T0453

Server only Targets
388 390 392 394
398 400 402 404
406 408 410 412
414 416 418 420
422 424 426 428
430 432 433 435
436 438 439 441
442 444 445 447
448 450 452 453
455 456 458 459
461 463 470 472
475 477 478 479
481 483 485 486
488 490 491 494
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514  

T0453

C-terminal domain of probable hemolysin from Chromobacterium violaceum

Target type: Server only

Target sequence:

>T0453 C-terminal domain of Probable hemolysin , Chromobacterium violaceum , 91 residues
DGEEDEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEWNGFSFEVVDMDRTRVDKILVQRHH

Structure:
Method: X-ray, res=2.14Å, R/Rfree=0.19/0.24
Determined by: MCSG
PDB ID: 3ded

3ded_A cartoon
Cartoon diagram of 453: 3ded chain A

PyMOL of 3ded

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

FAD-binding domain fold.

CASP category:

Comparative modeling:easy.

Closest templates:

2pls.

Target sequence - PDB file inconsistencies:

T0453    3ded.pdb    T0453.pdb    PyMOL    PyMOL of domains    

T0453    1 DGEEDEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEWNGFSFEVVDMDRTRVDKILVQRHH 91
           ~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3dedA  341 ----DEIVQREDGSWLVDGMVSLDRFREFFELEAPLPGEAGGNIHTLAGVMLYQLGRVPSVTDRFEWNGFSFEVVDMDRTRVDKILVQRHH 427

Residue change log: change 356, 387, 413, MSE to MET;

Single domain protein: target 5-91 ; pdb 341-427

Sequence classification:

Transporter associated domain CorC_HlyC in Pfam.

Server predictions:

