75.44 91.36 87.24 92.56 79.41 68.63 76.07 74.50 66.92 71.49 75.41 71.58 75.71 0.72 0.72 0.58 0.98 0.81 0.09 1.05 0.70 1.12 0.61 0.36 0.66 0.38 0.44 0.02 70.09 61.76 76.19 91.97 88.07 92.69 79.41 68.72 76.10 74.75 72.05 73.35 75.82 72.81 79.73 0.84 0.72 0.62 1.12 0.57 -0.26 0.85 0.11 0.79 0.55 0.89 0.62 0.10 0.18 0.09 FFASflextemplate 4
5 pro−sp3−TASSER 69.94 62.78 76.22 87.96 83.64 94.03 77.35 66.77 71.49 77.27 70.71 73.21 75.00 70.36 82.13 0.70 0.89 0.67 0.25 0.15 0.33 0.53 0.24 0.17 0.94 0.78 0.82 0.33 0.32 0.62 69.94 62.78 76.22 88.27 86.42 94.03 77.65 71.18 72.44 77.27 73.32 73.71 77.87 76.50 84.77 0.80 1.00 0.62 -0.23 0.15 0.22 0.25 0.82 -0.18 1.00 1.10 0.66 0.42 0.68 0.74 pro−sp3−TASSER 5
6 PS2−server 69.78 62.32 76.45 91.67 89.81 94.74 78.53 69.90 76.42 72.22 60.77 72.00 74.59 68.85 77.85 0.67 0.82 0.69 1.04 1.27 0.44 0.83 1.01 1.20 0.34 -0.33 0.71 0.29 0.16 0.22 69.78 62.32 76.59 91.67 89.81 94.74 78.53 69.90 76.42 75.76 68.86 78.85 75.00 73.36 78.99 0.75 0.87 0.69 1.01 1.01 0.48 0.55 0.45 0.87 0.73 0.37 1.20 -0.03 0.25 -0.00 PS2−server 6
7 GS−MetaServer2 69.71 61.94 76.42 86.11 82.41 93.84 75.29 63.73 70.81 76.26 67.34 77.41 71.72 65.98 78.35 0.66 0.76 0.69 -0.14 -0.07 0.30 0.00 -0.50 0.02 0.82 0.41 1.19 -0.02 -0.13 0.27 69.71 61.94 76.42 89.81 87.35 94.07 77.35 67.94 73.93 76.26 68.86 77.41 76.64 73.09 80.07 0.73 0.77 0.66 0.33 0.38 0.24 0.15 -0.12 0.21 0.82 0.37 1.05 0.23 0.21 0.14 GS−MetaServer2 7
8 keasar−server 69.56 61.17 75.96 90.74 89.71 91.78 78.82 68.43 74.95 73.74 65.32 75.50 77.46 76.64 79.72 0.64 0.65 0.64 0.84 1.26 -0.03 0.90 0.65 0.89 0.52 0.18 1.02 0.60 0.96 0.40 70.17 62.40 77.25 91.05 90.02 93.81 80.59 77.25 78.83 75.76 71.04 75.50 78.28 76.64 84.05 0.87 0.89 0.80 0.79 1.06 0.14 1.25 2.59 1.50 0.73 0.73 0.85 0.48 0.70 0.65 keasar−server 8
9 Phyre2 69.33 62.37 73.76 87.35 83.23 93.79 76.18 66.47 73.30 73.48 69.28 65.97 75.00 68.99 78.27 0.61 0.83 0.39 0.12 0.08 0.29 0.23 0.17 0.54 0.49 0.62 0.18 0.33 0.18 0.26 69.63 62.37 73.76 94.14 93.52 93.79 76.18 66.47 73.31 73.48 69.28 65.97 79.92 76.37 83.70 0.71 0.89 0.20 1.92 1.94 0.14 -0.25 -0.54 0.05 0.32 0.44 -0.16 0.74 0.66 0.60 Phyre2 9
10 Zhang−Server 69.17 61.15 73.35 90.12 84.16 93.90 77.65 68.43 73.46 71.97 65.91 64.77 79.92 69.26 85.52 0.58 0.65 0.34 0.71 0.24 0.31 0.60 0.65 0.58 0.31 0.25 0.07 0.87 0.21 0.94 69.63 62.22 73.35 91.05 88.37 94.04 78.23 69.22 73.61 72.22 67.00 65.08 80.33 75.82 86.04 0.71 0.85 0.13 0.79 0.64 0.23 0.45 0.26 0.13 0.10 0.06 -0.26 0.81 0.59 0.90 Zhang−Server 10
11 forecast 69.17 60.12 74.92 88.89 85.80 94.10 76.18 63.43 72.05 75.25 70.20 70.52 75.00 71.17 82.10 0.58 0.49 0.52 0.45 0.54 0.34 0.23 -0.57 0.28 0.70 0.73 0.58 0.33 0.40 0.62 69.17 61.55 75.17 88.89 85.80 94.42 77.06 68.63 72.12 75.76 70.88 71.44 76.23 73.77 84.28 0.57 0.66 0.44 -0.00 -0.01 0.36 0.05 0.08 -0.26 0.73 0.70 0.42 0.16 0.31 0.68 forecast 11
12 Fiser−M4T 69.02 57.77 78.68 82.72 75.93 89.88 80.59 74.71 79.37 81.06 73.99 78.55 76.23 71.86 81.41 0.56 0.14 0.94 -0.87 -1.25 -0.34 1.35 2.18 1.81 1.39 1.15 1.29 0.47 0.47 0.56 69.02 57.77 78.68 82.72 75.93 89.88 80.59 74.71 79.37 81.06 73.99 78.55 76.23 71.86 81.41 0.53 -0.37 1.05 -2.26 -2.50 -1.28 1.25 1.85 1.65 1.67 1.21 1.17 0.16 0.05 0.31 Fiser−M4T 12
