T0435

Server only Targets
388 390 392 394
398 400 402 404
406 408 410 412
414 416 418 420
422 424 426 428
430 432 433 435
436 438 439 441
442 444 445 447
448 450 452 453
455 456 458 459
461 463 470 472
475 477 478 479
481 483 485 486
488 490 491 494
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514  

T0435

methyltransferase domain of human PR domain-containing protein 4 (PRDM4) from Homo sapiens

Target type: Server only

Target sequence:

>T0435 PRDM4, Homo sapiens, 151 residues
EHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGAEVGVWTGETIPVRTCFGPLIGQQSHSMEVAEWTDKAVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPE

Structure:
Method: X-ray, res=2.15Å, R/Rfree=0.23/0.30
Determined by: SGC
PDB ID: 3db5

3db5_A cartoon
Cartoon diagram of 435: 3db5 chain A residues

PyMOL of 3db5

Domains:  PyMOL of domains

Single domain protein. However, the domain is different from the entire chain due to a domain swap of the N-terminal region. Its residue range in PDB is B:4-13,A:14-141.

435 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation with a swapped domain (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

435 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation with N-terminal segment removed (just A:14-141, y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

β-clip fold.

CASP category:

Whole chain: Comparative modeling:medium.

Domain (swap segment removed): Comparative modeling:easy. Domain (swap): Comparative modeling:medium.

Closest templates:

2qpw.

Target sequence - PDB file inconsistencies:

T0435    3db5.pdb    T0435.pdb    PyMOL    PyMOL of domains    

T0435    1 EHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGAEVGVWTGETIPVRTCFGPLIGQQSHSMEVAEWTDKAVNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVPE 151
           ~~~||||||||||||||||||||||||||||~~~|||||||||||||||||||||||||~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~
3db5A    4 ---PVTFVPDTPIESRARLSLPKQLVLRQSI---EVGVWTGETIPVRTCFGPLIGQQSH-----------VNHIWKIYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSR---------- 141

Residue change log: change 98, 99, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, the domain is different from the entire chain due to a domain swap of the N-terminal region. Its residue range in PDB is B:4-13, A:14-141. Since no server predicted the swap well, we removed the swapped N-terminal segment (pdb A:4-A:13) for evaluation, resulting this domain definition:

1st domain: target 14-31, 35-59, 71-141 ; pdb 14-31, 35-59, 71-141

Sequence classification:

SET domain in Pfam.

Comments:

This protein is a close homolog of T0434.

Server predictions:

T0435:pdb 4-141:seq 4-141:CM_medium;   alignment

distribution of first scores
First models for T0435: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

435_1:pdb 14-141:seq 14-141:CM_easy;   alignment

distribution of first scores
First models for T0435_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

