T0426

Server only Targets
388 390 392 394
398 400 402 404
406 408 410 412
414 416 418 420
422 424 426 428
430 432 433 435
436 438 439 441
442 444 445 447
448 450 452 453
455 456 458 459
461 463 470 472
475 477 478 479
481 483 485 486
488 490 491 494
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514  

T0426

carbonic anhydrase 13 from Homo sapiens

Target type: Server only

Target sequence:

>T0426 CA13A, Homo sapiens, 283 residues
MHHHHHHSSGVDLGTENLYFQSMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASF

Structure:
Method: X-ray, res=2.05Å, R/Rfree=0.16/0.22
Determined by: SGC
PDB ID: 3da2

3da2_A cartoon
Cartoon diagram of 426: 3da2 chain A

PyMOL of 3da2

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

Carbonic anhydrase fold.

CASP category:

Comparative modeling:easy.

Closest templates:

2hfx, 1jd0, 1rj5, 1kop, 2foy, 1lug.

Target sequence - PDB file inconsistencies:

T0426    3da2.pdb    T0426.pdb    PyMOL    PyMOL of domains    

T0426    1 MHHHHHHSSGVDLGTENLYFQSMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASF 283
           ~~~~~~~~~~~~~~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3da2A    0 ---------------------SMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASF 261

Single domain protein: target 22-283 ; pdb 0-261

Sequence classification:

Eukaryotic-type carbonic anhydrase (Carb_anhydrase) in Pfam.

Server predictions:

T0426:pdb 0-261:seq 22-283:CM_easy;   alignment

distribution of first scores
First models for T0426: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0426 T0426 T0426 T0426
First score First Z-score Best score Best Z-score
1 MULTICOM−RANK 96.66 94.18 94.41 1.16 1.29 0.81 96.76 95.23 94.52 1.59 1.60 1.26 MULTICOM−RANK 1
2 Phyre_de_novo 96.66 91.95 93.86 1.16 0.65 0.66 96.66 91.98 93.86 1.51 0.16 0.79 Phyre_de_novo 2
3 MULTICOM−CLUSTER 96.56 89.06 94.51 1.12 -0.18 0.83 96.85 95.45 94.51 1.66 1.70 1.25 MULTICOM−CLUSTER 3
4 MUProt 96.47 91.00 94.37 1.09 0.37 0.80 96.85 95.32 94.40 1.66 1.64 1.17 MUProt 4
5 MULTICOM−REFINE 96.37 94.97 94.30 1.05 1.52 0.78 96.66 95.26 94.31 1.51 1.61 1.11 MULTICOM−REFINE 5
6 Zhang−Server 96.09 94.37 93.96 0.95 1.34 0.69 96.28 94.75 93.96 1.20 1.39 0.86 Zhang−Server 6
7 COMA−M 95.99 94.34 94.36 0.92 1.34 0.80 96.37 94.34 94.36 1.27 1.21 1.15 COMA−M 7
8 LEE−SERVER 95.90 93.61 93.92 0.88 1.13 0.68 96.66 94.15 94.70 1.51 1.12 1.39 LEE−SERVER 8
9 RAPTOR 95.90 87.63 94.94 0.88 -0.60 0.95 96.47 93.73 94.94 1.36 0.93 1.56 RAPTOR 9
10 Fiser−M4T 95.80 94.21 94.09 0.85 1.30 0.72 95.80 94.21 94.09 0.81 1.15 0.95 Fiser−M4T 10
11 HHpred5 95.61 89.50 95.26 0.78 -0.06 1.03 95.61 89.50 95.26 0.66 -0.95 1.79 HHpred5 11
12 BioSerf 95.52 93.86 93.82 0.75 1.20 0.65 95.52 93.86 93.82 0.59 0.99 0.76 BioSerf 12
13 GS−KudlatyPred 95.13 85.59 93.82 0.60 -1.18 0.65 95.13 85.59 93.82 0.27 -2.68 0.76 GS−KudlatyPred 13
14 PS2−server 95.04 92.88 94.10 0.57 0.92 0.73 96.37 92.88 94.10 1.27 0.56 0.96 PS2−server 14
15 forecast 95.04 91.60 92.01 0.57 0.55 0.18 95.80 92.05 92.33 0.81 0.19 -0.30 forecast 15
16 GS−MetaServer2 94.94 92.91 93.42 0.54 0.92 0.55 95.42 94.08 93.42 0.51 1.09 0.48 GS−MetaServer2 16
17 MULTICOM−CMFR 94.94 91.89 92.17 0.54 0.63 0.22 95.32 92.53 92.45 0.43 0.40 -0.21 MULTICOM−CMFR 17
18 keasar−server 94.85 92.88 93.87 0.50 0.92 0.67 95.13 92.88 93.87 0.27 0.56 0.80 keasar−server 18
19 3DShot2 94.85 92.30 92.06 0.50 0.75 0.19 94.85 92.30 92.06 0.05 0.30 -0.49 3DShot2 19
20 Pcons_local 94.66 91.60 91.31 0.43 0.55 -0.00 94.66 91.60 91.31 -0.11 -0.01 -1.03 Pcons_local 20
21 SAM−T02−server 94.56 92.59 93.75 0.40 0.83 0.64 94.56 92.59 93.75 -0.19 0.43 0.71 SAM−T02−server 21
22 PSI 94.47 91.92 93.47 0.37 0.64 0.56 94.47 91.92 93.47 -0.26 0.13 0.51 PSI 22
23 YASARA 94.47 85.69 90.42 0.37 -1.15 -0.23 95.23 93.07 93.17 0.35 0.64 0.30 YASARA 23
24 3D−JIGSAW_V3 94.37 92.33 93.08 0.33 0.76 0.46 94.37 92.33 93.15 -0.34 0.31 0.28 3D−JIGSAW_V3 24
25 MUSTER 94.37 91.76 93.92 0.33 0.59 0.68 94.94 91.76 93.92 0.12 0.06 0.83 MUSTER 25
26 OLGAFS 94.28 90.97 91.02 0.30 0.37 -0.08 94.37 91.83 91.23 -0.34 0.09 -1.08 OLGAFS 26
27 HHpred4 94.28 90.14 93.72 0.30 0.13 0.63 94.28 90.14 93.72 -0.41 -0.66 0.69 HHpred4 27
28 HHpred2 94.28 90.14 93.72 0.30 0.13 0.63 94.28 90.14 93.72 -0.41 -0.66 0.69 HHpred2 28
29 SAM−T06−server 94.28 86.32 91.65 0.30 -0.97 0.09 94.47 92.40 93.66 -0.26 0.34 0.65 SAM−T06−server 29
30 pro−sp3−TASSER 94.08 92.24 90.56 0.22 0.73 -0.20 94.75 92.72 90.77 -0.03 0.49 -1.41 pro−sp3−TASSER 30
31 fais−server 94.08 89.82 93.79 0.22 0.03 0.65 94.85 92.65 93.79 0.05 0.45 0.74 fais−server 31
32 COMA 93.89 89.31 91.11 0.16 -0.11 -0.05 95.32 93.03 94.36 0.43 0.62 1.15 COMA 32
33 rehtnap 93.80 92.14 90.34 0.12 0.70 -0.25 93.80 92.14 90.34 -0.80 0.23 -1.72 rehtnap 33
34 BAKER−ROBETTA 93.80 91.70 92.75 0.12 0.58 0.37 93.89 91.73 92.81 -0.73 0.05 0.04 BAKER−ROBETTA 34
35 Pushchino 93.80 90.62 90.37 0.12 0.26 -0.25 93.80 90.62 90.37 -0.80 -0.45 -1.70 Pushchino 35
36 pipe_int 93.80 89.73 91.58 0.12 0.01 0.07 96.37 91.92 93.95 1.27 0.13 0.85 pipe_int 36
37 Phyre2 93.80 87.75 91.85 0.12 -0.56 0.14 95.23 90.78 92.83 0.35 -0.38 0.06 Phyre2 37