13 Phragment 68.94 61.53 72.97 87.35 83.03 93.83 76.18 66.47 73.30 73.48 69.28 65.97 75.00 68.99 73.76 0.55 0.70 0.30 0.12 0.04 0.30 0.23 0.17 0.54 0.49 0.62 0.18 0.33 0.18 -0.16 69.71 62.30 72.97 93.21 92.59 93.88 76.18 66.47 73.31 73.48 69.28 65.97 79.92 76.37 83.70 0.73 0.87 0.06 1.58 1.71 0.17 -0.25 -0.54 0.05 0.32 0.44 -0.16 0.74 0.66 0.60 Phragment 13
14 HHpred5 68.94 60.61 77.09 88.58 85.91 95.35 80.29 64.80 77.16 73.99 68.94 72.62 75.82 70.08 80.45 0.55 0.56 0.76 0.38 0.56 0.54 1.27 -0.24 1.35 0.55 0.59 0.76 0.42 0.29 0.47 68.94 60.61 77.09 88.58 85.91 95.35 80.29 64.80 77.16 73.99 68.94 72.62 75.82 70.08 80.45 0.51 0.40 0.78 -0.11 0.02 0.70 1.15 -1.03 1.06 0.42 0.38 0.54 0.10 -0.19 0.19 HHpred5 14
15 Poing 68.86 62.06 72.99 87.65 83.54 94.10 76.18 66.28 73.30 73.48 69.28 65.97 72.54 70.36 73.48 0.54 0.78 0.30 0.18 0.13 0.34 0.23 0.12 0.54 0.49 0.62 0.18 0.07 0.32 -0.19 69.48 62.06 72.99 92.59 90.64 94.10 76.18 66.28 73.31 73.48 69.28 65.97 79.92 76.37 83.70 0.67 0.80 0.06 1.35 1.22 0.25 -0.25 -0.60 0.05 0.32 0.44 -0.16 0.74 0.66 0.60 Poing 15
16 RAPTOR 68.56 61.76 74.49 90.43 88.99 95.76 76.47 63.33 71.98 74.24 70.20 68.00 72.54 67.08 79.01 0.49 0.74 0.47 0.78 1.12 0.61 0.30 -0.60 0.27 0.58 0.73 0.36 0.07 -0.02 0.33 70.86 62.32 78.69 90.43 88.99 95.76 78.82 72.35 74.97 77.78 73.57 77.12 79.10 74.73 82.68 1.07 0.87 1.05 0.56 0.80 0.85 0.65 1.16 0.49 1.09 1.14 1.02 0.61 0.44 0.47 RAPTOR 16
17 CpHModels 68.48 61.17 72.84 83.95 78.19 90.88 77.06 70.98 73.19 71.97 67.42 66.86 76.64 62.70 77.93 0.48 0.65 0.28 -0.61 -0.84 -0.18 0.45 1.27 0.52 0.31 0.41 0.26 0.51 -0.47 0.23 68.48 61.17 72.84 83.95 78.19 90.88 77.06 70.98 73.19 71.97 67.42 66.86 76.64 62.70 77.93 0.37 0.56 0.04 -1.81 -1.93 -0.92 0.05 0.77 0.02 0.06 0.13 -0.07 0.23 -1.20 -0.14 CpHModels 17
18 SAM−T08−server 68.41 62.58 73.51 87.04 82.72 94.03 77.06 70.78 69.12 74.50 69.44 72.01 69.26 68.17 73.22 0.47 0.86 0.36 0.05 -0.02 0.33 0.45 1.22 -0.33 0.61 0.64 0.71 -0.29 0.09 -0.21 68.94 62.58 77.97 87.04 83.85 94.12 77.06 70.78 71.28 77.02 73.15 81.67 73.36 70.63 78.40 0.51 0.94 0.93 -0.68 -0.50 0.25 0.05 0.71 -0.48 0.95 1.07 1.50 -0.29 -0.12 -0.08 SAM−T08−server 18
19 LOOPP_Server 68.17 57.74 77.74 86.11 82.41 93.45 73.53 62.94 69.05 79.04 75.00 81.65 76.64 71.72 82.09 0.44 0.13 0.84 -0.14 -0.07 0.24 -0.44 -0.69 -0.34 1.15 1.27 1.56 0.51 0.46 0.62 68.17 57.74 77.74 86.11 82.41 93.45 77.35 69.71 75.56 79.04 75.00 81.65 76.64 72.95 82.09 0.28 -0.38 0.89 -1.02 -0.86 0.01 0.15 0.40 0.64 1.31 1.38 1.50 0.23 0.20 0.40 LOOPP_Server 19
20 SAM−T06−server 68.02 59.99 73.05 87.35 81.17 94.07 76.47 64.90 71.03 72.47 65.24 66.36 76.64 75.00 81.26 0.41 0.47 0.31 0.12 -0.30 0.34 0.30 -0.21 0.07 0.37 0.17 0.21 0.51 0.79 0.54 68.02 60.15 73.05 87.35 85.80 94.07 76.47 70.10 71.03 72.47 65.83 66.36 76.64 75.00 81.26 0.24 0.28 0.07 -0.56 -0.01 0.24 -0.15 0.51 -0.55 0.15 -0.13 -0.12 0.23 0.47 0.29 SAM−T06−server 20
21 METATASSER 67.94 58.97 72.60 88.27 84.57 93.80 78.23 65.29 71.12 73.74 68.86 65.43 75.00 71.72 81.79 0.40 0.32 0.26 0.32 0.32 0.29 0.75 -0.12 0.09 0.52 0.58 0.13 0.33 0.46 0.59 68.94 60.40 73.37 90.43 87.96 93.85 79.12 68.92 76.94 73.99 69.61 66.97 78.28 73.09 82.72 0.51 0.35 0.13 0.56 0.54 0.16 0.75 0.17 1.01 0.42 0.49 -0.06 0.48 0.21 0.48 METATASSER 21