435_1s:pdb B:4-13,A:14-141:seq 4-13,14-141:CM_medium;   alignment

distribution of first scores
First models for T0435_1s: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0435 435_1 435_1s T0435 435_1 435_1s T0435 435_1 435_1s T0435 435_1 435_1s
First score First Z-score Best score Best Z-score
1 Zhang−Server 78.83 73.99 83.80 85.31 80.19 84.34 77.18 72.42 77.43 0.94 0.85 0.80 0.94 0.87 0.80 0.93 0.88 0.81 78.83 76.28 83.80 85.31 81.94 84.34 77.18 74.01 77.43 0.88 0.93 0.71 0.87 0.87 0.70 0.86 0.90 0.72 Zhang−Server 1
2 YASARA 78.63 75.00 85.29 85.09 81.14 85.97 76.98 73.41 79.02 0.92 0.94 0.92 0.92 0.95 0.93 0.91 0.97 0.96 78.63 76.01 85.29 85.09 82.24 85.97 76.98 74.41 79.02 0.85 0.90 0.86 0.84 0.90 0.87 0.83 0.95 0.90 YASARA 2
3 HHpred2 78.02 74.66 83.23 84.65 80.99 83.78 76.59 73.15 76.66 0.86 0.91 0.76 0.87 0.94 0.75 0.87 0.95 0.74 78.02 74.66 83.23 84.65 80.99 83.78 76.59 73.15 76.66 0.78 0.76 0.65 0.79 0.77 0.65 0.78 0.80 0.64 HHpred2 3
4 BioSerf 78.02 74.13 83.86 84.65 80.41 84.19 76.59 73.28 77.40 0.86 0.86 0.81 0.87 0.89 0.78 0.87 0.96 0.81 78.02 74.13 83.86 84.65 80.41 84.19 76.59 73.28 77.40 0.78 0.70 0.72 0.79 0.71 0.69 0.78 0.82 0.72 BioSerf 4
5 LEE−SERVER 78.02 71.30 84.51 84.65 77.34 84.92 76.59 69.71 78.05 0.86 0.60 0.86 0.87 0.62 0.84 0.87 0.61 0.87 78.02 75.20 84.51 84.65 81.14 84.92 76.59 73.88 78.05 0.78 0.82 0.78 0.79 0.79 0.76 0.78 0.89 0.79 LEE−SERVER 5
6 MUSTER 77.82 74.46 83.42 84.43 80.78 83.88 76.39 72.95 76.99 0.84 0.89 0.77 0.85 0.92 0.76 0.85 0.93 0.77 77.82 74.46 83.42 84.43 80.78 83.88 76.39 72.95 76.99 0.75 0.74 0.67 0.77 0.75 0.66 0.76 0.78 0.67 MUSTER 6
7 MULTICOM−REFINE 77.82 72.72 83.21 83.99 79.75 83.88 75.99 71.89 76.84 0.84 0.73 0.75 0.81 0.83 0.76 0.81 0.83 0.76 77.82 72.85 83.57 83.99 79.75 84.16 75.99 71.89 77.14 0.75 0.56 0.69 0.71 0.64 0.69 0.71 0.66 0.69 MULTICOM−REFINE 7
8 HHpred5 77.42 75.00 83.25 83.99 81.36 83.73 75.99 72.02 76.71 0.80 0.94 0.76 0.81 0.97 0.75 0.81 0.84 0.75 77.42 75.00 83.25 83.99 81.36 83.73 75.99 72.02 76.71 0.70 0.79 0.65 0.71 0.81 0.64 0.71 0.67 0.64 HHpred5 8
9 MULTICOM−CMFR 77.42 74.60 83.44 83.33 80.26 84.09 75.40 72.49 77.06 0.80 0.90 0.77 0.75 0.87 0.78 0.75 0.88 0.78 77.42 74.60 83.44 83.33 80.26 84.09 75.40 72.49 77.06 0.70 0.75 0.67 0.64 0.70 0.68 0.63 0.72 0.68 MULTICOM−CMFR 9
10 HHpred4 77.42 74.06 83.16 84.21 80.56 83.79 76.19 72.75 76.95 0.80 0.85 0.75 0.83 0.90 0.75 0.83 0.91 0.77 77.42 74.06 83.16 84.21 80.56 83.79 76.19 72.75 76.95 0.70 0.69 0.64 0.74 0.73 0.65 0.73 0.75 0.67 HHpred4 10