38 FEIG 93.70 88.71 91.91 0.09 -0.28 0.16 94.56 88.71 92.14 -0.19 -1.30 -0.44 FEIG 38
39 3Dpro 93.61 91.19 93.47 0.05 0.43 0.56 94.28 91.19 93.47 -0.41 -0.19 0.51 3Dpro 39
40 nFOLD3 93.51 91.35 93.24 0.02 0.47 0.50 95.04 93.19 93.24 0.20 0.69 0.35 nFOLD3 40
41 CpHModels 93.32 91.41 91.29 -0.05 0.49 -0.01 93.32 91.41 91.29 -1.19 -0.10 -1.04 CpHModels 41
42 Poing 93.22 89.03 90.44 -0.09 -0.19 -0.23 95.23 90.78 92.83 0.35 -0.38 0.06 Poing 42
43 Phragment 93.22 89.03 90.44 -0.09 -0.19 -0.23 95.23 90.78 92.83 0.35 -0.38 0.06 Phragment 43
44 3D−JIGSAW_AEP 93.13 90.39 92.29 -0.12 0.20 0.25 94.28 92.11 93.13 -0.41 0.21 0.27 3D−JIGSAW_AEP 44
45 FOLDpro 93.13 90.20 93.58 -0.12 0.14 0.59 93.13 90.20 93.58 -1.34 -0.63 0.59 FOLDpro 45
46 SAM−T08−server 93.13 88.74 92.57 -0.12 -0.28 0.33 94.37 92.40 93.66 -0.34 0.34 0.65 SAM−T08−server 46
47 panther_server 92.94 90.39 89.60 -0.19 0.20 -0.45 93.22 90.74 90.14 -1.27 -0.39 -1.86 panther_server 47
48 GeneSilicoMetaServer 92.65 90.17 91.50 -0.29 0.14 0.05 95.32 93.22 93.68 0.43 0.71 0.66 GeneSilicoMetaServer 48
49 FAMSD 92.18 84.92 90.67 -0.46 -1.38 -0.17 93.89 91.54 92.29 -0.73 -0.04 -0.33 FAMSD 49
50 mGenTHREADER 91.98 81.30 91.42 -0.54 -2.42 0.03 91.98 81.30 91.42 -2.27 -4.59 -0.95 mGenTHREADER 50
51 circle 91.79 89.63 89.51 -0.60 -0.02 -0.47 92.27 89.66 90.63 -2.04 -0.87 -1.51 circle 51
52 MUFOLD−Server 91.70 87.06 88.55 -0.64 -0.76 -0.72 91.70 87.06 88.55 -2.50 -2.03 -2.99 MUFOLD−Server 52
53 FFASstandard 91.51 84.64 90.06 -0.71 -1.46 -0.33 95.80 94.12 90.06 0.81 1.11 -1.92 FFASstandard 53
54 Pcons_dot_net 91.41 87.91 86.60 -0.74 -0.52 -1.23 94.94 91.06 91.32 0.12 -0.25 -1.02 Pcons_dot_net 54
55 Pcons_multi 91.41 87.91 86.60 -0.74 -0.52 -1.23 93.80 88.20 92.53 -0.80 -1.52 -0.16 Pcons_multi 55
56 FFASflextemplate 91.13 89.09 89.98 -0.84 -0.18 -0.35 91.51 89.09 90.06 -2.65 -1.13 -1.92 FFASflextemplate 56
57 FFASsuboptimal 91.13 89.09 89.98 -0.84 -0.18 -0.35 91.51 89.09 90.06 -2.65 -1.13 -1.92 FFASsuboptimal 57
58 METATASSER 90.84 88.68 86.37 -0.95 -0.29 -1.29 93.99 88.68 91.51 -0.65 -1.31 -0.88 METATASSER 58
59 LOOPP_Server 85.69 84.29 82.16 -2.81 -1.56 -2.39 95.42 91.03 91.70 0.51 -0.27 -0.75 LOOPP_Server 59
60 Distill 83.21 80.79 73.63 -3.71 -2.56 -4.62 84.73 82.32 75.12 -8.12 -4.14 -12.55 Distill 60
61 ACOMPMOD 81.30 72.58 75.98 -4.40 -4.93 -4.01 92.65 91.00 90.25 -1.73 -0.28 -1.78 ACOMPMOD 61
62 FUGUE_KM 79.68 75.54 74.33 -4.99 -4.07 -4.44 79.68 75.54 74.33 -12.20 -7.15 -13.12 FUGUE_KM 62
63 FALCON_CONSENSUS 74.14 69.24 71.52 -6.99 -5.89 -5.17 95.13 83.05 91.67 0.27 -3.81 -0.77 FALCON_CONSENSUS 63
64 FALCON 74.14 69.24 71.52 -6.99 -5.89 -5.17 95.13 91.38 91.77 0.27 -0.11 -0.70 FALCON 64
65 mariner1 69.75 67.40 60.63 -8.58 -6.42 -8.02 76.62 67.46 68.12 -14.67 -10.74 -17.54 mariner1 65
66 MUFOLD−MD 12.12 10.59 20.58 -29.44 -22.76 -18.48 18.23 17.40 25.53 -61.82 -32.99 -47.86 MUFOLD−MD 66
67 RBO−Proteus 9.45 7.60 20.32 -30.41 -23.62 -18.55 10.88 9.22 20.91 -67.76 -36.62 -51.15 RBO−Proteus 67
68 RANDOM 8.11 6.82 8.11 -30.89 -23.85 -21.74 8.11 6.82 8.11 -70.00 -37.69 -60.26 RANDOM 68
69 schenk−torda−server 6.68 5.92 10.91 -31.41 -24.11 -21.00 7.82 7.03 10.91 -70.23 -37.60 -58.27 schenk−torda−server 69
70 BHAGEERATH                   -30.89 -23.85 -21.74                   -70.00 -37.69 -60.26 BHAGEERATH 70
71 Frankenstein                   -30.89 -23.85 -21.74                   -70.00 -37.69 -60.26 Frankenstein 71
72 huber−torda−server                   -30.89 -23.85 -21.74                   -70.00 -37.69 -60.26 huber−torda−server 72
73 mahmood−torda−server                   -30.89 -23.85 -21.74                   -70.00 -37.69 -60.26 mahmood−torda−server 73
74 test_http_server_01                   -30.89 -23.85 -21.74                   -70.00 -37.69 -60.26 test_http_server_01 74