22 Phyre_de_novo 67.87 60.51 72.58 87.96 84.67 93.93 75.59 65.98 72.85 73.74 69.53 66.14 70.90 67.62 72.00 0.39 0.55 0.26 0.25 0.34 0.31 0.08 0.05 0.45 0.52 0.65 0.19 -0.11 0.04 -0.33 69.86 63.37 72.58 92.28 91.05 93.93 76.47 65.98 74.03 73.74 69.53 66.14 79.92 77.46 83.60 0.78 1.16 -0.01 1.24 1.32 0.19 -0.15 -0.69 0.24 0.37 0.48 -0.15 0.74 0.81 0.59 Phyre_de_novo 22
23 circle 67.56 60.45 73.66 87.65 81.69 93.48 74.12 66.47 67.48 74.24 68.69 72.70 72.54 65.71 75.84 0.35 0.54 0.38 0.18 -0.20 0.24 -0.29 0.17 -0.67 0.58 0.56 0.77 0.07 -0.16 0.03 69.33 60.45 75.07 91.36 90.33 93.48 78.82 68.43 76.01 74.24 68.69 72.70 74.59 71.04 80.81 0.62 0.36 0.42 0.90 1.14 0.02 0.65 0.03 0.76 0.46 0.34 0.55 -0.09 -0.06 0.23 circle 23
24 FFASsuboptimal 67.33 60.23 75.14 91.67 89.81 94.51 74.71 64.31 70.44 70.96 67.42 69.17 81.15 79.23 84.50 0.31 0.51 0.54 1.04 1.27 0.41 -0.14 -0.36 -0.05 0.19 0.41 0.46 1.00 1.23 0.85 67.41 60.23 75.14 92.28 90.23 94.58 75.88 65.98 70.44 71.21 67.76 70.26 81.15 79.23 84.50 0.06 0.30 0.44 1.24 1.11 0.42 -0.35 -0.69 -0.70 -0.08 0.19 0.29 0.93 1.05 0.70 FFASsuboptimal 24
25 mGenTHREADER 67.18 59.66 70.43 86.11 82.00 93.45 79.12 74.02 75.13 67.93 65.24 58.55 71.31 69.13 72.83 0.29 0.42 0.01 -0.14 -0.15 0.24 0.98 2.02 0.93 -0.17 0.17 -0.48 -0.07 0.19 -0.25 67.18 59.66 70.43 86.11 82.00 93.45 79.12 74.02 75.13 67.93 65.24 58.55 71.31 69.13 72.83 -0.01 0.14 -0.38 -1.02 -0.97 0.01 0.75 1.65 0.53 -0.66 -0.23 -0.95 -0.61 -0.32 -0.79 mGenTHREADER 25
26 MULTICOM−CLUSTER 67.03 59.41 72.41 90.43 88.99 95.15 75.00 67.35 70.71 72.47 67.26 68.12 75.00 69.81 78.30 0.27 0.38 0.24 0.78 1.12 0.51 -0.07 0.39 0.00 0.37 0.40 0.37 0.33 0.26 0.26 69.02 62.68 75.10 90.74 88.99 95.23 79.41 73.53 76.25 73.99 67.26 68.12 77.87 73.77 83.33 0.53 0.97 0.43 0.67 0.80 0.66 0.85 1.51 0.82 0.42 0.11 0.06 0.42 0.31 0.55 MULTICOM−CLUSTER 26
27 fais−server 67.03 58.74 71.50 87.35 83.23 94.60 75.59 64.22 71.68 70.20 62.29 62.50 74.18 72.54 79.89 0.27 0.28 0.13 0.12 0.08 0.42 0.08 -0.38 0.21 0.10 -0.16 -0.13 0.24 0.54 0.41 67.03 58.74 77.01 88.89 86.42 94.60 77.35 65.78 74.22 73.23 68.18 73.63 76.64 74.18 80.72 -0.06 -0.11 0.76 -0.00 0.15 0.43 0.15 -0.74 0.29 0.28 0.26 0.65 0.23 0.36 0.22 fais−server 27
28 MULTICOM−RANK 66.79 56.44 72.06 88.27 84.98 94.10 74.71 58.73 69.99 73.48 69.61 68.96 72.95 66.12 77.11 0.23 -0.06 0.20 0.32 0.39 0.34 -0.14 -1.72 -0.15 0.49 0.66 0.44 0.11 -0.12 0.15 69.78 61.60 75.31 90.12 88.07 94.86 80.88 69.31 76.82 73.99 69.61 69.52 77.87 73.77 80.98 0.75 0.68 0.47 0.45 0.57 0.52 1.35 0.28 0.97 0.42 0.49 0.21 0.42 0.31 0.25 MULTICOM−RANK 28
29 FUGUE_KM 66.72 60.17 67.57 86.11 82.00 93.45 75.00 66.57 69.37 67.68 63.97 56.41 72.13 69.13 75.08 0.22 0.50 -0.31 -0.14 -0.15 0.24 -0.07 0.19 -0.28 -0.20 0.03 -0.67 0.02 0.19 -0.04 66.72 60.17 67.57 86.11 82.00 93.45 75.00 66.57 69.37 67.68 63.97 56.41 72.13 69.13 75.08 -0.15 0.28 -0.88 -1.02 -0.97 0.01 -0.65 -0.51 -0.99 -0.70 -0.44 -1.18 -0.48 -0.32 -0.50 FUGUE_KM 29
30 FAMSD 66.72 59.10 71.21 86.73 79.32 93.33 74.71 68.82 67.99 70.71 65.32 64.53 74.59 66.67 80.42 0.22 0.34 0.10 -0.01 -0.64 0.22 -0.14 0.74 -0.56 0.16 0.18 0.05 0.29 -0.06 0.46 68.02 60.81 74.69 86.73 82.51 93.60 76.18 68.82 71.32 73.99 69.61 73.27 74.59 71.04 80.81 0.24 0.46 0.36 -0.79 -0.84 0.07 -0.25 0.14 -0.47 0.42 0.49 0.61 -0.09 -0.06 0.23 FAMSD 30
