T0414

conserved protein of unknown function CA_C3497 from Clostridium acetobutylicum ATCC 824

Target sequence:

>T0414 CA_C3497, conserved protein of unknown function, Clostridium acetobutylicum ATCC 824, 140 residues
SNAMKPDIYENNREGILCVYKNEKWLVCIKNWKPDNDIEGIAHLEIHHSTDEQFILSAGKAILITAEKENDKFNIELTLMEKGKVYNVPAECWFYSITQKDTKMMYVQDSNCSMDNSDFCDLSKEEIEYIQTNARKLFEK

Structure:

Method: X-ray, res=1.53Å, R/Rfree=0.17/0.18

Determined by: MCSG

PDB ID: 3d0j

3d0j_A cartoon
Cartoon diagram of 414: 3d0j chain A

PyMOL of 3d0j

Domains: PyMOL of domains

Single domain protein, but N-terminal segment 0-5 (pdb numbering) interacts with a symmetry mate, but does not form a swap. This region can be removed for evaluation.

414 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Double-stranded β-helix fold.

CASP category:

Whole chain: Comparative modeling:hard.

Domain (with N-terminal segment pdb 0-5 removed): Comparative modeling:hard.

Closest templates:

2pa7.

Target sequence - PDB file inconsistencies:

T0414 3d0j.pdb T0414.pdb PyMOL PyMOL of domains

T0414    1 SNAMKPDIYENNREGILCVYKNEKWLVCIKNWKPDNDIEGIAHLEIHHSTDEQFILSAGKAILITAEKENDKFNIELTLMEKGKVYNVPAECWFYSITQKDTKMMYVQDSNCSMDNSDFCDLSKEEIEYIQTNARKLFEK 140
           ~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3d0jA    0 --AMKPDIYENNREGILCVYKNEKWLVCIKNWKPDNDIEGIAHLEIHHSTDEQFILSAGKAILITAEKENDKFNIELTLMEKGKVYNVPAECWFYSITQKDTKMMYVQDSNCSMDNSDFCDLSKEEIEYIQTNARKLFEK 137

Residue change log: change 1, 77, 101, 102, 111, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, N-terminal segment (target 1-8, pdb 0-6) interacts with a symmetry mate, but does not form a swap. This segment can be removed for domain-based evaluation, resulting this domain definition:

1st domain: target 9-140 ; pdb 6-137

Sequence classification:

RmlC-like cupins superfamily in SCOP.

Comments:

This protein is a homolog of T0503.

Server predictions:

T0414:pdb 0-137:seq 3-140:CM_hard; alignment

distribution of
first scores
First models for T0414: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

414_1:pdb 6-137:seq 9-140:CM_hard; alignment

distribution of
first scores
First models for T0414_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

