T0513

Server only Targets
388 390 392 394
398 400 402 404
406 408 410 412
414 416 418 420
422 424 426 428
430 432 433 435
436 438 439 441
442 444 445 447
448 450 452 453
455 456 458 459
461 463 470 472
475 477 478 479
481 483 485 486
488 490 491 494
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514  

T0513

MutT/Nudix family hydrolase from Rhodospirillum rubrum

Target type: Server only

Target sequence:

>T0513 MutT/nudix family protein, Rhodospirillum rubrum, 292 residues
MSFLKHVQDCNTHDLSNFVRFVIEGRRVGWVRKALAQRLKAHGRVFDVTRDAVLLSASLRTPQSRTRAVADVVDRLADEGVVPAPRGELYRVNQSWGEPTLMLLDRAVVPTFGVRAYGVHLNGYVGAGADLHLWIGRRSPDKSVAPGKLDNMVAGGQPADLSLRQNLIKECAEEADLPEALARQAIPVGAITYCMESPAGIKPDTLFLYDLALPEDFRPHNTDGEMADFMLWPAAKVVEAVRTTEAFKFNVNLTVIDFAIRHGLIDPDNEPDYQEILAGLRGRPRERAASPA

Structure:
Method: X-ray, res=1.8Å, R/Rfree=0.17/0.21
Determined by: NYSGRC
PDB ID: 3dup

3dup_A cartoon
Cartoon diagram of 513: 3dup chain A

PyMOL of 3dup

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 0-15,115-283 and 16-114. Residue ranges in target: 1-15,115-283 and 16-114. Domain boundary unclear.

513 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Nudix hydrolase fold with an inserted (or N-terminal?) domain, which is possibly formed by triplication of a left-handed ββα unit.

CASP category:

Whole chain: Fold recognition.

1st domain: Comparative modeling:hard. 2nd domain: Fold recognition.

Closest templates:

2pny, 2dho, 2fkb, 1q27, 1hzt.

Target sequence - PDB file inconsistencies:

T0513    3dup.pdb    T0513.pdb    PyMOL    PyMOL of domains    

T0513    1 -MSFLKHVQDCNTHDLSNFVRFVIEGRRVGWVRKALAQRLKAHGRVFDVTRDAVLLSASLRTPQSRTRAVADVVDRLADEGVVPAPRGELYRVNQSWGEPTLMLLDRAVVPTFGVRAYGVHLNGYVGAGADLHLWIGRRSPDKSVAPGKLDNMVAGGQPADLSLRQNLIKECAEEADLPEALARQAIPVGAITYCMESPAGIKPDTLFLYDLALPEDFRPHNTDGEMADFMLWPAAKVVEAVRTTEAFKFNVNLTVIDFAIRHGLIDPDNEPDYQEILAGLRGRPRERAASPA 292
           ~:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~
3dupA    0 SLSFLKHVQDCNTHDLSNFVRFVIEGRRVGWVRKALAQRLKAHGRVFDVTRDAVLLSASLRTPQSRTRAVADVVDRLADEGVVPAPRGELYRVNQSWGEPTLMLLDRAVVPTFGVRAYGVHLNGYVGAGADLHLWIGRRSPDKSVAPGKLDNMVAGGQPADLSLRQNLIKECAEEADLPEALARQAIPVGAITYCMESPAGIKPDTLFLYDLALPEDFRPHNTDGEMADFMLWPAAKVVEAVRTTEAFKFNVNLTVIDFAIRHGLIDPDNEPDYQEILAGLRGR--------- 283

Residue change log: change 1 L to M; change 102, 152, 195, 226, 230, MSE to MET; remove 0 S as it is not present in target sequence;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 1-15, 115-283 ; pdb 1-15, 115-283

2nd domain: target 16-114 ; pdb 16-114

Sequence classification:

NUDIX domain in Pfam.

Server predictions:

T0513:pdb 1-283:seq 1-283:FR;   alignment

distribution of first scores
First models for T0513: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

513_1:pdb 1-15,115-283:seq 1-15,115-283:CM_hard;   alignment

distribution of first scores
First models for T0513_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