31 HHpred4 66.72 57.95 77.95 88.58 85.29 94.45 78.53 69.31 76.29 72.22 66.50 76.82 80.74 77.73 82.31 0.22 0.16 0.86 0.38 0.45 0.40 0.83 0.86 1.17 0.34 0.31 1.13 0.96 1.07 0.64 66.72 57.95 77.95 88.58 85.29 94.45 78.53 69.31 76.29 72.22 66.50 76.82 80.74 77.73 82.31 -0.15 -0.33 0.92 -0.11 -0.14 0.37 0.55 0.28 0.84 0.10 -0.02 0.99 0.87 0.85 0.42 HHpred4 31
32 3DShot2 66.72 57.77 71.76 85.49 79.11 91.48 75.00 64.80 68.08 72.73 67.17 67.50 73.77 70.77 77.50 0.22 0.14 0.16 -0.28 -0.67 -0.08 -0.07 -0.24 -0.55 0.40 0.39 0.31 0.20 0.36 0.19 66.72 57.77 71.76 85.49 79.11 91.48 75.00 64.80 68.08 72.73 67.17 67.50 73.77 70.77 77.50 -0.15 -0.37 -0.15 -1.24 -1.69 -0.70 -0.65 -1.03 -1.32 0.19 0.09 -0.00 -0.22 -0.10 -0.19 3DShot2 32
33 MUProt 66.72 57.36 72.04 88.58 86.11 93.87 74.71 65.88 70.16 73.74 69.53 68.98 72.95 66.39 77.03 0.22 0.07 0.19 0.38 0.60 0.30 -0.14 0.03 -0.11 0.52 0.65 0.44 0.11 -0.09 0.15 68.64 61.48 73.48 91.05 88.99 94.83 77.94 67.75 75.94 74.75 69.53 68.98 80.74 77.73 85.21 0.42 0.64 0.15 0.79 0.80 0.51 0.35 -0.17 0.74 0.55 0.48 0.16 0.87 0.85 0.80 MUProt 33
34 MULTICOM−REFINE 66.41 58.90 72.39 89.81 88.17 95.00 74.41 66.77 70.52 72.47 67.26 68.29 74.59 69.40 78.65 0.18 0.31 0.23 0.65 0.97 0.49 -0.22 0.24 -0.04 0.37 0.40 0.38 0.29 0.22 0.30 68.25 60.58 75.32 89.81 88.17 95.00 80.00 74.12 76.92 73.99 69.53 68.98 81.15 80.60 86.36 0.30 0.40 0.47 0.33 0.59 0.57 1.05 1.68 1.00 0.42 0.48 0.16 0.93 1.24 0.94 MULTICOM−REFINE 34
35 Pcons_multi 66.41 58.79 71.99 85.19 82.31 93.11 74.12 67.84 69.44 73.23 69.70 65.33 74.18 67.62 80.24 0.18 0.29 0.19 -0.34 -0.09 0.18 -0.29 0.51 -0.26 0.46 0.67 0.12 0.24 0.04 0.45 68.02 59.89 72.69 87.04 82.41 94.30 75.00 67.84 71.05 75.00 69.70 66.01 75.00 73.63 80.24 0.24 0.21 0.01 -0.68 -0.86 0.32 -0.65 -0.15 -0.54 0.59 0.51 -0.16 -0.03 0.29 0.16 Pcons_multi 35
36 FEIG 66.41 58.54 70.96 83.33 77.78 84.24 73.82 69.31 68.23 73.99 65.74 70.26 77.87 72.95 81.91 0.18 0.25 0.07 -0.74 -0.92 -1.25 -0.37 0.86 -0.51 0.55 0.23 0.56 0.65 0.58 0.60 67.64 59.10 71.65 86.11 80.04 88.90 74.41 70.88 69.58 76.01 70.45 71.59 78.69 74.86 82.85 0.12 -0.01 -0.17 -1.02 -1.46 -1.63 -0.85 0.74 -0.93 0.77 0.63 0.43 0.55 0.46 0.49 FEIG 36
37 BAKER−ROBETTA 66.41 58.08 69.30 87.35 83.23 92.50 76.18 63.82 70.46 65.91 60.86 58.69 75.82 72.81 81.46 0.18 0.18 -0.12 0.12 0.08 0.08 0.23 -0.48 -0.05 -0.41 -0.32 -0.47 0.42 0.57 0.56 69.33 63.09 76.72 87.35 83.23 94.13 82.06 72.45 77.15 73.48 69.02 73.51 76.64 73.91 83.02 0.62 1.08 0.71 -0.56 -0.66 0.26 1.75 1.19 1.06 0.32 0.39 0.64 0.23 0.33 0.51 BAKER−ROBETTA 37
38 SAM−T02−server 66.26 57.72 67.52 91.36 90.74 93.75 75.29 67.84 69.76 66.92 61.87 55.71 75.00 73.63 75.26 0.16 0.13 -0.32 0.98 1.44 0.28 0.00 0.51 -0.19 -0.29 -0.21 -0.73 0.33 0.65 -0.02 67.64 59.97 69.95 91.36 90.74 93.75 75.59 70.10 70.72 69.70 65.49 60.09 75.00 73.63 76.06 0.12 0.23 -0.46 0.90 1.24 0.12 -0.45 0.51 -0.63 -0.34 -0.19 -0.79 -0.03 0.29 -0.38 SAM−T02−server 38
39 HHpred2 66.18 55.50 77.47 88.89 84.77 94.61 77.35 70.49 74.48 71.47 64.90 76.03 80.33 79.23 84.04 0.14 -0.21 0.81 0.45 0.36 0.42 0.53 1.15 0.79 0.25 0.13 1.07 0.91 1.23 0.80 66.18 55.50 77.47 88.89 84.77 94.61 77.35 70.49 74.48 71.47 64.90 76.03 80.33 79.23 84.04 -0.31 -1.00 0.84 -0.00 -0.27 0.43 0.15 0.62 0.36 -0.03 -0.28 0.90 0.81 1.05 0.65 HHpred2 39
40 PSI 66.03 57.44 73.23 86.73 79.73 93.88 75.59 64.90 71.50 72.98 67.59 66.42 75.00 71.72 79.97 0.12 0.09 0.33 -0.01 -0.56 0.30 0.08 -0.21 0.17 0.43 0.43 0.22 0.33 0.46 0.42 69.71 61.32 77.69 91.97 90.12 95.50 77.94 66.77 74.08 73.99 68.94 75.18 78.28 76.91 80.50 0.73 0.60 0.88 1.12 1.08 0.75 0.35 -0.46 0.25 0.42 0.38 0.81 0.48 0.73 0.19 PSI 40