#	GROUP ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	↓ GROUP	#
		T0414			414_1			T0414			414_1			T0414			414_1			T0414			414_1
		First score						First Z-score						Best score						Best Z-score
1	Pcons_multi	59.96	51.51	63.33	62.12	53.28	63.48	1.85	1.73	1.51	1.81	1.64	1.51	59.96	54.47	63.33	62.12	56.38	63.48	1.43	1.59	1.19	1.39	1.57	1.20	Pcons_multi	1
2	Phyre_de_novo	58.88	49.34	67.31	61.55	51.58	67.37	1.72	1.42	1.88	1.74	1.41	1.88	58.88	49.58	68.71	61.55	51.64	68.77	1.31	0.96	1.74	1.33	0.97	1.74	Phyre_de_novo	2
3	LEE−SERVER	57.97	52.78	64.26	60.42	54.99	64.49	1.60	1.91	1.59	1.60	1.87	1.61	57.97	52.78	64.65	60.42	54.99	64.85	1.20	1.37	1.33	1.20	1.39	1.34	LEE−SERVER	3
4	Poing	56.34	48.73	67.47	58.52	50.57	67.66	1.40	1.34	1.90	1.37	1.28	1.91	56.34	48.73	67.47	58.52	51.58	67.66	1.01	0.85	1.61	0.98	0.96	1.63	Poing	4
5	Phragment	56.34	46.20	67.83	58.71	49.75	68.20	1.40	0.98	1.93	1.39	1.17	1.96	56.34	48.67	67.83	58.71	50.63	68.20	1.01	0.84	1.65	1.01	0.84	1.68	Phragment	5
6	Phyre2	56.16	48.43	67.36	58.52	50.44	67.38	1.37	1.30	1.89	1.37	1.26	1.89	56.16	50.48	67.36	58.52	51.20	67.38	0.98	1.07	1.60	0.98	0.91	1.60	Phyre2	6
7	SAM−T06−server	54.89	46.92	56.73	57.01	48.67	57.04	1.21	1.09	0.89	1.19	1.03	0.90	54.89	46.92	56.73	57.01	48.67	57.04	0.83	0.61	0.53	0.81	0.59	0.54	SAM−T06−server	7
8	Frankenstein	53.80	45.83	53.14	56.25	47.92	53.37	1.08	0.93	0.55	1.09	0.93	0.55	53.80	49.94	54.53	56.25	52.02	54.79	0.71	1.00	0.31	0.73	1.01	0.31	Frankenstein	8
9	Zhang−Server	53.08	41.85	60.76	55.30	43.56	61.31	0.98	0.37	1.27	0.98	0.35	1.31	56.34	47.52	65.06	58.71	49.49	65.46	1.01	0.69	1.37	1.01	0.69	1.40	Zhang−Server	9
10	HHpred4	52.90	45.29	48.29	55.11	47.16	48.68	0.96	0.86	0.10	0.95	0.82	0.11	52.90	45.29	48.29	55.11	47.16	48.68	0.60	0.40	-0.32	0.60	0.40	-0.32	HHpred4	10
11	3DShot2	52.54	45.17	55.26	54.73	47.03	55.42	0.92	0.84	0.75	0.91	0.81	0.75	52.54	45.17	55.26	54.73	47.03	55.42	0.56	0.39	0.38	0.55	0.38	0.37	3DShot2	11
12	mGenTHREADER	52.17	43.72	49.00	54.36	50.57	49.90	0.87	0.64	0.16	0.86	1.28	0.22	52.17	43.72	49.00	54.36	50.57	49.90	0.51	0.20	-0.25	0.51	0.83	-0.20	mGenTHREADER	12
13	keasar−server	51.81	47.34	54.90	54.17	49.49	55.23	0.82	1.14	0.72	0.84	1.13	0.73	52.54	47.34	54.90	54.73	49.56	55.23	0.56	0.67	0.34	0.55	0.70	0.35	keasar−server	13
14	MULTICOM−CMFR	51.09	45.53	53.18	52.84	47.03	53.37	0.73	0.89	0.56	0.68	0.81	0.55	51.09	45.53	53.18	52.84	47.03	53.37	0.39	0.43	0.17	0.34	0.38	0.16	MULTICOM−CMFR	14