513_2:pdb 16-114:seq 16-114:FR;   alignment

distribution of first scores
First models for T0513_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0513 513_1 513_2 T0513 513_1 513_2 T0513 513_1 513_2 T0513 513_1 513_2
First score First Z-score Best score Best Z-score
1 fais−server 45.67 36.54 57.11 58.70 49.00 63.46 34.60 26.35 55.14 1.19 1.04 1.57 0.93 0.80 1.40 1.21 0.64 1.34 46.29 37.40 57.11 58.70 49.00 63.46 38.38 30.64 55.14 1.31 1.01 1.65 0.84 0.44 1.30 1.23 0.97 1.28 fais−server 1
2 HHpred4 44.97 36.07 45.97 59.92 48.87 63.41 25.25 20.71 23.87 1.11 0.97 0.69 1.05 0.79 1.40 -0.12 -0.35 -0.35 44.97 36.07 45.97 59.92 48.87 63.41 25.25 20.71 23.87 1.04 0.69 0.54 1.06 0.42 1.29 -0.52 -0.85 -0.58 HHpred4 2
3 HHpred5 44.61 35.72 47.21 60.05 50.63 63.71 27.78 25.08 26.93 1.06 0.92 0.79 1.06 0.98 1.43 0.24 0.42 -0.18 44.61 35.72 47.21 60.05 50.63 63.71 27.78 25.08 26.93 0.97 0.61 0.66 1.08 0.74 1.33 -0.18 -0.04 -0.40 HHpred5 3
4 Zhang−Server 44.35 38.22 55.55 59.24 51.99 59.84 42.68 36.78 58.59 1.03 1.29 1.44 0.98 1.12 1.04 2.37 2.48 1.52 45.41 38.60 55.55 60.05 54.21 60.35 42.68 36.78 58.59 1.13 1.29 1.50 1.08 1.40 0.88 1.81 2.10 1.49 Zhang−Server 4
5 COMA−M 44.08 35.13 47.04 58.70 46.92 60.45 23.48 21.89 32.33 1.00 0.83 0.77 0.93 0.58 1.10 -0.38 -0.15 0.11 44.97 36.04 47.67 60.33 49.32 62.12 25.25 23.15 37.83 1.04 0.68 0.71 1.14 0.50 1.12 -0.52 -0.40 0.25 COMA−M 5
6 RAPTOR 43.82 35.92 50.08 54.08 46.74 56.32 32.58 28.87 49.08 0.96 0.95 1.01 0.49 0.56 0.68 0.92 1.09 1.01 44.52 36.57 50.73 56.25 47.46 57.41 36.11 33.16 51.34 0.95 0.81 1.02 0.40 0.16 0.49 0.93 1.44 1.06 RAPTOR 6
7 COMA 42.93 33.69 46.77 57.06 45.56 59.69 23.23 22.14 33.17 0.85 0.62 0.75 0.77 0.43 1.02 -0.41 -0.10 0.15 42.93 35.81 47.67 57.06 48.82 62.12 24.50 22.98 37.83 0.63 0.63 0.71 0.55 0.41 1.12 -0.62 -0.43 0.25 COMA 7
8 SAM−T08−server 42.67 34.95 53.45 57.61 48.19 63.52 28.28 27.10 43.96 0.82 0.81 1.28 0.82 0.71 1.41 0.31 0.77 0.73 44.26 35.63 53.45 59.10 50.73 63.52 28.28 27.10 43.96 0.90 0.59 1.29 0.91 0.76 1.30 -0.12 0.33 0.62 SAM−T08−server 8
9 Phyre2 42.49 34.72 46.55 59.10 52.49 62.97 21.21 19.53 30.36 0.80 0.77 0.73 0.97 1.18 1.35 -0.70 -0.56 0.00 42.76 36.63 47.75 59.24 52.49 62.97 28.54 27.86 38.68 0.59 0.82 0.72 0.94 1.08 1.23 -0.08 0.46 0.30 Phyre2 9
10 METATASSER 42.40 35.57 45.67 56.25 49.64 56.27 27.27 25.76 37.56 0.79 0.90 0.66 0.69 0.87 0.67 0.16 0.54 0.39 44.17 37.63 47.67 57.47 51.54 57.09 31.06 28.87 42.16 0.88 1.06 0.71 0.62 0.91 0.44 0.25 0.65 0.51 METATASSER 10