11 fais−server 77.42 73.79 83.42 83.99 80.04 83.80 75.99 72.16 77.04 0.80 0.83 0.77 0.81 0.86 0.75 0.81 0.85 0.78 77.42 73.79 83.42 83.99 80.04 83.80 75.99 72.16 77.04 0.70 0.66 0.67 0.71 0.67 0.65 0.71 0.69 0.68 fais−server 11
12 mGenTHREADER 77.02 73.52 83.05 83.33 79.53 83.49 75.40 71.83 76.60 0.76 0.80 0.74 0.75 0.81 0.73 0.75 0.82 0.74 77.02 73.52 83.05 83.33 79.53 83.49 75.40 71.83 76.60 0.65 0.63 0.63 0.64 0.62 0.62 0.63 0.65 0.63 mGenTHREADER 12
13 COMA 77.02 73.52 83.52 83.33 79.09 84.01 75.59 70.17 76.92 0.76 0.80 0.78 0.75 0.77 0.77 0.77 0.66 0.77 77.02 73.52 83.59 83.33 79.09 84.10 75.59 70.17 76.97 0.65 0.63 0.69 0.64 0.58 0.68 0.66 0.46 0.67 COMA 13
14 COMA−M 77.02 73.39 82.77 83.33 77.63 83.31 75.40 70.64 76.26 0.76 0.79 0.72 0.75 0.65 0.71 0.75 0.70 0.71 77.62 74.93 83.59 83.99 81.07 84.10 75.99 73.21 76.97 0.73 0.79 0.69 0.71 0.78 0.68 0.71 0.81 0.67 COMA−M 14
15 keasar−server 77.02 72.85 83.31 83.11 78.58 83.76 75.20 70.97 76.73 0.76 0.74 0.76 0.73 0.73 0.75 0.73 0.74 0.75 77.02 72.98 83.31 83.11 78.95 83.90 75.20 71.30 76.74 0.65 0.57 0.66 0.61 0.56 0.66 0.61 0.59 0.64 keasar−server 15
16 MUProt 77.02 72.85 82.35 83.55 78.29 83.14 75.59 70.97 75.86 0.76 0.74 0.68 0.77 0.70 0.70 0.77 0.74 0.67 77.82 72.85 83.59 83.99 79.75 84.18 75.99 71.89 77.16 0.75 0.56 0.69 0.71 0.64 0.69 0.71 0.66 0.69 MUProt 16
17 Poing 76.81 73.72 82.64 83.11 78.58 83.24 75.40 71.03 76.45 0.74 0.82 0.71 0.73 0.73 0.71 0.75 0.74 0.73 76.81 73.72 82.64 83.11 78.58 83.24 75.40 71.03 76.45 0.63 0.65 0.59 0.61 0.53 0.59 0.63 0.56 0.61 Poing 17
18 Phyre2 76.81 73.72 82.64 83.11 78.58 83.24 75.40 71.03 76.45 0.74 0.82 0.71 0.73 0.73 0.71 0.75 0.74 0.73 76.81 73.72 82.64 83.11 78.58 83.24 75.40 71.03 76.45 0.63 0.65 0.59 0.61 0.53 0.59 0.63 0.56 0.61 Phyre2 18
19 Phragment 76.81 73.72 82.64 83.11 78.58 83.24 75.40 71.03 76.45 0.74 0.82 0.71 0.73 0.73 0.71 0.75 0.74 0.73 76.81 73.72 82.64 83.11 78.58 83.24 75.40 71.03 76.45 0.63 0.65 0.59 0.61 0.53 0.59 0.63 0.56 0.61 Phragment 19
20 FUGUE_KM 76.81 73.32 82.52 83.33 79.53 83.49 75.40 71.83 76.40 0.74 0.79 0.70 0.75 0.81 0.73 0.75 0.82 0.72 76.81 73.32 82.52 83.33 79.53 83.49 75.40 71.83 76.40 0.63 0.61 0.58 0.64 0.62 0.62 0.63 0.65 0.61 FUGUE_KM 20
21 pro−sp3−TASSER 76.81 72.51 82.54 83.11 78.44 83.02 75.20 70.44 76.01 0.74 0.71 0.70 0.73 0.72 0.69 0.73 0.68 0.69 77.02 73.39 82.54 83.11 79.17 83.02 75.20 71.23 76.01 0.65 0.62 0.58 0.61 0.59 0.57 0.61 0.58 0.56 pro−sp3−TASSER 21