41 GeneSilicoMetaServer 65.87 56.67 68.82 86.73 83.03 94.07 74.71 65.88 69.17 68.94 63.72 61.90 69.26 63.25 72.77 0.10 -0.03 -0.17 -0.01 0.04 0.34 -0.14 0.03 -0.32 -0.05 -0.00 -0.18 -0.29 -0.41 -0.25 69.71 61.94 76.42 87.04 83.33 94.17 76.18 66.86 70.86 76.26 71.21 77.41 76.64 73.09 80.20 0.73 0.77 0.66 -0.68 -0.63 0.27 -0.25 -0.43 -0.59 0.82 0.76 1.05 0.23 0.21 0.15 GeneSilicoMetaServer 41
42 COMA−M 65.80 53.22 73.68 90.12 87.04 94.42 74.12 60.98 67.69 71.21 64.48 70.88 78.28 76.37 81.82 0.09 -0.55 0.38 0.71 0.77 0.39 -0.29 -1.17 -0.63 0.22 0.08 0.61 0.69 0.93 0.60 67.41 59.23 74.24 90.43 88.58 95.29 74.12 62.55 67.85 71.97 67.09 71.68 80.33 79.23 84.37 0.06 0.03 0.28 0.56 0.70 0.68 -0.95 -1.68 -1.39 0.06 0.08 0.44 0.81 1.05 0.69 COMA−M 42
43 MUSTER 65.72 55.91 70.48 87.65 84.16 94.25 76.18 65.78 72.15 67.93 63.38 61.89 72.13 65.85 77.20 0.08 -0.14 0.02 0.18 0.24 0.36 0.23 0.00 0.30 -0.17 -0.04 -0.18 0.02 -0.14 0.16 65.72 55.91 70.48 87.96 86.52 94.25 78.82 68.63 74.92 67.93 63.38 61.89 72.13 67.21 78.97 -0.44 -0.88 -0.37 -0.34 0.18 0.30 0.65 0.08 0.47 -0.66 -0.53 -0.60 -0.48 -0.58 -0.00 MUSTER 43
44 3Dpro 65.57 55.70 70.22 86.42 83.33 94.39 74.41 66.28 70.53 70.20 65.49 60.77 67.62 60.79 79.83 0.05 -0.18 -0.01 -0.08 0.09 0.39 -0.22 0.12 -0.03 0.10 0.20 -0.28 -0.47 -0.66 0.41 65.57 55.70 70.22 86.42 83.33 94.39 77.35 66.37 75.59 70.20 65.49 60.77 77.87 73.77 82.92 -0.49 -0.94 -0.42 -0.90 -0.63 0.35 0.15 -0.57 0.65 -0.26 -0.19 -0.72 0.42 0.31 0.50 3Dpro 44
45 COMA 64.19 54.52 70.70 87.35 83.44 94.29 72.06 56.47 63.78 70.71 64.98 66.26 75.41 73.50 79.85 -0.15 -0.35 0.04 0.12 0.11 0.37 -0.82 -2.27 -1.44 0.16 0.14 0.20 0.38 0.64 0.41 66.18 57.28 74.24 90.43 88.58 95.29 72.65 60.00 67.85 72.47 69.61 73.15 77.46 73.50 84.37 -0.31 -0.51 0.28 0.56 0.70 0.68 -1.45 -2.42 -1.39 0.15 0.49 0.60 0.36 0.27 0.69 COMA 45
46 FFASstandard 64.11 54.70 76.66 83.64 80.97 93.36 77.94 65.20 74.05 73.23 66.83 73.43 79.51 75.41 80.68 -0.16 -0.33 0.72 -0.67 -0.34 0.22 0.68 -0.14 0.70 0.46 0.35 0.84 0.82 0.84 0.49 70.09 61.09 77.57 90.74 88.07 93.61 79.12 69.51 76.45 77.02 69.11 75.15 79.92 75.41 80.97 0.84 0.54 0.86 0.67 0.57 0.07 0.75 0.34 0.88 0.95 0.41 0.81 0.74 0.53 0.25 FFASstandard 46
47 GS−KudlatyPred 63.73 55.04 69.80 86.73 81.79 94.22 75.29 69.61 71.52 66.92 60.02 58.53 75.00 72.27 79.38 -0.22 -0.28 -0.06 -0.01 -0.19 0.36 0.00 0.94 0.17 -0.29 -0.42 -0.48 0.33 0.51 0.37 63.73 55.04 69.80 86.73 81.79 94.22 75.29 69.61 71.52 66.92 60.02 58.53 75.00 72.27 79.38 -1.03 -1.12 -0.49 -0.79 -1.02 0.29 -0.55 0.37 -0.42 -0.84 -1.09 -0.95 -0.03 0.10 0.05 GS−KudlatyPred 47
48 FALCON_CONSENSUS 63.73 54.73 73.16 86.11 84.26 93.64 80.88 72.25 76.92 69.44 64.06 65.82 73.77 67.49 80.11 -0.22 -0.32 0.32 -0.14 0.26 0.27 1.42 1.58 1.30 0.01 0.04 0.16 0.20 0.02 0.43 68.56 60.02 76.34 90.43 87.55 94.49 80.88 75.59 77.91 72.22 66.67 74.40 77.46 72.54 81.17 0.39 0.24 0.65 0.56 0.44 0.39 1.35 2.10 1.26 0.10 0.01 0.73 0.36 0.14 0.28 FALCON_CONSENSUS 48
49 FALCON 63.73 54.73 73.16 86.11 84.26 93.64 80.88 72.25 76.92 69.44 64.06 65.82 73.77 67.49 80.11 -0.22 -0.32 0.32 -0.14 0.26 0.27 1.42 1.58 1.30 0.01 0.04 0.16 0.20 0.02 0.43 68.56 60.02 76.34 90.43 87.55 94.49 80.88 75.59 77.91 72.22 66.67 74.40 77.46 72.54 81.17 0.39 0.24 0.65 0.56 0.44 0.39 1.35 2.10 1.26 0.10 0.01 0.73 0.36 0.14 0.28 FALCON 49