T0453:pdb 341-427:seq 5-91:CM_easy;   alignment

distribution of first scores
First models for T0453: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0453 T0453 T0453 T0453
First score First Z-score Best score Best Z-score
1 MULTICOM−RANK 87.93 85.25 89.91 1.70 1.41 1.55 87.93 85.25 89.91 1.74 1.53 1.51 MULTICOM−RANK 1
2 Phyre_de_novo 87.93 82.95 85.66 1.70 0.99 0.52 87.93 82.95 85.66 1.74 0.89 0.31 Phyre_de_novo 2
3 Zhang−Server 87.36 86.02 85.16 1.55 1.55 0.39 87.36 86.02 85.28 1.55 1.75 0.21 Zhang−Server 3
4 3D−JIGSAW_AEP 87.07 82.66 85.38 1.47 0.94 0.45 87.36 82.95 85.38 1.55 0.89 0.24 3D−JIGSAW_AEP 4
5 MULTICOM−REFINE 86.49 83.43 89.13 1.31 1.08 1.36 86.78 84.10 89.56 1.35 1.21 1.41 MULTICOM−REFINE 5
6 PSI 86.21 82.18 84.11 1.24 0.86 0.14 86.21 82.18 84.15 1.16 0.67 -0.11 PSI 6
7 BAKER−ROBETTA 86.21 71.46 87.01 1.24 -1.08 0.85 86.21 83.53 87.01 1.16 1.05 0.69 BAKER−ROBETTA 7
8 MULTICOM−CLUSTER 85.92 83.62 89.65 1.16 1.12 1.49 87.93 85.25 89.91 1.74 1.53 1.51 MULTICOM−CLUSTER 8
9 FEIG 85.92 83.05 89.19 1.16 1.01 1.38 85.92 83.05 89.19 1.06 0.91 1.30 FEIG 9
10 LEE−SERVER 85.63 82.57 87.90 1.08 0.93 1.06 86.49 84.19 88.30 1.26 1.23 1.05 LEE−SERVER 10
11 METATASSER 85.34 83.81 84.90 1.00 1.15 0.33 86.78 86.21 85.01 1.35 1.80 0.13 METATASSER 11
12 MUProt 85.34 83.05 87.73 1.00 1.01 1.02 85.63 83.05 88.42 0.97 0.91 1.09 MUProt 12
13 MUFOLD−Server 85.34 79.22 86.24 1.00 0.32 0.66 87.36 84.48 88.34 1.55 1.32 1.07 MUFOLD−Server 13
14 pro−sp3−TASSER 85.06 76.63 83.84 0.92 -0.15 0.07 85.06 83.43 85.44 0.77 1.02 0.25 pro−sp3−TASSER 14
15 Pcons_multi 84.77 81.90 85.24 0.85 0.80 0.41 84.77 81.90 86.86 0.68 0.59 0.65 Pcons_multi 15
16 RAPTOR 84.48 81.42 88.28 0.77 0.72 1.16 84.48 82.18 89.01 0.58 0.67 1.25 RAPTOR 16
17 YASARA 84.48 79.89 84.59 0.77 0.44 0.26 84.48 80.46 85.12 0.58 0.19 0.16 YASARA 17
18 FFASsuboptimal 83.91 82.76 84.93 0.61 0.96 0.34 83.91 82.76 84.93 0.39 0.83 0.11 FFASsuboptimal 18
19 COMA 83.62 83.24 84.57 0.53 1.05 0.25 83.62 83.24 86.31 0.29 0.97 0.50 COMA 19
20 COMA−M 83.62 81.90 85.49 0.53 0.80 0.48 84.77 82.66 86.31 0.68 0.80 0.50 COMA−M 20
21 fais−server 83.62 81.51 83.30 0.53 0.73 -0.06 83.62 81.51 87.50 0.29 0.48 0.83 fais−server 21
22 pipe_int 83.62 80.94 84.90 0.53 0.63 0.33 83.62 80.94 84.90 0.29 0.32 0.10 pipe_int 22
23 3DShot2 83.33 81.23 80.31 0.46 0.68 -0.79 83.33 81.23 80.31 0.19 0.40 -1.19 3DShot2 23
24 3D−JIGSAW_V3 83.33 80.65 83.49 0.46 0.58 -0.01 83.33 80.65 83.49 0.19 0.24 -0.29 3D−JIGSAW_V3 24
25 MULTICOM−CMFR 83.33 80.65 86.80 0.46 0.58 0.79 85.92 83.62 87.58 1.06 1.07 0.85 MULTICOM−CMFR 25
26 FFASstandard 83.05 82.66 83.90 0.38 0.94 0.09 83.91 82.66 86.86 0.39 0.80 0.65 FFASstandard 26
27 FFASflextemplate 83.05 82.66 83.90 0.38 0.94 0.09 83.91 82.66 85.11 0.39 0.80 0.16 FFASflextemplate 27
28 forecast 83.05 81.13 86.62 0.38 0.67 0.75 83.05 81.13 86.62 0.10 0.37 0.58 forecast 28
29 GS−MetaServer2 83.05 79.02 81.52 0.38 0.28 -0.49 83.05 79.60 87.45 0.10 -0.06 0.82 GS−MetaServer2 29
30 HHpred2 82.47 79.02 87.58 0.22 0.28 0.98 82.47 79.02 87.58 -0.10 -0.22 0.85 HHpred2 30
31 HHpred4 82.47 78.64 86.98 0.22 0.21 0.84 82.47 78.64 86.98 -0.10 -0.33 0.68 HHpred4 31
32 HHpred5 82.47 78.64 86.98 0.22 0.21 0.84 82.47 78.64 86.98 -0.10 -0.33 0.68 HHpred5 32
33 GS−KudlatyPred 82.18 79.12 87.16 0.14 0.30 0.88 82.18 79.12 87.16 -0.19 -0.19 0.73 GS−KudlatyPred 33
34 PS2−server 82.18 78.54 86.98 0.14 0.20 0.84 82.47 81.90 86.98 -0.10 0.59 0.68 PS2−server 34
35 MUSTER 81.90 77.11 84.41 0.07 -0.06 0.21 83.91 79.89 84.41 0.39 0.03 -0.04 MUSTER 35
36 Fiser−M4T 81.32 79.41 83.96 -0.09 0.35 0.10 81.32 79.41 83.96 -0.48 -0.11 -0.16 Fiser−M4T 36
37 huber−torda−server 81.32 78.64 85.62 -0.09 0.21 0.51 83.33 81.42 85.62 0.19 0.46 0.30 huber−torda−server 37
