T0392

PDZ domain of Rhophilin-2 Homo sapiens

Target sequence:

>T0392 RHPN2A, Homo sapiens, 109 residues
MHHHHHHSSGVDLGTENLYFQSMPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLLDEVTF

Structure:

Method: X-ray, res=1.82Å, R/Rfree=0.22/0.27

Determined by: SGC

PDB ID: 2vsv

392_2vsv:A,B
Ribbon diagram of 392: 2vsv chains A (white) and B (rainbow)

PyMOL of 2vsv

Domains: PyMOL of domains

Single domain protein. However, 1-23 (target numbers, and -23-0 in PDB numbers) are introduced in cloning, protrude away from the domain in 3D structure (interact with another chain, see above) and can be deleted for domain evaluation.

392 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation (without N-terminal segment, y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

PDZ domain fold.

2vsv_B:514-594 cartoon
Cartoon diagram of 392: 2vsv chain B residues 514-595

CASP category:

Whole chain: Comparative modeling:medium.

1st domain(with N-terminal segment seq:1-23 removed): Comparative modeling:easy.

Closest templates:

1vae

Target sequence - PDB file inconsistencies:

The most complete chain B is missing only the C-terminus 105-DEVTF-109. PDB numbering is different from the target. PDB coordinates are from -22 to 0 and from 514 to 594, which corresponds to the target 1 to 104.

T0392 2vsv.pdb T0392.pdb PyMOL PyMOL of domains

T0392    1 MHHHHHHSSGVDLGTENLYFQSMPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLLDEVTF 109
           ~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~
2vsvA  -15 -------SSGVDLGTENLYFQSMPRSIRFTAEEGDLGFTLRGNAPVQVHFLDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLL----- 594

We suggest to evaluate this target as a single domain spanning whole chain. However, N-termial segment (target 1-23, pdb -15-0) is introduced in cloning, protrudes away from the domain in 3D structure (interact with another chain) and can be deleted for domain evaluation, resulting in this domain definition:

1st domain: target 24-104 ; pdb 514-594

Sequence classification:

PDZ signaling domain in CDD.

Server predictions:

T0392:pdb -15-594:seq 8-104:CM_medium; alignment

distribution of
first scores
First models for T0392: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

392_1:pdb 514-594:seq 24-104:CM_easy; alignment

distribution of
first scores
First models for T0392_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