22 MULTICOM−RANK 76.81 70.50 82.52 83.33 76.46 83.31 75.40 69.18 76.00 0.74 0.53 0.70 0.75 0.55 0.71 0.75 0.56 0.68 76.81 70.50 82.52 83.33 76.46 83.31 75.40 69.18 76.00 0.63 0.30 0.58 0.64 0.31 0.60 0.63 0.34 0.56 MULTICOM−RANK 22
23 SAM−T02−server 76.41 73.86 81.38 82.67 79.90 81.92 74.80 72.16 74.91 0.70 0.84 0.61 0.69 0.84 0.60 0.69 0.85 0.59 76.41 73.86 81.38 82.67 79.90 81.92 74.80 72.16 74.91 0.58 0.67 0.46 0.56 0.66 0.46 0.55 0.69 0.44 SAM−T02−server 23
24 PS2−server 76.41 73.72 83.31 83.11 80.19 83.63 75.20 72.55 76.88 0.70 0.82 0.76 0.73 0.87 0.74 0.73 0.89 0.76 76.41 73.72 83.31 83.11 80.19 83.63 75.20 72.55 76.88 0.58 0.65 0.66 0.61 0.69 0.63 0.61 0.73 0.66 PS2−server 24
25 PSI 76.41 72.92 83.43 82.89 79.09 83.92 75.00 71.43 77.03 0.70 0.75 0.77 0.71 0.77 0.76 0.71 0.78 0.78 76.41 72.92 83.43 82.89 79.09 83.92 75.00 71.43 77.03 0.58 0.57 0.67 0.59 0.58 0.66 0.58 0.60 0.68 PSI 25
26 Pushchino 76.41 72.78 81.08 82.89 78.95 82.68 75.00 71.30 75.01 0.70 0.74 0.58 0.71 0.76 0.66 0.71 0.77 0.60 76.41 72.78 81.08 82.89 78.95 82.68 75.00 71.30 75.01 0.58 0.55 0.43 0.59 0.56 0.53 0.58 0.59 0.45 Pushchino 26
27 pipe_int 76.41 71.84 82.31 82.67 77.70 82.85 74.80 70.17 75.77 0.70 0.65 0.68 0.69 0.65 0.68 0.69 0.66 0.66 76.61 74.46 83.35 83.11 80.78 83.73 75.00 72.88 76.81 0.60 0.74 0.66 0.61 0.75 0.64 0.58 0.77 0.65 pipe_int 27
28 RAPTOR 76.41 68.48 83.22 82.46 73.83 83.95 74.60 66.80 76.69 0.70 0.35 0.75 0.67 0.32 0.76 0.67 0.33 0.75 77.42 75.27 83.40 83.99 81.65 83.95 75.99 73.74 77.03 0.70 0.82 0.67 0.71 0.84 0.66 0.71 0.87 0.68 RAPTOR 28
29 FFASstandard 76.21 73.12 82.40 82.67 79.31 83.37 74.80 71.63 75.93 0.68 0.77 0.69 0.69 0.79 0.72 0.69 0.80 0.68 76.21 73.12 82.40 82.67 79.31 83.37 74.80 71.63 75.93 0.55 0.59 0.57 0.56 0.60 0.60 0.55 0.63 0.55 FFASstandard 29
30 SAM−T08−server 75.81 72.31 83.65 81.58 77.78 84.14 73.81 71.30 77.03 0.64 0.69 0.79 0.59 0.66 0.78 0.58 0.77 0.78 76.61 73.66 83.65 83.11 79.90 84.14 75.20 72.16 77.03 0.60 0.65 0.69 0.61 0.66 0.68 0.61 0.69 0.68 SAM−T08−server 30
31 FFASsuboptimal 75.81 71.37 82.09 82.24 77.41 82.62 74.41 69.91 75.55 0.64 0.61 0.66 0.65 0.63 0.66 0.65 0.63 0.64 76.61 73.66 83.47 83.33 80.12 84.01 75.20 72.16 76.85 0.60 0.65 0.68 0.64 0.68 0.67 0.61 0.69 0.66 FFASsuboptimal 31
32 MULTICOM−CLUSTER 75.61 65.39 83.75 82.24 71.13 84.33 74.41 64.22 77.28 0.62 0.06 0.80 0.65 0.09 0.80 0.65 0.08 0.80 76.81 70.50 83.75 83.33 76.46 84.33 75.40 69.18 77.28 0.63 0.30 0.70 0.64 0.31 0.70 0.63 0.34 0.71 MULTICOM−CLUSTER 32