11 MUSTER 42.31 35.07 45.06 54.48 45.06 54.00 26.01 23.48 40.30 0.78 0.82 0.62 0.53 0.38 0.45 -0.02 0.13 0.54 43.55 39.02 47.98 58.83 51.04 61.52 26.01 23.48 40.30 0.75 1.39 0.74 0.87 0.82 1.04 -0.42 -0.34 0.40 MUSTER 11
12 MULTICOM−CLUSTER 42.23 33.92 52.57 55.44 48.64 54.09 33.08 30.72 60.39 0.77 0.65 1.21 0.62 0.76 0.45 1.00 1.41 1.62 42.23 33.92 52.57 57.88 48.64 56.78 40.66 33.08 60.39 0.49 0.18 1.20 0.70 0.37 0.40 1.54 1.42 1.59 MULTICOM−CLUSTER 12
13 Poing 41.96 35.25 45.93 58.56 52.04 61.81 26.52 23.57 30.28 0.73 0.85 0.68 0.92 1.13 1.23 0.06 0.15 -0.00 42.31 36.78 49.01 58.56 52.04 64.02 26.52 23.82 37.92 0.50 0.86 0.84 0.82 1.00 1.37 -0.35 -0.28 0.26 Poing 13
14 GS−KudlatyPred 41.78 36.78 54.68 55.30 46.33 56.61 49.75 39.31 62.85 0.71 1.08 1.38 0.60 0.51 0.71 3.38 2.93 1.75 43.91 37.54 60.38 58.97 48.01 64.82 49.75 40.91 63.01 0.83 1.04 1.98 0.89 0.26 1.48 2.76 2.86 1.75 GS−KudlatyPred 14
15 FALCON 41.52 36.04 47.40 52.72 47.19 51.70 37.12 25.84 50.71 0.68 0.97 0.80 0.36 0.61 0.21 1.57 0.55 1.10 43.46 36.04 47.45 53.26 47.83 52.29 39.65 35.27 50.71 0.74 0.68 0.69 -0.13 0.23 -0.20 1.40 1.82 1.02 FALCON 15
16 BAKER−ROBETTA 41.43 36.13 54.20 55.30 46.69 55.90 49.49 41.58 62.89 0.67 0.98 1.34 0.60 0.55 0.64 3.34 3.33 1.76 41.43 36.13 54.20 55.30 46.74 55.90 49.49 41.58 62.89 0.32 0.71 1.36 0.23 0.03 0.28 2.72 2.98 1.74 BAKER−ROBETTA 16
17 Phragment 41.34 35.51 49.97 58.29 51.40 62.11 32.83 30.64 41.12 0.66 0.89 1.00 0.89 1.06 1.26 0.96 1.40 0.58 42.05 37.10 49.97 58.83 51.72 62.11 32.83 30.64 41.12 0.45 0.93 0.94 0.87 0.94 1.12 0.49 0.97 0.45 Phragment 17
18 FALCON_CONSENSUS 40.81 34.45 45.77 52.72 47.19 52.23 31.06 29.71 45.14 0.59 0.73 0.67 0.36 0.61 0.27 0.71 1.23 0.80 43.46 36.04 47.45 53.26 47.83 52.29 39.65 35.27 50.71 0.74 0.68 0.69 -0.13 0.23 -0.20 1.40 1.82 1.02 FALCON_CONSENSUS 18
19 PSI 40.72 33.83 44.93 54.21 45.34 52.45 26.26 25.00 42.37 0.58 0.64 0.61 0.50 0.41 0.29 0.02 0.40 0.65 41.52 34.10 45.02 54.21 48.87 53.28 26.77 25.17 42.37 0.34 0.22 0.45 0.04 0.42 -0.07 -0.32 -0.03 0.52 PSI 19
20 3D−JIGSAW_V3 40.72 32.83 30.63 54.08 45.65 49.54 20.45 18.27 9.22 0.58 0.49 -0.52 0.49 0.44 -0.00 -0.81 -0.78 -1.14 40.81 34.75 38.74 54.48 48.60 49.60 23.23 20.79 34.27 0.20 0.38 -0.18 0.09 0.37 -0.56 -0.79 -0.83 0.04 3D−JIGSAW_V3 20
21 3D−JIGSAW_AEP 40.64 33.04 29.66 53.67 45.52 48.21 20.20 17.84 9.70 0.57 0.52 -0.60 0.45 0.43 -0.14 -0.85 -0.86 -1.11 40.64 33.39 31.08 53.80 45.97 49.20 24.75 22.39 11.79 0.16 0.06 -0.94 -0.04 -0.12 -0.62 -0.59 -0.54 -1.30 3D−JIGSAW_AEP 21