15	METATASSER	50.91	43.90	56.51	53.22	45.90	56.72	0.71	0.66	0.87	0.72	0.66	0.87	56.34	47.52	62.69	58.33	49.12	62.88	1.01	0.69	1.13	0.96	0.65	1.14	METATASSER	15
16	BAKER−ROBETTA	50.00	44.69	59.84	52.27	46.59	60.22	0.59	0.77	1.18	0.61	0.75	1.20	50.18	46.26	61.33	52.27	47.92	61.71	0.28	0.53	0.99	0.27	0.49	1.02	BAKER−ROBETTA	16
17	MUProt	49.64	46.26	45.05	51.52	47.60	45.42	0.55	0.99	-0.21	0.52	0.88	-0.20	52.90	47.70	58.17	55.30	49.87	58.31	0.60	0.71	0.67	0.62	0.74	0.67	MUProt	17
18	MULTICOM−RANK	49.64	45.77	44.83	51.70	47.66	45.19	0.55	0.92	-0.23	0.54	0.89	-0.23	53.08	47.77	58.17	55.49	49.94	58.28	0.62	0.72	0.67	0.64	0.75	0.67	MULTICOM−RANK	18
19	MULTICOM−CLUSTER	49.64	45.77	44.83	51.70	47.66	45.19	0.55	0.92	-0.23	0.54	0.89	-0.23	49.64	45.77	48.27	51.70	47.66	48.37	0.21	0.46	-0.33	0.21	0.46	-0.35	MULTICOM−CLUSTER	19
20	MULTICOM−REFINE	49.46	44.14	44.90	51.52	47.35	45.26	0.53	0.70	-0.22	0.52	0.85	-0.22	53.08	47.52	57.66	55.30	49.49	57.79	0.62	0.69	0.62	0.62	0.69	0.61	MULTICOM−REFINE	20
21	circle	49.09	43.90	62.58	51.33	45.90	62.58	0.48	0.66	1.44	0.49	0.66	1.43	49.09	45.35	62.58	51.52	46.59	62.58	0.15	0.41	1.12	0.19	0.33	1.11	circle	21
22	fais−server	49.09	38.71	47.43	51.33	40.47	47.38	0.48	-0.07	0.02	0.49	-0.07	-0.02	49.09	41.06	47.43	51.33	42.93	47.38	0.15	-0.15	-0.41	0.16	-0.14	-0.46	fais−server	22
23	FAMSD	48.91	42.75	60.23	50.95	44.26	60.23	0.46	0.50	1.22	0.45	0.44	1.21	48.91	43.42	60.23	50.95	45.39	60.23	0.13	0.16	0.88	0.12	0.17	0.87	FAMSD	23
24	SAM−T08−server	48.73	41.73	62.91	50.95	43.62	63.05	0.43	0.36	1.47	0.45	0.35	1.47	51.45	44.20	62.91	53.79	46.21	63.05	0.43	0.26	1.15	0.44	0.28	1.16	SAM−T08−server	24
25	MUSTER	48.37	42.81	57.85	50.38	43.31	57.95	0.39	0.51	0.99	0.38	0.31	0.99	52.17	48.19	60.06	54.17	50.00	60.06	0.51	0.78	0.86	0.49	0.76	0.85	MUSTER	25
26	FFASsuboptimal	47.28	39.31	51.36	49.43	41.10	51.48	0.25	0.02	0.39	0.26	0.02	0.37	47.28	41.12	51.36	49.43	42.99	51.48	-0.07	-0.14	-0.01	-0.05	-0.13	-0.03	FFASsuboptimal	26
27	FOLDpro	47.10	40.82	47.93	49.24	42.68	48.24	0.23	0.23	0.06	0.24	0.23	0.06	47.10	41.18	48.97	49.24	42.68	48.98	-0.09	-0.13	-0.26	-0.07	-0.17	-0.29	FOLDpro	27
28	FALCON_CONSENSUS	46.92	42.69	44.88	49.05	44.63	44.95	0.21	0.49	-0.22	0.22	0.49	-0.25	52.72	48.01	58.70	54.92	50.00	58.78	0.58	0.75	0.73	0.57	0.76	0.72	FALCON_CONSENSUS	28
29	FALCON	46.92	42.69	44.88	49.05	44.63	44.95	0.21	0.49	-0.22	0.22	0.49	-0.25	52.72	48.01	58.70	54.92	50.00	58.78	0.58	0.75	0.73	0.57	0.76	0.72	FALCON	29
30	3Dpro	46.92	40.16	48.47	48.48	41.35	48.34	0.21	0.14	0.11	0.15	0.05	0.07	47.65	44.87	49.05	49.81	46.91	49.08	-0.02	0.35	-0.25	-0.01	0.37	-0.28	3Dpro	30
