T0432

Server only Targets
388 390 392 394
398 400 402 404
406 408 410 412
414 416 418 420
422 424 426 428
430 432 433 435
436 438 439 441
442 444 445 447
448 450 452 453
455 456 458 459
461 463 470 472
475 477 478 479
481 483 485 486
488 490 491 494
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514  

T0432

bromodomain of ATAD2A from Homo sapiens

Target type: Server only

Target sequence:

>T0432 ATAD2A, Homo sapiens, 130 residues
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR

Structure:
Method: X-ray, res=1.95Å, R/Rfree=0.20/0.24
Determined by: SGC
PDB ID: 3dai

3dai cartoon
Cartoon diagram of 432:

PyMOL of 3dai

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

Bromodomain 4-helical bundle fold.

CASP category:

Comparative modeling:easy.

Closest templates:

2dkw.

Target sequence - PDB file inconsistencies:

T0432    3dai.pdb    T0432.pdb    PyMOL    PyMOL of domains    

T0432    1 SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR 130
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3daiA  979 SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR 1108

Single domain protein: target 1-130 ; pdb 979-1108

Sequence classification:

Bromodomain family in Pfam.

Server predictions:

T0432:pdb 979-1108:seq 1-130:CM_easy;   alignment

distribution of first scores
First models for T0432: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0432 T0432 T0432 T0432
First score First Z-score Best score Best Z-score
1 Phyre_de_novo 90.58 87.50 85.60 1.68 1.23 1.52 90.58 87.50 85.60 1.77 1.23 1.68 Phyre_de_novo 1
2 MULTICOM−REFINE 89.61 85.26 85.98 1.55 1.05 1.56 90.00 88.72 85.98 1.67 1.34 1.73 MULTICOM−REFINE 2
3 MULTICOM−RANK 89.23 86.67 83.80 1.50 1.16 1.33 89.61 88.14 84.02 1.61 1.29 1.45 MULTICOM−RANK 3
4 LEE−SERVER 88.46 87.18 82.84 1.40 1.20 1.22 88.65 87.18 82.84 1.45 1.20 1.28 LEE−SERVER 4
5 MUProt 88.46 86.80 85.08 1.40 1.17 1.46 91.54 88.33 86.27 1.92 1.31 1.78 MUProt 5
6 Zhang−Server 88.27 87.24 86.22 1.37 1.21 1.59 90.96 90.45 87.32 1.83 1.51 1.93 Zhang−Server 6
7 3DShot2 86.92 80.90 75.00 1.19 0.71 0.39 86.92 80.90 75.00 1.17 0.60 0.15 3DShot2 7
8 FEIG 86.54 85.39 81.62 1.14 1.06 1.09 86.54 85.39 81.71 1.11 1.03 1.12 FEIG 8
9 METATASSER 84.61 83.46 77.15 0.88 0.91 0.62 87.50 83.46 84.60 1.27 0.84 1.53 METATASSER 9
10 COMA−M 84.23 81.03 80.97 0.83 0.72 1.02 84.23 82.24 80.97 0.73 0.73 1.01 COMA−M 10
11 YASARA 82.89 80.06 75.43 0.65 0.64 0.43 82.89 80.06 75.43 0.52 0.52 0.21 YASARA 11
12 pro−sp3−TASSER 82.69 80.90 77.96 0.63 0.71 0.70 89.04 86.86 87.20 1.52 1.17 1.91 pro−sp3−TASSER 12
13 MUSTER 82.50 80.58 75.60 0.60 0.68 0.45 82.50 80.58 77.72 0.45 0.57 0.54 MUSTER 13
14 RAPTOR 82.11 80.70 75.61 0.55 0.69 0.45 82.11 80.70 75.61 0.39 0.58 0.24 RAPTOR 14
15 keasar−server 82.11 76.47 76.39 0.55 0.35 0.53 83.46 80.64 77.92 0.61 0.57 0.57 keasar−server 15