33 LOOPP_Server 75.40 73.79 81.28 82.02 80.26 81.96 74.21 72.62 74.98 0.60 0.83 0.60 0.63 0.87 0.60 0.63 0.90 0.59 75.40 73.79 81.28 82.02 80.26 81.96 74.21 72.62 74.98 0.45 0.66 0.45 0.49 0.70 0.46 0.48 0.74 0.45 LOOPP_Server 33
34 FFASflextemplate 75.40 71.91 79.84 81.80 78.00 80.79 74.01 70.44 73.59 0.60 0.66 0.48 0.61 0.68 0.51 0.60 0.68 0.47 76.01 72.65 80.42 82.46 78.58 81.35 74.60 70.97 74.11 0.53 0.54 0.37 0.54 0.53 0.40 0.53 0.55 0.35 FFASflextemplate 34
35 FALCON_CONSENSUS 75.40 71.10 80.47 81.58 76.90 80.82 73.81 69.97 74.54 0.60 0.58 0.53 0.59 0.58 0.51 0.58 0.64 0.55 77.22 75.47 83.76 83.99 82.09 84.19 76.19 69.97 77.35 0.68 0.85 0.70 0.71 0.88 0.69 0.73 0.43 0.71 FALCON_CONSENSUS 35
36 FALCON 75.40 71.10 80.47 81.58 76.90 80.82 73.81 69.97 74.54 0.60 0.58 0.53 0.59 0.58 0.51 0.58 0.64 0.55 77.22 75.47 83.76 83.99 82.09 84.19 76.19 69.97 77.35 0.68 0.85 0.70 0.71 0.88 0.69 0.73 0.43 0.71 FALCON 36
37 SAM−T06−server 75.20 72.38 81.20 82.24 79.17 81.79 74.01 65.67 74.78 0.58 0.70 0.59 0.65 0.78 0.59 0.60 0.22 0.57 76.41 72.38 81.20 82.46 79.17 81.79 74.60 70.50 74.78 0.58 0.51 0.45 0.54 0.59 0.44 0.53 0.49 0.42 SAM−T06−server 37
38 FEIG 67.94 62.57 76.66 73.47 67.33 77.25 66.47 61.71 70.77 -0.15 -0.19 0.23 -0.17 -0.24 0.22 -0.18 -0.17 0.21 69.36 62.57 76.66 75.44 67.40 77.25 71.03 63.09 70.77 -0.29 -0.57 -0.01 -0.27 -0.61 -0.02 0.07 -0.36 -0.03 FEIG 38
39 3D−JIGSAW_V3 67.54 63.51 66.70 72.37 67.98 67.61 65.67 61.57 61.86 -0.19 -0.11 -0.58 -0.27 -0.19 -0.57 -0.26 -0.18 -0.59 67.54 63.78 67.50 73.25 69.44 68.46 66.47 62.90 62.67 -0.52 -0.43 -0.94 -0.52 -0.40 -0.92 -0.51 -0.38 -0.94 3D−JIGSAW_V3 39
40 GS−KudlatyPred 66.94 62.63 71.15 72.59 67.91 71.95 65.67 61.44 66.04 -0.25 -0.19 -0.22 -0.25 -0.19 -0.21 -0.26 -0.20 -0.21 66.94 62.63 71.15 72.59 67.91 71.95 65.67 61.44 66.04 -0.59 -0.56 -0.57 -0.60 -0.56 -0.56 -0.61 -0.55 -0.56 GS−KudlatyPred 40
41 FAMSD 66.53 59.14 76.30 71.71 65.86 76.68 64.88 59.33 70.54 -0.29 -0.51 0.20 -0.33 -0.37 0.17 -0.35 -0.40 0.19 66.94 62.10 76.67 72.37 67.11 77.14 65.48 60.45 70.89 -0.59 -0.62 -0.01 -0.62 -0.64 -0.03 -0.64 -0.67 -0.01 FAMSD 41
42 3Dpro 65.93 62.97 73.80 71.49 68.28 74.13 65.28 62.23 68.23 -0.35 -0.16 -0.01 -0.35 -0.16 -0.04 -0.31 -0.12 -0.02 66.94 63.31 73.80 71.49 68.28 74.13 65.28 62.23 68.23 -0.59 -0.48 -0.30 -0.72 -0.52 -0.34 -0.66 -0.46 -0.31 3Dpro 42
43 BAKER−ROBETTA 65.93 58.13 75.53 71.49 63.01 76.18 64.48 56.55 69.77 -0.35 -0.60 0.13 -0.35 -0.62 0.13 -0.39 -0.67 0.12 66.13 58.67 76.52 71.71 63.60 77.13 64.88 57.27 71.18 -0.69 -0.99 -0.03 -0.70 -1.00 -0.03 -0.72 -1.04 0.02 BAKER−ROBETTA 43