22 MULTICOM−CMFR 40.46 32.92 52.21 53.26 43.84 54.04 32.83 30.47 59.95 0.55 0.51 1.18 0.41 0.24 0.45 0.96 1.37 1.60 40.46 33.48 52.53 53.80 47.46 59.84 38.89 30.47 59.95 0.13 0.08 1.19 -0.04 0.16 0.81 1.30 0.94 1.57 MULTICOM−CMFR 22
23 HHpred2 40.46 32.80 37.57 52.72 45.29 50.87 25.50 24.16 25.04 0.55 0.49 0.02 0.36 0.40 0.13 -0.09 0.25 -0.29 40.46 32.80 37.57 52.72 45.29 50.87 25.50 24.16 25.04 0.13 -0.08 -0.30 -0.23 -0.24 -0.39 -0.49 -0.21 -0.51 HHpred2 23
24 SAM−T06−server 40.11 32.45 46.35 53.26 41.94 55.07 27.78 23.23 41.85 0.50 0.44 0.72 0.41 0.04 0.55 0.24 0.09 0.62 40.11 32.57 46.35 53.26 49.37 55.07 27.78 23.23 41.85 0.05 -0.14 0.58 -0.13 0.51 0.17 -0.18 -0.38 0.49 SAM−T06−server 24
25 3DShot2 39.84 31.83 29.30 53.67 45.06 48.15 25.50 23.99 7.11 0.47 0.35 -0.63 0.45 0.38 -0.15 -0.09 0.22 -1.25 39.84 31.83 29.30 53.67 45.06 48.15 25.50 23.99 7.11 -0.00 -0.31 -1.12 -0.06 -0.28 -0.76 -0.49 -0.24 -1.58 3DShot2 25
26 Phyre_de_novo 39.75 31.39 49.21 56.39 46.78 66.69 21.46 20.79 30.54 0.46 0.28 0.94 0.71 0.56 1.73 -0.67 -0.34 0.01 40.90 32.83 51.73 56.93 49.19 67.11 25.50 24.33 38.54 0.21 -0.08 1.11 0.53 0.48 1.79 -0.49 -0.18 0.29 Phyre_de_novo 26
27 MULTICOM−REFINE 39.66 32.13 52.02 52.85 43.98 54.53 32.83 30.64 58.49 0.45 0.39 1.17 0.37 0.26 0.50 0.96 1.40 1.52 39.84 32.86 52.02 53.53 45.83 54.53 39.90 31.65 59.11 -0.00 -0.07 1.14 -0.08 -0.14 0.10 1.44 1.16 1.52 MULTICOM−REFINE 27
28 MULTICOM−RANK 39.58 30.92 51.95 52.45 43.02 53.85 32.83 30.64 59.09 0.44 0.21 1.16 0.33 0.16 0.43 0.96 1.40 1.55 40.55 32.51 51.95 54.62 48.64 56.21 40.66 30.64 59.09 0.14 -0.15 1.14 0.11 0.37 0.32 1.54 0.97 1.52 MULTICOM−RANK 28
29 MUProt 39.49 31.48 52.55 52.72 45.02 54.59 33.08 30.72 59.84 0.43 0.29 1.21 0.36 0.37 0.51 1.00 1.41 1.59 40.72 33.30 52.55 54.21 48.05 54.74 39.65 30.72 59.84 0.18 0.04 1.20 0.04 0.27 0.13 1.40 0.99 1.56 MUProt 29
30 keasar−server 38.96 28.48 35.75 52.58 38.54 49.24 19.44 16.67 24.40 0.36 -0.15 -0.12 0.34 -0.33 -0.04 -0.96 -1.07 -0.32 41.34 34.04 40.35 54.48 47.42 52.11 26.26 23.91 29.92 0.30 0.21 -0.02 0.09 0.15 -0.23 -0.39 -0.26 -0.22 keasar−server 30
31 FFASstandard 38.60 27.68 30.07 51.63 43.30 49.11 21.21 17.00 9.24 0.32 -0.27 -0.57 0.25 0.19 -0.05 -0.70 -1.01 -1.14 38.60 33.27 30.07 52.04 46.56 49.15 21.21 17.59 9.24 -0.25 0.03 -1.04 -0.35 -0.01 -0.62 -1.06 -1.42 -1.45 FFASstandard 31
32 pro−sp3−TASSER 38.43 34.13 46.41 51.63 47.01 54.09 31.82 27.44 45.26 0.30 0.69 0.72 0.25 0.59 0.45 0.82 0.83 0.81 45.32 40.31 48.20 59.10 54.30 57.61 34.85 31.65 48.36 1.12 1.69 0.76 0.91 1.41 0.51 0.76 1.16 0.88 pro−sp3−TASSER 32