#	GROUP ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	TS ↓	TR ↓	CS ↓	↓ GROUP	#
		T0392			392_1			T0392			392_1			T0392			392_1			T0392			392_1
		First score						First Z-score						Best score						Best Z-score
1	pro−sp3−TASSER	80.67	76.38	78.22	91.36	89.71	86.79	1.95	2.41	1.82	1.55	2.34	1.64	80.67	76.38	78.22	92.28	89.71	86.79	1.89	1.80	1.72	1.93	1.92	1.70	pro−sp3−TASSER	1
2	MULTICOM−RANK	80.41	79.72	76.57	92.28	91.46	85.86	1.87	3.28	1.42	1.81	2.68	1.41	80.41	79.72	76.57	92.28	91.46	85.86	1.79	2.70	1.25	1.93	2.31	1.39	MULTICOM−RANK	2
3	Zhang−Server	79.12	77.75	77.35	90.74	89.09	85.18	1.48	2.77	1.61	1.38	2.22	1.24	80.67	79.30	79.76	92.59	91.36	87.67	1.89	2.59	2.16	2.05	2.29	1.99	Zhang−Server	3
4	MULTICOM−CMFR	78.09	69.16	74.78	87.35	76.65	81.27	1.16	0.55	0.97	0.44	-0.21	0.27	78.09	69.16	74.78	87.35	81.28	81.27	0.95	-0.16	0.74	0.05	0.07	-0.11	MULTICOM−CMFR	4
5	FFASsuboptimal	78.09	68.73	73.60	87.35	76.03	81.23	1.16	0.44	0.68	0.44	-0.33	0.26	78.09	68.73	74.43	87.96	77.47	81.43	0.95	-0.28	0.65	0.28	-0.77	-0.05	FFASsuboptimal	5
6	Phyre_de_novo	78.09	68.47	75.76	87.96	76.85	82.73	1.16	0.37	1.22	0.61	-0.17	0.64	78.09	71.56	75.76	87.96	82.51	82.73	0.95	0.49	1.02	0.28	0.34	0.37	Phyre_de_novo	6
7	FEIG	77.83	66.84	72.96	87.35	75.82	81.67	1.08	-0.05	0.53	0.44	-0.37	0.37	77.83	72.42	72.96	87.65	79.32	81.67	0.86	0.72	0.23	0.16	-0.36	0.02	FEIG	7
8	BAKER−ROBETTA	77.58	68.21	73.94	87.96	76.65	81.43	1.01	0.30	0.77	0.61	-0.21	0.31	78.87	76.63	74.77	89.20	87.14	82.48	1.23	1.87	0.74	0.75	1.36	0.29	BAKER−ROBETTA	8
9	FALCON	77.32	74.74	75.55	88.58	86.52	85.16	0.93	1.99	1.16	0.78	1.72	1.24	77.58	75.17	76.66	88.58	86.52	86.29	0.76	1.47	1.28	0.52	1.22	1.53	FALCON	9
10	3DShot2	77.06	73.97	71.84	88.27	84.57	81.10	0.85	1.79	0.25	0.69	1.34	0.23	77.06	73.97	71.84	88.27	84.57	81.10	0.58	1.14	-0.09	0.40	0.79	-0.16	3DShot2	10
11	nFOLD3	77.06	68.13	73.21	87.65	76.95	81.48	0.85	0.28	0.59	0.52	-0.15	0.33	77.58	75.00	73.30	88.89	86.42	82.53	0.76	1.42	0.32	0.64	1.20	0.30	nFOLD3	11
12	huber−torda−server	76.80	67.44	72.22	87.96	76.65	81.43	0.77	0.10	0.34	0.61	-0.21	0.31	76.80	67.44	72.22	87.96	80.25	81.43	0.48	-0.63	0.02	0.28	-0.16	-0.05	huber−torda−server	12
13	MUProt	76.55	69.33	74.23	87.04	84.16	82.37	0.69	0.59	0.84	0.35	1.26	0.55	76.55	73.37	74.23	88.27	85.80	82.89	0.39	0.98	0.59	0.40	1.06	0.42	MUProt	13
14	LEE−SERVER	76.55	68.30	74.89	87.65	77.78	82.14	0.69	0.33	1.00	0.52	0.01	0.49	77.32	69.42	75.15	87.96	78.50	82.31	0.67	-0.09	0.85	0.28	-0.54	0.23	LEE−SERVER	14