31	COMA	46.74	40.58	50.05	48.86	42.42	50.23	0.18	0.20	0.26	0.19	0.19	0.25	46.74	40.58	50.05	48.86	42.42	50.23	-0.13	-0.21	-0.15	-0.12	-0.20	-0.16	COMA	31
32	PS2−server	46.01	40.46	54.03	48.11	42.30	53.94	0.09	0.18	0.64	0.10	0.18	0.61	53.08	44.99	57.29	55.11	47.41	57.71	0.62	0.36	0.58	0.60	0.43	0.61	PS2−server	32
33	3D−JIGSAW_AEP	45.47	39.67	48.41	47.54	41.48	48.63	0.02	0.07	0.11	0.03	0.07	0.10	45.47	39.67	48.41	47.54	41.48	48.63	-0.28	-0.33	-0.31	-0.27	-0.32	-0.33	3D−JIGSAW_AEP	33
34	PSI	45.29	39.98	51.13	47.35	41.79	51.23	-0.00	0.11	0.36	0.01	0.11	0.35	56.52	50.60	58.90	59.09	52.90	59.16	1.03	1.09	0.75	1.05	1.13	0.76	PSI	34
35	HHpred2	44.38	37.14	50.33	46.59	39.02	50.43	-0.12	-0.29	0.29	-0.08	-0.26	0.27	44.38	37.14	50.33	46.59	39.02	50.43	-0.41	-0.65	-0.12	-0.38	-0.64	-0.14	HHpred2	35
36	forecast	44.20	39.49	52.98	46.21	41.29	52.93	-0.14	0.04	0.54	-0.13	0.04	0.51	44.20	39.49	52.98	46.21	41.29	52.93	-0.43	-0.35	0.15	-0.42	-0.35	0.12	forecast	36
37	mariner1	44.20	34.60	40.06	46.21	36.17	40.35	-0.14	-0.64	-0.67	-0.13	-0.64	-0.69	50.91	44.75	61.05	53.22	46.78	61.20	0.36	0.33	0.96	0.38	0.35	0.97	mariner1	37
38	3D−JIGSAW_V3	43.48	39.61	46.58	45.45	41.41	46.83	-0.23	0.06	-0.06	-0.22	0.06	-0.07	43.84	39.98	46.79	45.83	41.79	47.03	-0.47	-0.29	-0.48	-0.46	-0.28	-0.49	3D−JIGSAW_V3	38
39	GeneSilicoMetaServer	43.48	34.18	33.94	45.45	35.73	35.13	-0.23	-0.70	-1.25	-0.22	-0.70	-1.18	43.48	35.02	33.94	45.45	36.62	35.13	-0.51	-0.93	-1.77	-0.50	-0.94	-1.71	GeneSilicoMetaServer	39
40	COMA−M	43.12	38.89	40.10	45.08	40.66	40.11	-0.27	-0.04	-0.67	-0.27	-0.04	-0.71	44.75	41.37	44.39	46.59	43.06	44.48	-0.36	-0.11	-0.72	-0.38	-0.12	-0.75	COMA−M	40
41	FEIG	42.94	37.62	51.52	44.89	38.32	51.61	-0.30	-0.22	0.40	-0.29	-0.35	0.38	49.27	45.53	51.52	51.33	47.60	51.61	0.17	0.43	0.00	0.16	0.45	-0.02	FEIG	41
42	FUGUE_KM	41.85	35.69	42.50	43.75	37.31	42.68	-0.44	-0.49	-0.45	-0.43	-0.49	-0.46	41.85	35.69	42.50	43.75	37.31	42.68	-0.71	-0.84	-0.91	-0.70	-0.85	-0.94	FUGUE_KM	42
43	nFOLD3	41.30	33.27	32.68	43.18	34.78	33.86	-0.50	-0.83	-1.37	-0.50	-0.82	-1.30	53.26	45.41	54.00	55.30	47.10	54.29	0.64	0.42	0.25	0.62	0.39	0.25	nFOLD3	43
44	pro−sp3−TASSER	41.12	34.54	39.85	42.99	36.49	39.81	-0.53	-0.65	-0.69	-0.52	-0.60	-0.74	54.35	47.34	55.11	56.44	48.48	55.59	0.77	0.67	0.36	0.75	0.57	0.39	pro−sp3−TASSER	44
45	HHpred5	40.76	35.33	43.01	42.61	36.93	43.19	-0.57	-0.54	-0.40	-0.57	-0.54	-0.42	40.76	35.33	43.01	42.61	36.93	43.19	-0.84	-0.89	-0.86	-0.83	-0.90	-0.89	HHpred5	45