50 nFOLD3 63.50 55.78 73.75 84.26 79.11 90.87 75.00 69.12 69.83 73.74 71.21 72.59 72.13 66.94 77.51 -0.25 -0.16 0.39 -0.54 -0.67 -0.18 -0.07 0.82 -0.18 0.52 0.84 0.76 0.02 -0.03 0.19 66.79 59.43 73.75 91.97 91.36 94.61 78.53 69.12 75.85 73.74 71.21 72.59 73.77 72.68 77.51 -0.13 0.08 0.20 1.12 1.40 0.43 0.55 0.23 0.72 0.37 0.76 0.54 -0.22 0.16 -0.19 nFOLD3 50
51 MUFOLD−Server 60.12 52.20 62.11 86.11 80.76 92.19 65.59 59.31 62.84 59.09 54.21 46.25 70.08 59.97 73.66 -0.75 -0.70 -0.93 -0.14 -0.37 0.03 -2.46 -1.58 -1.64 -1.22 -1.07 -1.56 -0.20 -0.75 -0.17 60.20 52.43 62.11 87.04 82.31 92.41 66.18 61.67 62.97 59.09 54.21 46.25 70.08 59.97 73.66 -2.07 -1.84 -1.83 -0.68 -0.89 -0.36 -3.65 -1.94 -2.67 -2.22 -2.04 -2.26 -0.80 -1.57 -0.68 MUFOLD−Server 51
52 3D−JIGSAW_AEP 60.12 50.82 57.08 87.96 83.03 88.23 75.59 63.43 67.44 50.00 43.10 35.60 65.57 54.65 67.35 -0.75 -0.91 -1.49 0.25 0.04 -0.60 0.08 -0.57 -0.68 -2.29 -2.32 -2.51 -0.69 -1.29 -0.76 60.12 50.87 57.08 88.27 83.03 93.97 76.18 64.80 67.46 50.51 44.44 35.62 66.39 55.19 67.37 -2.09 -2.27 -2.70 -0.23 -0.71 0.20 -0.25 -1.03 -1.49 -3.74 -3.65 -3.39 -1.38 -2.22 -1.49 3D−JIGSAW_AEP 52
53 Distill 59.97 50.82 60.73 79.32 74.59 76.50 69.12 63.04 63.56 66.16 61.45 57.56 69.67 66.67 69.53 -0.77 -0.91 -1.08 -1.59 -1.50 -2.49 -1.56 -0.67 -1.49 -0.38 -0.26 -0.57 -0.25 -0.06 -0.56 59.97 50.82 60.73 79.94 76.85 76.73 69.12 64.51 63.56 67.93 64.06 58.44 70.08 68.72 70.83 -2.13 -2.28 -2.07 -3.27 -2.27 -6.03 -2.65 -1.11 -2.51 -0.66 -0.42 -0.96 -0.80 -0.38 -1.05 Distill 53
54 MUFOLD−MD 59.66 51.33 60.82 85.80 81.07 91.88 66.18 59.51 62.65 58.84 51.43 45.98 67.62 54.78 67.66 -0.82 -0.84 -1.07 -0.21 -0.32 -0.02 -2.31 -1.53 -1.68 -1.25 -1.38 -1.59 -0.47 -1.28 -0.74 60.20 52.07 62.17 87.35 82.61 93.35 66.47 59.51 63.07 59.09 54.21 46.23 70.08 59.97 73.67 -2.07 -1.94 -1.82 -0.56 -0.81 -0.02 -3.55 -2.56 -2.64 -2.22 -2.04 -2.26 -0.80 -1.57 -0.68 MUFOLD−MD 54
55 BioSerf 59.20 50.08 71.40 87.04 82.72 94.43 76.18 63.43 74.03 72.22 63.97 66.37 36.07 26.78 61.69 -0.89 -1.02 0.12 0.05 -0.02 0.39 0.23 -0.57 0.70 0.34 0.03 0.21 -3.91 -4.15 -1.30 59.20 50.08 71.40 87.04 82.72 94.43 76.18 63.43 74.03 72.22 63.97 66.37 36.07 26.78 61.69 -2.36 -2.48 -0.21 -0.68 -0.78 0.37 -0.25 -1.43 0.24 0.10 -0.44 -0.12 -6.12 -6.08 -2.22 BioSerf 55
56 Pushchino 58.44 52.86 57.82 88.58 84.67 90.46 76.77 65.20 72.68 51.77 43.52 40.14 61.07 59.97 59.34 -1.00 -0.60 -1.41 0.38 0.34 -0.25 0.38 -0.14 0.41 -2.08 -2.27 -2.10 -1.18 -0.75 -1.52 58.44 52.86 57.82 88.58 84.67 90.46 76.77 65.20 72.68 51.77 43.52 40.14 61.07 59.97 59.34 -2.58 -1.72 -2.57 -0.11 -0.29 -1.07 -0.05 -0.91 -0.11 -3.51 -3.80 -2.91 -2.21 -1.57 -2.52 Pushchino 56
57 3D−JIGSAW_V3 57.44 49.97 50.61 87.65 81.48 93.68 74.41 66.18 66.18 46.21 39.14 30.44 56.56 51.37 35.80 -1.15 -1.04 -2.23 0.18 -0.24 0.27 -0.22 0.10 -0.94 -2.74 -2.76 -2.96 -1.67 -1.63 -3.73 57.44 50.36 50.69 87.65 82.10 93.69 74.71 66.47 66.18 46.97 40.24 30.84 56.97 51.37 35.82 -2.88 -2.41 -3.81 -0.45 -0.94 0.10 -0.75 -0.54 -1.82 -4.36 -4.34 -3.90 -2.85 -2.74 -5.53 3D−JIGSAW_V3 57