38 mGenTHREADER 81.03 78.35 85.67 -0.17 0.16 0.52 81.03 78.35 85.67 -0.58 -0.41 0.32 mGenTHREADER 38
39 nFOLD3 81.03 78.35 85.11 -0.17 0.16 0.38 81.03 78.35 85.11 -0.58 -0.41 0.16 nFOLD3 39
40 SAM−T02−server 80.75 80.36 79.70 -0.24 0.53 -0.94 80.75 80.36 84.67 -0.68 0.16 0.04 SAM−T02−server 40
41 Pcons_local 80.75 75.96 81.67 -0.24 -0.27 -0.46 80.75 76.15 83.06 -0.68 -1.03 -0.41 Pcons_local 41
42 Pcons_dot_net 80.75 75.96 81.67 -0.24 -0.27 -0.46 85.06 82.76 86.26 0.77 0.83 0.48 Pcons_dot_net 42
43 Frankenstein 80.46 76.44 81.38 -0.32 -0.18 -0.53 80.46 76.44 81.38 -0.77 -0.94 -0.89 Frankenstein 43
44 BioSerf 80.46 73.95 83.02 -0.32 -0.63 -0.13 80.46 73.95 83.02 -0.77 -1.64 -0.43 BioSerf 44
45 SAM−T06−server 80.46 72.80 82.90 -0.32 -0.84 -0.16 80.46 74.23 82.90 -0.77 -1.56 -0.46 SAM−T06−server 45
46 Pushchino 80.17 79.79 77.82 -0.40 0.42 -1.39 80.17 79.79 77.82 -0.87 -0.00 -1.88 Pushchino 46
47 OLGAFS 80.17 77.49 85.12 -0.40 0.01 0.39 80.17 77.49 85.12 -0.87 -0.65 0.16 OLGAFS 47
48 panther_server 80.17 74.23 81.04 -0.40 -0.58 -0.61 80.17 74.23 81.04 -0.87 -1.56 -0.98 panther_server 48
49 GeneSilicoMetaServer 79.02 76.34 84.52 -0.71 -0.20 0.24 79.89 77.39 84.52 -0.96 -0.68 -0.01 GeneSilicoMetaServer 49
50 FAMSD 78.74 77.39 83.32 -0.79 -0.01 -0.05 85.92 79.41 85.63 1.06 -0.11 0.31 FAMSD 50
51 LOOPP_Server 78.45 74.04 80.43 -0.86 -0.62 -0.76 78.45 74.04 81.40 -1.45 -1.62 -0.88 LOOPP_Server 51
52 FUGUE_KM 78.45 69.64 76.66 -0.86 -1.41 -1.68 78.45 75.58 77.53 -1.45 -1.19 -1.96 FUGUE_KM 52
53 Poing 78.16 63.41 85.13 -0.94 -2.54 0.39 82.18 80.46 85.13 -0.19 0.19 0.17 Poing 53
54 Phyre2 78.16 63.41 85.13 -0.94 -2.54 0.39 82.18 80.46 85.13 -0.19 0.19 0.17 Phyre2 54
55 Phragment 78.16 63.41 85.13 -0.94 -2.54 0.39 81.90 77.30 85.13 -0.29 -0.70 0.17 Phragment 55
56 SAM−T08−server 77.87 75.00 83.53 -1.02 -0.44 -0.00 79.31 75.86 83.53 -1.16 -1.11 -0.28 SAM−T08−server 56
57 ACOMPMOD 77.59 73.56 79.05 -1.10 -0.70 -1.09 77.59 73.56 79.05 -1.74 -1.75 -1.54 ACOMPMOD 57
58 keasar−server 77.30 75.77 84.53 -1.18 -0.30 0.24 81.03 78.16 85.72 -0.58 -0.46 0.33 keasar−server 58
59 rehtnap 77.01 70.11 79.35 -1.25 -1.33 -1.02 77.01 72.61 79.65 -1.93 -2.02 -1.37 rehtnap 59
60 3Dpro 76.15 73.66 72.65 -1.49 -0.69 -2.65 79.89 76.82 76.77 -0.96 -0.84 -2.18 3Dpro 60
61 Distill 76.15 71.55 76.37 -1.49 -1.07 -1.75 79.02 76.05 77.61 -1.26 -1.05 -1.94 Distill 61
62 circle 75.29 69.35 79.31 -1.72 -1.47 -1.03 80.75 77.11 81.45 -0.68 -0.76 -0.87 circle 62
63 CpHModels 71.84 65.61 67.87 -2.65 -2.14 -3.82 71.84 65.61 67.87 -3.67 -3.99 -4.67 CpHModels 63
64 FALCON_CONSENSUS 68.68 63.12 69.35 -3.51 -2.59 -3.46 68.68 63.12 69.35 -4.74 -4.69 -4.26 FALCON_CONSENSUS 64
65 FALCON 64.94 55.94 70.04 -4.52 -3.89 -3.29 78.45 75.58 82.62 -1.45 -1.19 -0.54 FALCON 65
66 FOLDpro 48.56 45.50 47.34 -8.96 -5.78 -8.82 73.85 69.06 69.01 -3.00 -3.02 -4.35 FOLDpro 66
67 MUFOLD−MD 41.38 35.82 42.34 -10.90 -7.53 -10.04 53.16 44.73 52.46 -9.96 -9.86 -8.99 MUFOLD−MD 67
68 RBO−Proteus 29.89 26.44 44.17 -14.01 -9.23 -9.59 34.20 31.61 46.01 -16.33 -13.55 -10.80 RBO−Proteus 68
69 RANDOM 20.96 17.26 20.96 -16.43 -10.89 -15.25 20.96 17.26 20.96 -20.79 -17.58 -17.82 RANDOM 69
70 mahmood−torda−server 20.69 19.54 26.85 -16.50 -10.48 -13.82 22.99 19.54 28.04 -20.10 -16.94 -15.84 mahmood−torda−server 70
71 schenk−torda−server 19.25 18.49 26.35 -16.89 -10.67 -13.94 25.29 19.73 27.07 -19.33 -16.89 -16.11 schenk−torda−server 71
72 mariner1 17.53 14.65 14.04 -17.36 -11.37 -16.94 32.47 25.10 35.53 -16.91 -15.38 -13.74 mariner1 72
73 BHAGEERATH                   -16.43 -10.89 -15.25                   -20.79 -17.58 -17.82 BHAGEERATH 73
74 test_http_server_01                   -16.43 -10.89 -15.25                   -20.79 -17.58 -17.82 test_http_server_01 74