15	FAMSD	76.55	67.53	72.42	87.65	76.75	81.10	0.69	0.13	0.39	0.52	-0.19	0.23	76.55	69.24	72.42	87.65	81.38	81.10	0.39	-0.14	0.07	0.16	0.09	-0.16	FAMSD	15
16	Phyre2	76.55	67.18	72.80	87.96	76.65	81.43	0.69	0.04	0.49	0.61	-0.21	0.31	76.55	71.82	72.80	87.96	82.92	81.43	0.39	0.56	0.18	0.28	0.43	-0.05	Phyre2	16
17	circle	76.29	67.95	73.26	87.35	77.26	81.27	0.61	0.24	0.60	0.44	-0.09	0.27	76.55	69.33	73.30	87.35	79.94	81.27	0.39	-0.11	0.32	0.05	-0.23	-0.11	circle	17
18	3Dpro	76.29	67.35	73.45	87.65	76.95	81.32	0.61	0.08	0.65	0.52	-0.15	0.29	76.29	67.35	73.45	87.65	76.95	81.32	0.30	-0.65	0.37	0.16	-0.89	-0.09	3Dpro	18
19	Poing	76.29	66.92	72.84	87.96	76.65	81.43	0.61	-0.03	0.50	0.61	-0.21	0.31	76.29	71.65	72.84	87.96	82.92	81.43	0.30	0.52	0.19	0.28	0.43	-0.05	Poing	19
20	Phragment	76.29	66.92	72.83	87.96	76.65	81.43	0.61	-0.03	0.49	0.61	-0.21	0.31	76.29	71.65	72.83	87.96	82.92	81.43	0.30	0.52	0.19	0.28	0.43	-0.05	Phragment	20
21	SAM−T08−server	76.29	66.50	75.33	88.27	84.98	83.45	0.61	-0.14	1.11	0.69	1.42	0.81	76.29	71.82	75.33	88.27	85.08	83.45	0.30	0.56	0.90	0.40	0.90	0.61	SAM−T08−server	21
22	HHpred2	76.03	68.99	73.19	87.35	78.91	81.29	0.53	0.50	0.58	0.44	0.24	0.28	76.03	68.99	73.19	87.35	78.91	81.29	0.20	-0.21	0.29	0.05	-0.45	-0.10	HHpred2	22
23	mGenTHREADER	76.03	66.67	71.63	87.96	76.65	81.43	0.53	-0.10	0.20	0.61	-0.21	0.31	76.03	66.67	71.63	87.96	76.65	81.43	0.20	-0.83	-0.15	0.28	-0.95	-0.05	mGenTHREADER	23
24	MUSTER	76.03	65.98	73.45	87.35	75.21	81.30	0.53	-0.27	0.65	0.44	-0.49	0.28	77.58	71.73	74.00	89.51	82.92	82.60	0.76	0.54	0.52	0.87	0.43	0.33	MUSTER	24
25	PS2−server	76.03	61.94	72.55	87.65	70.78	81.37	0.53	-1.32	0.42	0.52	-1.35	0.30	76.03	73.02	72.55	87.65	82.41	81.37	0.20	0.89	0.11	0.16	0.32	-0.07	PS2−server	25
26	Pcons_local	75.77	68.90	70.45	88.89	84.36	82.86	0.45	0.48	-0.09	0.87	1.30	0.67	76.03	71.56	70.45	88.89	84.98	82.86	0.20	0.49	-0.49	0.64	0.88	0.41	Pcons_local	26
27	YASARA	75.77	68.90	76.37	88.27	80.04	84.97	0.45	0.48	1.37	0.69	0.46	1.19	75.77	68.90	76.37	88.27	80.04	84.97	0.11	-0.23	1.20	0.40	-0.21	1.10	YASARA	27
28	keasar−server	75.77	65.72	71.63	87.96	75.82	81.57	0.45	-0.34	0.20	0.61	-0.37	0.35	76.03	67.44	72.27	87.96	77.88	82.07	0.20	-0.63	0.03	0.28	-0.68	0.15	keasar−server	28
29	forecast	75.52	66.15	72.69	87.04	75.72	81.56	0.38	-0.23	0.46	0.35	-0.39	0.35	75.52	66.15	72.69	87.04	83.54	81.58	0.02	-0.98	0.15	-0.07	0.57	-0.01	forecast	29
30	PSI	75.52	65.89	73.07	86.73	75.21	81.09	0.38	-0.30	0.55	0.27	-0.49	0.23	76.29	72.34	73.07	88.89	84.36	81.85	0.30	0.70	0.26	0.64	0.75	0.08	PSI	30