58 panther_server 42.95 34.56 42.25 67.59 60.80 70.06 65.88 57.84 62.49 43.43 37.54 34.50 33.61 33.33 22.66 -3.28 -3.36 -3.17 -4.10 -4.01 -3.53 -2.38 -1.94 -1.71 -3.07 -2.94 -2.60 -4.17 -3.48 -4.97 61.50 54.42 58.87 85.49 80.56 85.78 74.41 69.90 66.15 60.61 57.41 49.12 60.66 54.92 59.83 -1.68 -1.29 -2.39 -1.24 -1.33 -2.76 -0.85 0.45 -1.83 -1.95 -1.52 -1.95 -2.27 -2.26 -2.46 panther_server 58
59 FOLDpro 26.15 20.83 25.46 63.58 59.26 56.88 56.47 50.00 47.30 15.15 13.64 15.60 24.59 21.86 17.88 -5.76 -5.43 -5.06 -4.95 -4.29 -5.65 -4.77 -3.86 -4.88 -6.42 -5.63 -4.27 -5.16 -4.66 -5.41 65.57 55.70 70.22 86.42 83.33 94.39 77.35 66.28 74.78 70.20 65.49 60.77 73.36 67.90 79.83 -0.49 -0.94 -0.42 -0.90 -0.63 0.35 0.15 -0.60 0.44 -0.26 -0.19 -0.72 -0.29 -0.49 0.11 FOLDpro 59
60 rehtnap 23.85 18.30 14.96 34.88 28.91 35.30 54.71 47.45 40.36 28.54 23.65 16.60 17.21 15.57 6.22 -6.10 -5.81 -6.25 -11.08 -9.81 -9.13 -5.22 -4.48 -6.33 -4.84 -4.50 -4.18 -5.96 -5.30 -6.51 32.74 27.73 19.95 58.33 55.25 50.80 57.65 49.61 43.66 31.82 25.59 18.29 17.21 16.67 6.22 -10.14 -8.61 -9.15 -11.17 -7.72 -15.40 -6.55 -5.44 -7.75 -7.04 -6.76 -5.23 -9.07 -7.46 -9.33 rehtnap 60
61 Frankenstein 16.49 14.54 15.81 22.22 16.87 21.50 24.12 21.37 26.80 34.09 27.36 29.74 25.00 20.90 30.82 -7.19 -6.38 -6.15 -13.78 -12.00 -11.35 -12.98 -10.86 -9.16 -4.18 -4.08 -3.02 -5.11 -4.75 -4.20 43.71 33.05 53.73 67.59 61.63 72.19 65.59 55.20 64.64 63.38 54.46 58.90 30.33 29.78 32.61 -6.92 -7.15 -3.28 -7.78 -6.11 -7.67 -3.85 -3.82 -2.23 -1.46 -2.00 -0.91 -7.02 -5.67 -5.94 Frankenstein 61
62 RBO−Proteus 9.05 8.18 20.81 20.06 17.59 31.31 31.47 28.73 45.34 16.16 14.90 15.24 42.62 40.98 39.55 -8.28 -7.34 -5.59 -14.24 -11.87 -9.77 -11.11 -9.06 -5.29 -6.30 -5.48 -4.30 -3.19 -2.70 -3.38 9.59 8.74 20.92 20.68 17.80 32.74 33.82 29.71 45.69 17.42 14.90 15.57 44.67 41.26 39.79 -16.95 -13.82 -8.98 -24.92 -17.17 -21.93 -14.64 -11.22 -7.21 -9.59 -8.52 -5.52 -4.78 -4.11 -5.02 RBO−Proteus 62
63 RANDOM 7.02 6.04 7.02 21.67 18.72 21.67 22.67 17.78 22.67 18.41 15.66 18.41 27.44 23.69 27.44 -8.58 -7.66 -7.15 -13.90 -11.67 -11.32 -13.35 -11.73 -10.03 -6.04 -5.40 -4.02 -4.85 -4.47 -4.52 7.02 6.04 7.02 21.67 18.72 21.67 22.67 17.78 22.67 18.41 15.66 18.41 27.44 23.69 27.44 -17.71 -14.56 -11.40 -24.56 -16.94 -25.93 -18.43 -14.68 -13.27 -9.41 -8.39 -5.22 -7.47 -6.50 -6.61 RANDOM 63
64 mariner1 6.52 4.68 9.37 18.21 15.12 27.24 19.71 13.92 19.26 14.65 12.21 16.38 19.26 16.39 20.03 -8.66 -7.87 -6.88 -14.64 -12.32 -10.42 -14.10 -12.68 -10.74 -6.48 -5.79 -4.20 -5.74 -5.22 -5.21 7.90 6.62 16.04 26.54 22.84 34.70 23.53 20.78 24.88 20.45 17.93 20.43 31.56 26.91 40.13 -17.45 -14.40 -9.83 -22.78 -15.90 -21.22 -18.14 -13.81 -12.69 -9.05 -8.02 -5.00 -6.83 -6.06 -4.98 mariner1 64
65 schenk−torda−server 6.44 5.91 10.30 16.98 15.84 20.38 17.65 15.10 21.01 15.40 13.72 16.81 27.05 24.32 31.16 -8.67 -7.68 -6.78 -14.90 -12.19 -11.53 -14.62 -12.39 -10.37 -6.39 -5.62 -4.17 -4.89 -4.40 -4.17 6.44 5.91 10.91 20.68 19.24 21.02 17.94 15.10 23.19 15.40 13.89 16.81 28.28 24.32 34.60 -17.88 -14.59 -10.72 -24.92 -16.81 -26.17 -20.04 -15.46 -13.13 -9.95 -8.68 -5.39 -7.34 -6.42 -5.69 schenk−torda−server 65
66 OLGAFS 6.44 5.65 1.91 13.58 10.49 12.52 18.82 17.06 24.32 12.12 10.27 -4.64 22.95 19.54 25.12 -8.67 -7.72 -7.72 -15.62 -13.17 -12.79 -14.32 -11.91 -9.68 -6.78 -6.00 -6.06 -5.33 -4.89 -4.73 6.52 5.83 2.03 14.51 11.93 12.52 20.00 17.35 24.60 12.63 10.44 -4.63 23.36 19.54 26.08 -17.86 -14.61 -12.26 -27.17 -18.65 -29.24 -19.34 -14.81 -12.76 -10.44 -9.25 -7.66 -8.11 -7.07 -6.78 OLGAFS 66