16 FFASsuboptimal 81.73 80.32 75.09 0.50 0.66 0.40 81.73 80.32 75.19 0.33 0.54 0.18 FFASsuboptimal 16
17 PSI 81.54 80.00 75.24 0.47 0.63 0.41 81.54 80.00 75.24 0.30 0.51 0.18 PSI 17
18 HHpred4 81.54 79.49 76.13 0.47 0.59 0.51 81.54 79.49 76.13 0.30 0.46 0.31 HHpred4 18
19 Poing 81.54 78.46 73.88 0.47 0.51 0.27 81.54 78.46 73.88 0.30 0.37 -0.01 Poing 19
20 Phragment 81.54 78.46 73.85 0.47 0.51 0.26 81.54 78.46 73.85 0.30 0.37 -0.02 Phragment 20
21 forecast 81.35 80.32 74.61 0.45 0.66 0.34 81.73 80.32 75.99 0.33 0.54 0.29 forecast 21
22 FAMSD 81.35 78.40 74.56 0.45 0.51 0.34 81.35 78.40 75.00 0.26 0.36 0.15 FAMSD 22
23 Phyre2 81.35 78.27 73.85 0.45 0.50 0.26 81.35 78.27 73.85 0.26 0.35 -0.02 Phyre2 23
24 3Dpro 81.15 79.87 72.74 0.42 0.62 0.14 81.35 79.87 72.94 0.26 0.50 -0.15 3Dpro 24
25 circle 81.15 78.46 74.62 0.42 0.51 0.35 82.11 78.46 78.64 0.39 0.37 0.67 circle 25
26 GS−KudlatyPred 81.15 69.49 77.85 0.42 -0.20 0.69 81.54 80.64 77.85 0.30 0.57 0.56 GS−KudlatyPred 26
27 HHpred2 80.96 79.94 75.17 0.40 0.63 0.40 80.96 79.94 75.17 0.20 0.51 0.17 HHpred2 27
28 HHpred5 80.96 79.94 75.17 0.40 0.63 0.40 80.96 79.94 75.17 0.20 0.51 0.17 HHpred5 28
29 fais−server 80.96 79.30 74.91 0.40 0.58 0.38 81.35 80.06 74.99 0.26 0.52 0.15 fais−server 29
30 PS2−server 80.96 79.04 74.79 0.40 0.56 0.36 80.96 79.04 75.37 0.20 0.42 0.20 PS2−server 30
31 FFASstandard 80.96 78.91 74.66 0.40 0.55 0.35 80.96 78.91 74.66 0.20 0.41 0.10 FFASstandard 31
32 FFASflextemplate 80.96 78.91 74.66 0.40 0.55 0.35 81.35 78.91 75.17 0.26 0.41 0.17 FFASflextemplate 32
33 Distill 80.77 79.10 71.09 0.37 0.56 -0.03 80.77 79.10 71.15 0.17 0.43 -0.41 Distill 33
34 BAKER−ROBETTA 80.58 78.53 73.69 0.34 0.52 0.25 81.92 80.77 79.60 0.36 0.59 0.81 BAKER−ROBETTA 34
35 mGenTHREADER 80.58 77.76 71.46 0.34 0.46 0.01 80.58 77.76 71.46 0.14 0.30 -0.36 mGenTHREADER 35
36 FALCON 80.58 76.60 73.88 0.34 0.36 0.27 80.58 76.60 73.88 0.14 0.19 -0.01 FALCON 36
37 COMA 80.39 78.08 76.07 0.32 0.48 0.50 80.39 78.08 80.97 0.11 0.33 1.01 COMA 37
38 LOOPP_Server 80.39 73.97 75.22 0.32 0.16 0.41 80.39 75.96 75.22 0.11 0.13 0.18 LOOPP_Server 38
39 huber−torda−server 80.19 76.35 69.71 0.29 0.34 -0.18 80.19 76.35 69.71 0.08 0.16 -0.62 huber−torda−server 39
40 CpHModels 80.00 77.95 76.34 0.27 0.47 0.53 80.00 77.95 76.34 0.04 0.32 0.34 CpHModels 40
41 BioSerf 79.81 78.27 73.15 0.24 0.50 0.19 79.81 78.27 73.15 0.01 0.35 -0.12 BioSerf 41
42 MULTICOM−CMFR 79.81 77.89 72.33 0.24 0.47 0.10 79.81 77.89 72.33 0.01 0.31 -0.24 MULTICOM−CMFR 42
43 Fiser−M4T 78.85 76.80 71.03 0.11 0.38 -0.04 78.85 76.80 71.03 -0.14 0.21 -0.43 Fiser−M4T 43
44 ACOMPMOD 78.27 47.63 75.48 0.04 -1.94 0.44 78.27 47.63 75.48 -0.24 -2.57 0.22 ACOMPMOD 44
45 Pushchino 78.08 73.59 67.39 0.01 0.13 -0.43 78.08 73.59 67.39 -0.27 -0.10 -0.95 Pushchino 45
46 SAM−T08−server 77.50 74.42 78.09 -0.07 0.19 0.72 78.27 74.42 78.09 -0.24 -0.02 0.59 SAM−T08−server 46