31	MULTICOM−REFINE	75.26	71.48	73.09	88.27	83.95	83.32	0.30	1.15	0.56	0.69	1.22	0.78	76.55	72.25	74.08	88.27	83.95	83.32	0.39	0.68	0.55	0.40	0.66	0.56	MULTICOM−REFINE	31
32	Fiser−M4T	75.26	68.39	69.18	87.65	79.42	81.20	0.30	0.35	-0.41	0.52	0.33	0.26	75.26	68.39	69.18	87.65	79.42	81.20	-0.08	-0.37	-0.85	0.16	-0.34	-0.13	Fiser−M4T	32
33	ACOMPMOD	75.00	68.64	73.64	88.27	82.92	86.22	0.22	0.41	0.69	0.69	1.02	1.50	75.00	68.64	73.64	88.27	82.92	86.22	-0.17	-0.30	0.42	0.40	0.43	1.51	ACOMPMOD	33
34	OLGAFS	75.00	66.41	70.86	87.96	76.44	81.43	0.22	-0.16	0.01	0.61	-0.25	0.31	75.00	66.41	70.86	87.96	76.44	81.43	-0.17	-0.91	-0.37	0.28	-1.00	-0.05	OLGAFS	34
35	Pcons_dot_net	74.48	71.91	73.59	87.65	85.19	86.06	0.06	1.26	0.68	0.52	1.46	1.46	75.77	71.91	73.59	88.89	85.19	86.06	0.11	0.59	0.41	0.64	0.93	1.46	Pcons_dot_net	35
36	Pcons_multi	74.48	71.91	73.59	87.65	85.19	86.06	0.06	1.26	0.68	0.52	1.46	1.46	79.90	74.91	74.68	89.81	86.52	86.06	1.61	1.40	0.72	0.99	1.22	1.46	Pcons_multi	36
37	FUGUE_KM	74.48	71.73	72.27	87.96	85.70	84.96	0.06	1.21	0.36	0.61	1.56	1.19	74.48	71.73	72.27	87.96	85.70	84.96	-0.36	0.54	0.03	0.28	1.04	1.10	FUGUE_KM	37
38	FFASstandard	74.48	65.21	68.29	87.96	76.85	81.31	0.06	-0.47	-0.63	0.61	-0.17	0.28	74.48	65.21	71.44	87.96	76.85	81.43	-0.36	-1.23	-0.21	0.28	-0.91	-0.05	FFASstandard	38
39	FFASflextemplate	74.48	65.21	68.29	87.96	76.85	81.31	0.06	-0.47	-0.63	0.61	-0.17	0.28	74.48	65.21	68.36	87.96	76.85	81.43	-0.36	-1.23	-1.08	0.28	-0.91	-0.05	FFASflextemplate	39
40	GeneSilicoMetaServer	74.23	66.15	67.04	86.42	84.36	79.20	-0.02	-0.23	-0.93	0.18	1.30	-0.24	74.48	71.73	72.32	87.65	85.19	84.41	-0.36	0.54	0.04	0.16	0.93	0.92	GeneSilicoMetaServer	40
41	CpHModels	74.23	60.48	70.78	86.42	69.96	83.03	-0.02	-1.70	-0.01	0.18	-1.51	0.71	74.23	60.48	70.78	86.42	69.96	83.03	-0.45	-2.51	-0.39	-0.30	-2.42	0.47	CpHModels	41
42	MUFOLD−Server	73.97	69.33	73.33	86.42	81.28	80.74	-0.09	0.59	0.62	0.18	0.70	0.14	74.48	69.59	73.38	87.35	81.28	81.39	-0.36	-0.04	0.35	0.05	0.07	-0.07	MUFOLD−Server	42
43	RAPTOR	73.71	71.65	71.05	84.88	82.41	80.07	-0.17	1.19	0.05	-0.25	0.92	-0.02	78.09	73.28	76.65	88.89	84.77	85.48	0.95	0.96	1.28	0.64	0.84	1.27	RAPTOR	43
44	MULTICOM−CLUSTER	73.45	69.50	71.78	86.42	81.69	81.57	-0.25	0.64	0.23	0.18	0.78	0.35	77.32	73.11	75.49	87.96	83.75	82.60	0.67	0.91	0.95	0.28	0.61	0.33	MULTICOM−CLUSTER	44
45	COMA	73.45	68.47	68.08	86.42	80.66	80.01	-0.25	0.37	-0.68	0.18	0.58	-0.04	73.45	68.47	68.08	86.42	80.66	80.01	-0.73	-0.35	-1.16	-0.30	-0.07	-0.52	COMA	45
46	rehtnap	73.20	69.42	68.57	84.88	80.35	78.88	-0.33	0.61	-0.56	-0.25	0.52	-0.32	74.48	71.05	68.92	86.42	81.89	79.53	-0.36	0.35	-0.92	-0.30	0.20	-0.68	rehtnap	46