46	rehtnap	40.76	34.24	35.13	42.61	35.80	36.32	-0.57	-0.69	-1.14	-0.57	-0.69	-1.07	41.12	35.20	36.75	42.99	36.81	37.94	-0.79	-0.90	-1.49	-0.79	-0.92	-1.43	rehtnap	46
47	FFASstandard	40.40	35.81	40.20	42.23	37.44	41.41	-0.62	-0.47	-0.66	-0.61	-0.47	-0.59	46.74	44.44	42.89	48.86	46.47	43.72	-0.13	0.29	-0.87	-0.12	0.31	-0.83	FFASstandard	47
48	GS−MetaServer2	39.85	37.44	30.31	41.67	39.14	31.48	-0.69	-0.24	-1.59	-0.68	-0.24	-1.53	42.39	37.44	35.17	44.32	39.14	36.35	-0.64	-0.61	-1.65	-0.63	-0.62	-1.59	GS−MetaServer2	48
49	panther_server	39.31	36.17	32.43	40.91	38.13	32.82	-0.76	-0.42	-1.39	-0.77	-0.38	-1.40	47.10	40.94	49.03	48.48	42.55	49.24	-0.09	-0.16	-0.25	-0.16	-0.19	-0.26	panther_server	49
50	FFASflextemplate	39.31	34.00	37.30	41.10	35.54	38.49	-0.76	-0.73	-0.93	-0.75	-0.72	-0.86	39.31	34.00	38.13	41.10	35.54	39.33	-1.01	-1.06	-1.35	-1.00	-1.08	-1.28	FFASflextemplate	50
51	RAPTOR	38.23	33.03	40.84	39.96	34.53	40.84	-0.89	-0.86	-0.60	-0.89	-0.86	-0.64	51.27	45.71	59.84	53.60	47.79	60.13	0.41	0.46	0.84	0.42	0.48	0.86	RAPTOR	51
52	ACOMPMOD	37.68	31.64	37.41	39.39	33.08	37.64	-0.96	-1.06	-0.92	-0.96	-1.05	-0.94	47.83	42.87	42.21	50.00	44.82	42.40	-0.00	0.09	-0.94	0.01	0.10	-0.97	ACOMPMOD	52
53	CpHModels	37.50	31.46	33.20	39.20	32.89	34.38	-0.98	-1.08	-1.32	-0.98	-1.08	-1.25	37.50	31.46	33.20	39.20	32.89	34.38	-1.22	-1.39	-1.85	-1.22	-1.42	-1.79	CpHModels	53
54	GS−KudlatyPred	35.87	30.92	32.97	37.50	32.32	34.15	-1.19	-1.16	-1.34	-1.19	-1.15	-1.28	35.87	30.92	32.97	37.50	32.32	34.15	-1.41	-1.46	-1.87	-1.41	-1.49	-1.82	GS−KudlatyPred	54
55	Pcons_local	34.06	28.50	20.42	35.61	29.80	21.56	-1.42	-1.50	-2.51	-1.42	-1.49	-2.47	53.44	48.37	52.48	55.68	47.10	52.52	0.66	0.80	0.10	0.66	0.39	0.07	Pcons_local	55
56	SAM−T02−server	31.70	25.66	17.83	33.14	26.83	18.96	-1.72	-1.90	-2.76	-1.72	-1.88	-2.72	48.19	44.32	40.05	50.38	46.34	41.25	0.04	0.28	-1.16	0.06	0.29	-1.09	SAM−T02−server	56
57	MUFOLD−Server	30.62	25.00	33.21	32.01	26.26	33.35	-1.85	-1.99	-1.32	-1.86	-1.96	-1.35	30.62	25.54	33.25	32.01	26.70	33.39	-2.04	-2.16	-1.84	-2.04	-2.20	-1.89	MUFOLD−Server	57
58	MUFOLD−MD	20.47	17.63	33.28	21.40	18.43	33.32	-3.14	-3.02	-1.31	-3.15	-3.00	-1.36	20.83	17.63	33.28	21.97	18.43	33.32	-3.19	-3.18	-1.84	-3.18	-3.25	-1.90	MUFOLD−MD	58
59	RBO−Proteus	20.29	16.79	33.16	21.21	17.55	33.23	-3.16	-3.14	-1.32	-3.17	-3.12	-1.36	20.65	19.63	33.46	21.59	20.52	33.36	-3.21	-2.92	-1.82	-3.22	-2.99	-1.90	RBO−Proteus	59