47 panther_server 77.50 72.89 62.39 -0.07 0.07 -0.96 77.50 72.89 62.39 -0.36 -0.17 -1.67 panther_server 47
48 mariner1 77.50 65.58 72.97 -0.07 -0.51 0.17 80.77 70.77 75.49 0.17 -0.37 0.22 mariner1 48
49 MULTICOM−CLUSTER 76.15 68.85 74.40 -0.25 -0.25 0.32 83.46 82.31 76.92 0.61 0.73 0.43 MULTICOM−CLUSTER 49
50 pipe_int 75.39 70.51 73.31 -0.35 -0.12 0.21 82.31 78.97 76.19 0.42 0.41 0.32 pipe_int 50
51 Pcons_local 73.27 59.42 60.83 -0.63 -1.00 -1.13 80.00 69.81 76.55 0.04 -0.46 0.37 Pcons_local 51
52 3D−JIGSAW_AEP 72.50 62.24 67.02 -0.74 -0.78 -0.47 74.23 66.67 67.02 -0.89 -0.76 -1.00 3D−JIGSAW_AEP 52
53 GeneSilicoMetaServer 70.39 51.15 55.79 -1.02 -1.66 -1.67 75.39 58.33 67.26 -0.71 -1.55 -0.97 GeneSilicoMetaServer 53
54 SAM−T06−server 69.42 48.20 75.83 -1.15 -1.89 0.48 69.42 50.26 75.83 -1.68 -2.32 0.27 SAM−T06−server 54
55 3D−JIGSAW_V3 68.65 57.76 68.99 -1.25 -1.13 -0.26 68.65 64.49 68.99 -1.80 -0.97 -0.72 3D−JIGSAW_V3 55
56 MUFOLD−Server 66.73 60.32 62.77 -1.51 -0.93 -0.92 67.11 60.96 63.55 -2.05 -1.30 -1.51 MUFOLD−Server 56
57 SAM−T02−server 66.15 39.55 49.55 -1.59 -2.58 -2.33 66.15 44.42 49.55 -2.21 -2.88 -3.53 SAM−T02−server 57
58 FALCON_CONSENSUS 65.58 49.17 62.94 -1.66 -1.81 -0.90 65.58 49.17 62.94 -2.30 -2.43 -1.59 FALCON_CONSENSUS 58
59 Frankenstein 64.61 44.23 66.60 -1.79 -2.21 -0.51 71.92 66.28 66.60 -1.27 -0.80 -1.07 Frankenstein 59
60 FOLDpro 64.42 59.81 56.72 -1.82 -0.97 -1.57 66.54 59.87 57.31 -2.15 -1.41 -2.41 FOLDpro 60
61 Pcons_dot_net 63.46 48.78 50.60 -1.95 -1.85 -2.22 73.27 59.42 67.10 -1.05 -1.45 -0.99 Pcons_dot_net 61
62 Pcons_multi 63.46 48.78 50.60 -1.95 -1.85 -2.22 75.00 50.58 69.11 -0.77 -2.29 -0.70 Pcons_multi 62
63 FUGUE_KM 62.31 48.91 48.26 -2.10 -1.84 -2.47 70.58 48.91 68.00 -1.49 -2.45 -0.86 FUGUE_KM 63
64 GS−MetaServer2 60.00 51.92 46.09 -2.41 -1.60 -2.70 63.85 56.41 49.30 -2.59 -1.74 -3.56 GS−MetaServer2 64
65 nFOLD3 59.04 53.53 42.14 -2.54 -1.47 -3.13 73.85 70.00 67.40 -0.96 -0.44 -0.95 nFOLD3 65
66 OLGAFS 52.50 39.68 33.89 -3.41 -2.57 -4.01 56.92 56.28 43.03 -3.71 -1.75 -4.47 OLGAFS 66
67 RBO−Proteus 39.23 32.31 46.10 -5.19 -3.15 -2.70 39.23 32.31 48.95 -6.60 -4.04 -3.62 RBO−Proteus 67
68 rehtnap 37.12 31.09 14.73 -5.47 -3.25 -6.06 58.08 49.87 39.96 -3.53 -2.36 -4.91 rehtnap 68
69 MUFOLD−MD 36.92 28.08 47.32 -5.50 -3.49 -2.57 51.35 44.81 60.41 -4.62 -2.84 -1.96 MUFOLD−MD 69
70 RANDOM 22.35 19.67 22.35 -7.45 -4.16 -5.24 22.35 19.67 22.35 -9.34 -5.24 -7.46 RANDOM 70
71 BHAGEERATH 21.15 20.39 35.28 -7.61 -4.10 -3.86 25.39 21.99 35.28 -8.85 -5.02 -5.59 BHAGEERATH 71
72 schenk−torda−server 18.65 15.71 6.34 -7.94 -4.47 -6.95 18.65 15.71 6.34 -9.95 -5.62 -9.77 schenk−torda−server 72
73 mahmood−torda−server 16.54 13.21 4.46 -8.22 -4.67 -7.15 17.69 14.68 11.15 -10.10 -5.72 -9.08 mahmood−torda−server 73
74 test_http_server_01                   -7.45 -4.16 -5.24                   -9.34 -5.24 -7.46 test_http_server_01 74