44 CpHModels 65.73 59.01 69.57 71.49 64.18 72.24 64.68 58.07 64.52 -0.37 -0.52 -0.35 -0.35 -0.52 -0.19 -0.37 -0.52 -0.35 65.73 59.01 69.57 71.49 64.18 72.24 64.68 58.07 64.52 -0.74 -0.95 -0.73 -0.72 -0.94 -0.53 -0.74 -0.94 -0.73 CpHModels 44
45 METATASSER 65.52 61.09 68.77 71.27 66.45 69.50 64.48 59.99 63.91 -0.39 -0.33 -0.41 -0.37 -0.32 -0.41 -0.39 -0.34 -0.41 76.01 74.26 79.13 82.24 80.34 79.86 74.60 72.75 73.41 0.53 0.71 0.24 0.51 0.70 0.25 0.53 0.75 0.27 METATASSER 45
46 Phyre_de_novo 64.31 58.00 66.12 69.96 63.09 66.79 63.29 56.81 61.35 -0.51 -0.61 -0.63 -0.49 -0.61 -0.63 -0.51 -0.65 -0.64 77.02 74.33 82.97 83.33 79.83 83.52 75.59 72.29 76.72 0.65 0.72 0.63 0.64 0.65 0.62 0.66 0.70 0.64 Phyre_de_novo 46
47 circle 63.31 58.47 66.56 68.86 63.60 66.99 62.70 57.94 61.82 -0.61 -0.57 -0.59 -0.60 -0.57 -0.62 -0.57 -0.54 -0.59 77.02 73.79 81.69 83.33 80.70 82.02 75.40 72.75 75.37 0.65 0.66 0.50 0.64 0.74 0.47 0.63 0.75 0.49 circle 47
48 Pcons_dot_net 62.90 58.74 66.14 68.42 63.89 66.65 62.30 58.20 61.48 -0.66 -0.54 -0.62 -0.64 -0.54 -0.65 -0.62 -0.51 -0.63 62.90 58.74 66.14 68.42 63.89 66.65 62.30 58.20 61.48 -1.09 -0.98 -1.07 -1.08 -0.97 -1.10 -1.05 -0.93 -1.07 Pcons_dot_net 48
49 Pcons_multi 62.90 58.74 66.14 68.42 63.89 66.65 62.30 58.20 61.48 -0.66 -0.54 -0.62 -0.64 -0.54 -0.65 -0.62 -0.51 -0.63 63.71 58.74 68.60 69.30 63.89 68.98 62.90 58.20 63.68 -0.99 -0.98 -0.83 -0.97 -0.97 -0.87 -0.97 -0.93 -0.83 Pcons_multi 49
50 nFOLD3 61.90 56.65 63.61 67.33 61.62 64.58 60.71 56.48 59.41 -0.76 -0.73 -0.83 -0.74 -0.74 -0.81 -0.78 -0.68 -0.81 77.02 72.92 83.58 83.99 79.46 84.08 75.59 71.43 77.15 0.65 0.57 0.69 0.71 0.62 0.68 0.66 0.60 0.69 nFOLD3 50
51 3DShot2 61.69 57.26 61.61 67.11 62.28 62.48 60.71 56.35 57.50 -0.78 -0.68 -0.99 -0.76 -0.68 -0.99 -0.78 -0.69 -0.98 61.69 57.26 61.61 67.11 62.28 62.48 60.71 56.35 57.50 -1.24 -1.15 -1.53 -1.23 -1.13 -1.53 -1.25 -1.14 -1.52 3DShot2 51
52 Distill 61.69 56.45 66.62 66.89 61.18 67.53 61.51 57.67 61.99 -0.78 -0.75 -0.59 -0.78 -0.78 -0.57 -0.70 -0.56 -0.58 65.93 60.69 71.06 71.05 64.47 71.69 64.48 58.60 65.58 -0.72 -0.77 -0.58 -0.77 -0.91 -0.59 -0.77 -0.88 -0.61 Distill 52
53 Pcons_local 61.29 56.18 64.10 66.67 61.11 64.98 60.52 55.49 59.69 -0.82 -0.78 -0.79 -0.80 -0.78 -0.78 -0.80 -0.78 -0.79 61.29 56.18 64.10 66.67 61.11 64.98 60.52 55.49 59.69 -1.29 -1.26 -1.28 -1.28 -1.25 -1.28 -1.27 -1.24 -1.28 Pcons_local 53
54 GeneSilicoMetaServer 60.28 52.22 63.71 65.35 56.58 64.20 59.72 51.79 59.23 -0.92 -1.14 -0.82 -0.92 -1.17 -0.85 -0.88 -1.14 -0.83 76.81 73.32 83.53 83.33 79.53 84.03 75.40 71.83 77.01 0.63 0.61 0.68 0.64 0.62 0.67 0.63 0.65 0.68 GeneSilicoMetaServer 54
