T0439

Server only Targets
388 390 392 394
398 400 402 404
406 408 410 412
414 416 418 420
422 424 426 428
430 432 433 435
436 438 439 441
442 444 445 447
448 450 452 453
455 456 458 459
461 463 470 472
475 477 478 479
481 483 485 486
488 490 491 494
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514  

T0439

TrpR binding protein WrbA Agrobacterium tumefaciens str. C58

Target type: Server only

Target sequence:

>T0439 TrpR binding protein WrbA, Agrobacterium tumefaciens str. C58, 223 residues
MIIEFLKKLLAGTPETVPAKETKRMTKVLVLYYSSYGHIETMAYAVAEGVESTGAEAVVKRVPELVPEEVAKSSHFKMDQPAPVATVDELAEYDAIIVGAGTRFGTVASQMRNFWDQTGGLWFSGKLVGKVGSAFTSSATQHGGQESTILGFIPTFLHHGMAVVGLPYAFQGQMGVDEIKGGSPYGASTITDGDGSRQPSAIELDAARYQGAHVAKLAAKLSA

Structure:
No structure will be available any time soon.
Could be determined by: MCSG

Domains:

Single domain protein.

Structure classification:

Flavodoxin fold.

CASP category:

Unknown.

Closest templates:

5nul.

Target sequence - PDB file inconsistencies:

N/A - no structure

Sequence classification:

Flavodoxin (Flavodoxin_1) family in Pfam.

Server predictions:

Will be added here at some point.