47	BioSerf	72.94	60.74	70.64	86.73	72.33	79.41	-0.41	-1.63	-0.05	0.27	-1.05	-0.19	72.94	60.74	70.64	86.73	72.33	79.41	-0.92	-2.44	-0.43	-0.19	-1.90	-0.72	BioSerf	47
48	fais−server	71.91	67.27	67.55	81.79	76.44	77.64	-0.72	0.06	-0.81	-1.11	-0.25	-0.62	76.03	67.27	72.07	87.65	77.26	81.41	0.20	-0.67	-0.03	0.16	-0.82	-0.06	fais−server	48
49	GS−KudlatyPred	71.65	65.12	63.56	80.25	73.05	71.21	-0.80	-0.50	-1.79	-1.54	-0.91	-2.21	71.65	65.12	63.56	80.25	73.05	71.21	-1.39	-1.26	-2.45	-2.65	-1.74	-3.40	GS−KudlatyPred	49
50	pipe_int	71.39	63.32	73.88	82.41	77.88	80.49	-0.88	-0.96	0.75	-0.94	0.03	0.08	77.58	72.25	78.00	87.96	84.88	84.53	0.76	0.68	1.66	0.28	0.86	0.96	pipe_int	50
51	Frankenstein	71.13	67.70	68.44	82.10	78.19	77.93	-0.96	0.17	-0.59	-1.02	0.09	-0.55	75.26	68.56	75.18	87.04	80.35	83.30	-0.08	-0.32	0.86	-0.07	-0.14	0.56	Frankenstein	51
52	SAM−T02−server	71.13	61.86	60.20	83.95	73.25	72.91	-0.96	-1.34	-2.62	-0.51	-0.87	-1.79	71.13	67.27	61.12	83.95	77.16	72.91	-1.58	-0.67	-3.15	-1.24	-0.84	-2.84	SAM−T02−server	52
53	mariner1	70.88	62.11	63.85	80.86	69.14	70.99	-1.04	-1.27	-1.72	-1.37	-1.67	-2.27	76.29	70.79	73.87	88.27	82.72	82.23	0.30	0.28	0.49	0.40	0.38	0.21	mariner1	53
54	METATASSER	70.62	63.57	69.99	80.56	73.35	78.53	-1.12	-0.90	-0.21	-1.45	-0.85	-0.40	77.06	71.05	75.31	89.51	82.92	84.38	0.58	0.35	0.90	0.87	0.43	0.91	METATASSER	54
55	Distill	70.36	57.82	61.22	82.72	67.69	72.04	-1.20	-2.38	-2.37	-0.85	-1.96	-2.01	70.62	63.92	64.15	83.03	70.68	75.02	-1.76	-1.58	-2.28	-1.60	-2.27	-2.15	Distill	55
56	GS−MetaServer2	70.10	63.23	61.29	78.70	71.09	70.41	-1.28	-0.98	-2.35	-1.97	-1.29	-2.41	73.97	67.70	68.73	87.65	81.07	80.71	-0.55	-0.56	-0.98	0.16	0.02	-0.29	GS−MetaServer2	56
57	panther_server	69.84	59.88	62.10	81.79	71.09	72.86	-1.36	-1.85	-2.15	-1.11	-1.29	-1.81	72.42	69.16	66.95	84.57	80.45	77.82	-1.11	-0.16	-1.49	-1.01	-0.12	-1.23	panther_server	57
58	SAM−T06−server	67.78	63.49	64.61	78.39	74.07	68.73	-1.98	-0.92	-1.53	-2.06	-0.71	-2.83	70.10	67.27	64.61	83.64	79.53	76.34	-1.95	-0.67	-2.15	-1.36	-0.32	-1.72	SAM−T06−server	58
59	HHpred4	66.75	63.66	63.07	78.09	71.30	73.19	-2.30	-0.87	-1.91	-2.14	-1.25	-1.72	66.75	63.66	63.07	78.09	71.30	73.19	-3.16	-1.65	-2.59	-3.48	-2.13	-2.75	HHpred4	59
60	HHpred5	66.75	63.66	63.07	78.09	71.30	73.19	-2.30	-0.87	-1.91	-2.14	-1.25	-1.72	66.75	63.66	63.07	78.09	71.30	73.19	-3.16	-1.65	-2.59	-3.48	-2.13	-2.75	HHpred5	60