55 Frankenstein 59.88 51.68 56.78 65.13 56.21 57.68 59.33 51.26 53.19 -0.96 -1.19 -1.38 -0.94 -1.21 -1.38 -0.92 -1.19 -1.37 59.88 51.68 64.43 65.13 56.21 64.74 59.33 51.26 59.80 -1.47 -1.76 -1.25 -1.45 -1.75 -1.30 -1.43 -1.73 -1.26 Frankenstein 55
56 GS−MetaServer2 53.23 47.45 53.91 57.90 51.61 54.78 52.58 46.89 50.57 -1.63 -1.57 -1.61 -1.62 -1.60 -1.61 -1.63 -1.62 -1.61 53.23 47.45 53.91 57.90 51.61 54.78 52.58 46.89 50.57 -2.29 -2.22 -2.31 -2.28 -2.22 -2.32 -2.29 -2.24 -2.30 GS−MetaServer2 56
57 forecast 52.62 44.96 53.80 57.24 48.90 54.69 52.38 44.71 51.05 -1.69 -1.80 -1.62 -1.68 -1.84 -1.62 -1.65 -1.83 -1.57 59.07 55.17 61.77 64.25 60.02 62.67 58.13 54.30 57.47 -1.57 -1.38 -1.52 -1.55 -1.36 -1.51 -1.58 -1.38 -1.53 forecast 57
58 3D−JIGSAW_AEP 51.41 46.44 52.34 55.92 51.53 53.60 51.59 47.49 49.43 -1.81 -1.66 -1.74 -1.80 -1.61 -1.71 -1.73 -1.56 -1.71 52.02 49.19 52.62 56.58 53.51 53.62 51.79 48.28 49.43 -2.44 -2.03 -2.44 -2.44 -2.02 -2.44 -2.39 -2.08 -2.43 3D−JIGSAW_AEP 58
59 ACOMPMOD 50.40 45.97 46.04 54.83 50.00 47.08 49.60 45.24 43.73 -1.91 -1.71 -2.25 -1.90 -1.74 -2.24 -1.94 -1.78 -2.23 55.24 51.08 51.38 60.09 55.56 52.40 54.37 50.13 48.41 -2.04 -1.82 -2.56 -2.03 -1.81 -2.56 -2.06 -1.86 -2.55 ACOMPMOD 59
60 MUFOLD−Server 48.59 40.79 47.11 52.85 44.37 48.37 48.61 40.28 44.23 -2.09 -2.18 -2.16 -2.09 -2.23 -2.14 -2.04 -2.26 -2.18 48.59 41.26 47.27 52.85 44.66 48.61 48.61 40.87 44.50 -2.87 -2.90 -2.98 -2.87 -2.92 -2.95 -2.80 -2.93 -2.99 MUFOLD−Server 60
61 panther_server 47.58 42.47 50.35 51.75 46.20 51.05 46.83 41.80 47.32 -2.19 -2.03 -1.90 -2.19 -2.07 -1.92 -2.23 -2.12 -1.90 53.43 49.26 51.02 58.11 53.58 51.72 52.58 49.41 48.04 -2.27 -2.02 -2.60 -2.26 -2.02 -2.63 -2.29 -1.95 -2.59 panther_server 61
62 FOLDpro 44.56 34.61 41.07 48.03 41.16 41.74 43.45 38.43 38.72 -2.50 -2.74 -2.65 -2.54 -2.51 -2.68 -2.58 -2.44 -2.68 52.02 44.76 51.19 56.36 48.47 51.88 50.99 43.85 47.85 -2.44 -2.51 -2.58 -2.46 -2.54 -2.61 -2.49 -2.59 -2.61 FOLDpro 62
63 rehtnap 41.13 36.29 39.96 44.74 39.47 40.74 40.48 35.32 37.78 -2.84 -2.59 -2.74 -2.84 -2.65 -2.76 -2.89 -2.75 -2.76 41.13 36.29 39.96 44.74 39.47 40.74 40.48 35.32 37.78 -3.79 -3.44 -3.72 -3.80 -3.45 -3.75 -3.84 -3.58 -3.74 rehtnap 63
64 MUFOLD−MD 21.17 18.35 28.55 22.81 19.74 29.52 20.44 17.66 27.52 -4.84 -4.22 -3.66 -4.89 -4.36 -3.67 -4.98 -4.47 -3.69 21.17 18.35 29.41 22.81 19.74 30.12 20.44 17.66 28.84 -6.26 -5.40 -4.78 -6.32 -5.46 -4.84 -6.40 -5.62 -4.75 MUFOLD−MD 64