67 ACOMPMOD 0.00 0.00 -19.63 0.00 0.00 -4.16 0.00 0.00 -8.91 0.00 0.00 -12.50 0.00 0.00 -3.82 -9.62 -8.57 -10.15 -18.52 -15.08 -15.48 -19.10 -16.08 -16.62 -8.22 -7.16 -6.75 -7.83 -6.90 -7.45 20.02 15.98 18.10 22.84 18.11 21.40 25.29 20.78 26.57 39.39 34.51 38.61 29.92 27.05 34.08 -13.89 -11.83 -9.47 -24.13 -17.09 -26.03 -17.54 -13.81 -12.24 -5.70 -5.29 -3.07 -7.08 -6.04 -5.76 ACOMPMOD 67
68 BHAGEERATH                                                                                           -8.58 -7.66 -7.15 -13.90 -11.67 -11.32 -13.35 -11.73 -10.03 -6.04 -5.40 -4.02 -4.85 -4.47 -4.52                                                                                           -17.71 -14.56 -11.40 -24.56 -16.94 -25.93 -18.43 -14.68 -13.27 -9.41 -8.39 -5.22 -7.47 -6.50 -6.61 BHAGEERATH 68
69 Pcons_dot_net                                                                                           -8.58 -7.66 -7.15 -13.90 -11.67 -11.32 -13.35 -11.73 -10.03 -6.04 -5.40 -4.02 -4.85 -4.47 -4.52                                                                                           -17.71 -14.56 -11.40 -24.56 -16.94 -25.93 -18.43 -14.68 -13.27 -9.41 -8.39 -5.22 -7.47 -6.50 -6.61 Pcons_dot_net 69
70 Pcons_local                                                                                           -8.58 -7.66 -7.15 -13.90 -11.67 -11.32 -13.35 -11.73 -10.03 -6.04 -5.40 -4.02 -4.85 -4.47 -4.52                                                                                           -17.71 -14.56 -11.40 -24.56 -16.94 -25.93 -18.43 -14.68 -13.27 -9.41 -8.39 -5.22 -7.47 -6.50 -6.61 Pcons_local 70
71 YASARA                                                                                           -8.58 -7.66 -7.15 -13.90 -11.67 -11.32 -13.35 -11.73 -10.03 -6.04 -5.40 -4.02 -4.85 -4.47 -4.52                                                                                           -17.71 -14.56 -11.40 -24.56 -16.94 -25.93 -18.43 -14.68 -13.27 -9.41 -8.39 -5.22 -7.47 -6.50 -6.61 YASARA 71
72 huber−torda−server                                                                                           -8.58 -7.66 -7.15 -13.90 -11.67 -11.32 -13.35 -11.73 -10.03 -6.04 -5.40 -4.02 -4.85 -4.47 -4.52                                                                                           -17.71 -14.56 -11.40 -24.56 -16.94 -25.93 -18.43 -14.68 -13.27 -9.41 -8.39 -5.22 -7.47 -6.50 -6.61 huber−torda−server 72
73 mahmood−torda−server                                                                                           -8.58 -7.66 -7.15 -13.90 -11.67 -11.32 -13.35 -11.73 -10.03 -6.04 -5.40 -4.02 -4.85 -4.47 -4.52                                                                                           -17.71 -14.56 -11.40 -24.56 -16.94 -25.93 -18.43 -14.68 -13.27 -9.41 -8.39 -5.22 -7.47 -6.50 -6.61 mahmood−torda−server 73
74 test_http_server_01                                                                                           -8.58 -7.66 -7.15 -13.90 -11.67 -11.32 -13.35 -11.73 -10.03 -6.04 -5.40 -4.02 -4.85 -4.47 -4.52                                                                                           -17.71 -14.56 -11.40 -24.56 -16.94 -25.93 -18.43 -14.68 -13.27 -9.41 -8.39 -5.22 -7.47 -6.50 -6.61 test_http_server_01 74