61	3D−JIGSAW_V3	65.72	60.83	65.07	75.31	69.14	71.60	-2.61	-1.60	-1.42	-2.91	-1.67	-2.12	70.10	67.01	71.92	80.86	77.78	80.10	-1.95	-0.74	-0.07	-2.42	-0.70	-0.49	3D−JIGSAW_V3	61
62	COMA−M	65.46	59.97	64.34	76.23	69.24	73.85	-2.69	-1.83	-1.60	-2.66	-1.65	-1.56	72.68	68.73	67.51	84.26	80.56	77.55	-1.01	-0.28	-1.33	-1.13	-0.09	-1.32	COMA−M	62
63	3D−JIGSAW_AEP	64.69	60.22	69.59	75.31	69.96	76.29	-2.93	-1.76	-0.31	-2.91	-1.51	-0.96	65.98	60.48	69.59	75.93	69.96	76.57	-3.44	-2.51	-0.73	-4.30	-2.42	-1.64	3D−JIGSAW_AEP	63
64	FALCON_CONSENSUS	54.64	43.81	50.10	63.58	51.65	57.18	-5.99	-6.00	-5.11	-6.18	-5.09	-5.68	54.64	43.81	50.10	63.58	51.65	57.18	-7.56	-7.03	-6.28	-9.00	-6.45	-7.98	FALCON_CONSENSUS	64
65	MUFOLD−MD	48.97	42.95	47.22	58.64	51.44	55.64	-7.73	-6.23	-5.82	-7.55	-5.13	-6.06	48.97	42.95	47.22	58.64	51.44	55.64	-9.61	-7.27	-7.10	-10.89	-6.50	-8.49	MUFOLD−MD	65
66	FOLDpro	47.68	40.29	40.02	56.48	47.63	48.47	-8.12	-6.91	-7.60	-8.15	-5.87	-7.84	64.95	59.19	57.38	73.77	67.80	63.89	-3.82	-2.86	-4.21	-5.12	-2.90	-5.79	FOLDpro	66
67	RBO−Proteus	24.48	21.65	32.68	29.32	25.93	36.72	-15.20	-11.73	-9.41	-15.71	-10.11	-10.74	24.48	21.65	32.68	29.32	25.93	37.08	-18.50	-13.04	-11.24	-22.05	-12.12	-14.55	RBO−Proteus	67
68	mahmood−torda−server	21.91	15.38	28.43	23.46	17.49	28.98	-15.98	-13.35	-10.45	-17.34	-11.75	-12.66	21.91	17.27	28.43	23.46	18.42	28.98	-19.43	-14.23	-12.46	-24.29	-13.77	-17.20	mahmood−torda−server	68
69	RANDOM	18.64	15.40	18.64	22.31	18.03	22.31	-16.98	-13.34	-12.87	-17.66	-11.65	-14.31	18.64	15.40	18.64	22.31	18.03	22.31	-20.62	-14.74	-15.24	-24.72	-13.86	-19.38	RANDOM	69
70	schenk−torda−server	16.50	14.09	22.13	18.52	15.54	25.13	-17.64	-13.68	-12.01	-18.71	-12.14	-13.61	18.81	15.98	22.13	21.30	19.14	25.13	-20.56	-14.58	-14.25	-25.11	-13.61	-18.46	schenk−torda−server	70
71	BHAGEERATH							-16.98	-13.34	-12.87	-17.66	-11.65	-14.31							-20.62	-14.74	-15.24	-24.72	-13.86	-19.38	BHAGEERATH	71
72	LOOPP_Server							-16.98	-13.34	-12.87	-17.66	-11.65	-14.31							-20.62	-14.74	-15.24	-24.72	-13.86	-19.38	LOOPP_Server	72
73	Pushchino							-16.98	-13.34	-12.87	-17.66	-11.65	-14.31							-20.62	-14.74	-15.24	-24.72	-13.86	-19.38	Pushchino	73
74	test_http_server_01							-16.98	-13.34	-12.87	-17.66	-11.65	-14.31							-20.62	-14.74	-15.24	-24.72	-13.86	-19.38	test_http_server_01	74

Server only Targets
388	390	392	394
398	400	402	404
406	408	410	412
414	416	418	420
422	424	426	428
430	432	433	435
436	438	439	441
442	444	445	447
448	450	452	453
455	456	458	459
461	463	470	472
475	477	478	479
481	483	485	486
488	490	491	494
497	501	502	503
504	505	506	507
508	509	510	511
512	513	514