65 RBO−Proteus 17.34 16.13 26.38 18.86 17.54 27.19 17.06 15.87 25.89 -5.23 -4.43 -3.84 -5.26 -4.55 -3.86 -5.33 -4.65 -3.84 20.77 19.56 26.84 22.37 21.05 27.43 23.02 21.82 26.16 -6.31 -5.27 -5.04 -6.37 -5.32 -5.11 -6.07 -5.14 -5.05 RBO−Proteus 65
66 mariner1 14.72 12.70 17.21 16.01 13.82 20.14 14.48 12.50 17.34 -5.49 -4.74 -4.58 -5.52 -4.87 -4.44 -5.60 -4.98 -4.61 55.85 44.56 61.92 60.53 48.83 62.71 54.56 44.58 57.62 -1.97 -2.54 -1.50 -1.98 -2.50 -1.51 -2.04 -2.50 -1.51 mariner1 66
67 mahmood−torda−server 13.71 11.29 16.59 14.47 9.50 17.93 13.89 10.58 16.98 -5.59 -4.87 -4.63 -5.66 -5.24 -4.62 -5.66 -5.17 -4.64 13.91 11.56 18.71 15.13 12.35 19.97 13.89 11.64 18.54 -7.16 -6.15 -5.86 -7.20 -6.21 -5.88 -7.24 -6.32 -5.91 mahmood−torda−server 67
68 RANDOM 13.38 11.41 13.38 15.01 12.67 15.01 14.36 12.03 14.36 -5.63 -4.86 -4.89 -5.61 -4.97 -4.86 -5.61 -5.02 -4.88 13.38 11.41 13.38 15.01 12.67 15.01 14.36 12.03 14.36 -7.23 -6.16 -6.40 -7.22 -6.18 -6.38 -7.18 -6.27 -6.38 RANDOM 68
69 OLGAFS 11.89 10.42 4.78 12.94 11.11 6.96 11.90 9.46 6.27 -5.77 -4.95 -5.58 -5.81 -5.11 -5.51 -5.87 -5.28 -5.61 11.89 10.55 6.37 13.16 11.40 9.35 12.10 10.12 7.57 -7.41 -6.26 -7.11 -7.43 -6.30 -6.96 -7.47 -6.49 -7.14 OLGAFS 69
70 huber−torda−server 11.09 9.61 5.85 12.06 10.45 8.20 11.31 9.85 7.45 -5.86 -5.02 -5.49 -5.89 -5.16 -5.41 -5.93 -5.24 -5.50 64.31 59.74 69.85 69.96 64.98 71.88 63.29 58.53 64.79 -0.92 -0.88 -0.70 -0.90 -0.86 -0.57 -0.92 -0.89 -0.70 huber−torda−server 70
71 schenk−torda−server 11.09 9.41 14.28 11.84 10.31 14.95 11.31 10.52 14.71 -5.86 -5.04 -4.81 -5.91 -5.17 -4.86 -5.93 -5.17 -4.85 15.12 13.37 15.98 16.45 14.55 16.93 14.88 13.56 16.59 -7.01 -5.95 -6.14 -7.05 -5.98 -6.19 -7.11 -6.09 -6.13 schenk−torda−server 71
72 BHAGEERATH                                                       -5.63 -4.86 -4.89 -5.61 -4.97 -4.86 -5.61 -5.02 -4.88                                                       -7.23 -6.16 -6.40 -7.22 -6.18 -6.38 -7.18 -6.27 -6.38 BHAGEERATH 72
73 Fiser−M4T                                                       -5.63 -4.86 -4.89 -5.61 -4.97 -4.86 -5.61 -5.02 -4.88                                                       -7.23 -6.16 -6.40 -7.22 -6.18 -6.38 -7.18 -6.27 -6.38 Fiser−M4T 73
74 test_http_server_01                                                       -5.63 -4.86 -4.89 -5.61 -4.97 -4.86 -5.61 -5.02 -4.88                                                       -7.23 -6.16 -6.40 -7.22 -6.18 -6.38 -7.18 -6.27 -6.38 test_http_server_01 74