60	BioSerf	19.75	17.75	30.81	20.27	18.18	31.09	-3.23	-3.00	-1.54	-3.29	-3.04	-1.57	19.75	17.75	30.81	20.27	18.18	31.09	-3.32	-3.16	-2.09	-3.37	-3.28	-2.13	BioSerf	60
61	Distill	18.12	17.21	27.51	18.94	17.99	27.47	-3.43	-3.08	-1.85	-3.45	-3.06	-1.91	21.01	17.39	28.39	21.59	20.96	28.37	-3.17	-3.21	-2.33	-3.22	-2.93	-2.41	Distill	61
62	LOOPP_Server	16.49	12.98	10.90	17.23	13.57	11.61	-3.64	-3.67	-3.41	-3.66	-3.65	-3.42	16.49	12.98	15.93	17.23	13.57	16.59	-3.71	-3.78	-3.59	-3.72	-3.87	-3.62	LOOPP_Server	62
63	RANDOM	14.57	12.49	14.57	15.51	13.18	15.51	-3.88	-3.74	-3.06	-3.87	-3.70	-3.05	14.57	12.49	14.57	15.51	13.18	15.51	-3.93	-3.85	-3.73	-3.92	-3.92	-3.73	RANDOM	63
64	Pushchino	13.04	10.75	11.56	13.64	11.24	12.04	-4.08	-3.99	-3.35	-4.10	-3.96	-3.38	13.04	10.75	11.56	13.64	11.24	12.04	-4.12	-4.07	-4.03	-4.13	-4.16	-4.09	Pushchino	64
65	huber−torda−server	11.96	10.99	9.30	12.50	11.49	9.91	-4.21	-3.95	-3.56	-4.23	-3.93	-3.58	15.94	13.04	18.69	15.72	14.58	18.86	-3.77	-3.77	-3.31	-3.89	-3.74	-3.39	huber−torda−server	65
66	schenk−torda−server	11.96	10.02	16.65	12.88	10.86	17.08	-4.21	-4.09	-2.87	-4.19	-4.01	-2.90	15.04	13.41	18.33	15.72	14.02	18.56	-3.88	-3.73	-3.35	-3.89	-3.81	-3.42	schenk−torda−server	66
67	OLGAFS	10.51	9.24	4.37	11.36	9.85	4.36	-4.40	-4.20	-4.02	-4.37	-4.15	-4.11	11.05	9.42	4.42	11.36	9.85	4.41	-4.35	-4.24	-4.75	-4.39	-4.34	-4.87	OLGAFS	67
68	BHAGEERATH							-3.88	-3.74	-3.06	-3.87	-3.70	-3.05							-3.93	-3.85	-3.73	-3.92	-3.92	-3.73	BHAGEERATH	68
69	Fiser−M4T							-3.88	-3.74	-3.06	-3.87	-3.70	-3.05							-3.93	-3.85	-3.73	-3.92	-3.92	-3.73	Fiser−M4T	69
70	Pcons_dot_net							-3.88	-3.74	-3.06	-3.87	-3.70	-3.05							-3.93	-3.85	-3.73	-3.92	-3.92	-3.73	Pcons_dot_net	70
71	YASARA							-3.88	-3.74	-3.06	-3.87	-3.70	-3.05							-3.93	-3.85	-3.73	-3.92	-3.92	-3.73	YASARA	71
72	mahmood−torda−server							-3.88	-3.74	-3.06	-3.87	-3.70	-3.05							-3.96	-3.68	-3.73	-3.98	-3.76	-3.73	mahmood−torda−server	72
73	pipe_int							-3.88	-3.74	-3.06	-3.87	-3.70	-3.05							-3.93	-3.85	-3.73	-3.92	-3.92	-3.73	pipe_int	73
74	test_http_server_01							-3.88	-3.74	-3.06	-3.87	-3.70	-3.05							-3.93	-3.85	-3.73	-3.92	-3.92	-3.73	test_http_server_01	74

Server only Targets
388	390	392	394
398	400	402	404
406	408	410	412
414	416	418	420
422	424	426	428
430	432	433	435
436	438	439	441
442	444	445	447
448	450	452	453
455	456	458	459
461	463	470	472
475	477	478	479
481	483	485	486
488	490	491	494
497	501	502	503
504	505	506	507
508	509	510	511
512	513	514