33 FFASsuboptimal 38.25 28.24 31.25 51.36 43.12 50.51 21.72 18.43 9.92 0.27 -0.18 -0.48 0.23 0.17 0.09 -0.63 -0.76 -1.10 39.84 33.66 31.25 52.45 44.75 50.51 23.48 19.19 12.30 -0.00 0.12 -0.93 -0.28 -0.34 -0.44 -0.76 -1.12 -1.27 FFASsuboptimal 33
34 Pcons_local 38.16 31.09 29.07 50.81 46.20 48.92 23.48 22.64 5.48 0.26 0.24 -0.65 0.18 0.50 -0.07 -0.38 -0.01 -1.34 41.96 35.37 29.07 57.06 52.08 48.92 25.25 24.75 6.88 0.43 0.53 -1.14 0.55 1.01 -0.65 -0.52 -0.11 -1.59 Pcons_local 34
35 FFASflextemplate 37.81 30.07 28.27 50.27 42.94 46.93 20.45 17.51 7.91 0.22 0.09 -0.71 0.12 0.15 -0.27 -0.81 -0.92 -1.21 38.34 32.63 28.97 51.36 42.94 47.66 20.71 18.01 8.69 -0.31 -0.12 -1.15 -0.47 -0.67 -0.82 -1.13 -1.34 -1.48 FFASflextemplate 35
36 Pcons_dot_net 36.75 30.98 27.17 50.27 45.20 49.72 17.93 15.74 -0.49 0.09 0.22 -0.80 0.12 0.39 0.01 -1.17 -1.23 -1.66 44.44 35.54 41.46 60.19 52.08 61.82 26.01 24.75 14.65 0.94 0.57 0.09 1.11 1.01 1.08 -0.42 -0.11 -1.13 Pcons_dot_net 36
37 Pcons_multi 36.75 30.98 27.17 50.27 45.20 49.72 17.93 15.74 -0.49 0.09 0.22 -0.80 0.12 0.39 0.01 -1.17 -1.23 -1.66 41.25 32.77 42.18 55.57 46.65 62.28 22.73 21.21 17.00 0.29 -0.09 0.16 0.28 0.01 1.14 -0.86 -0.75 -0.99 Pcons_multi 37
38 LEE−SERVER 36.75 30.04 42.00 55.16 49.82 59.60 20.96 16.75 27.72 0.09 0.08 0.37 0.59 0.89 1.01 -0.74 -1.05 -0.14 36.75 33.16 42.00 55.30 50.09 59.60 21.72 17.09 27.72 -0.63 0.00 0.15 0.23 0.64 0.78 -1.00 -1.51 -0.35 LEE−SERVER 38
39 PS2−server 35.95 28.53 22.74 48.37 40.35 36.13 25.76 24.41 10.92 -0.01 -0.14 -1.15 -0.06 -0.13 -1.36 -0.05 0.30 -1.05 35.95 32.27 22.74 53.80 48.55 43.40 25.76 24.41 12.73 -0.79 -0.21 -1.77 -0.04 0.36 -1.39 -0.46 -0.17 -1.24 PS2−server 39
40 GeneSilicoMetaServer 35.60 28.09 25.04 48.10 40.67 44.59 21.97 21.63 2.61 -0.06 -0.21 -0.97 -0.08 -0.10 -0.50 -0.59 -0.19 -1.50 45.49 37.46 40.04 60.46 50.05 60.02 25.25 23.74 14.86 1.15 1.02 -0.05 1.16 0.63 0.84 -0.52 -0.29 -1.11 GeneSilicoMetaServer 40
41 BioSerf 35.16 29.33 51.70 53.53 44.75 58.33 32.07 25.17 51.05 -0.11 -0.02 1.14 0.44 0.34 0.88 0.85 0.43 1.12 35.16 29.33 51.70 53.53 44.75 58.33 32.07 25.17 51.05 -0.95 -0.90 1.11 -0.08 -0.34 0.61 0.39 -0.03 1.04 BioSerf 41
42 circle 34.36 28.48 17.47 45.79 40.08 36.91 17.17 12.79 -0.79 -0.21 -0.15 -1.56 -0.30 -0.16 -1.28 -1.28 -1.75 -1.68 39.58 32.19 29.15 52.99 44.34 52.98 19.44 17.59 1.93 -0.05 -0.23 -1.13 -0.18 -0.42 -0.11 -1.30 -1.42 -1.88 circle 42
43 GS−MetaServer2 34.01 30.54 19.63 51.90 46.29 48.69 0.00 0.00 -13.87 -0.25 0.16 -1.39 0.28 0.51 -0.09 -3.74 -4.01 -2.39 44.17 37.57 35.86 59.24 51.09 58.17 24.75 23.40 7.11 0.88 1.05 -0.47 0.94 0.82 0.59 -0.59 -0.35 -1.58 GS−MetaServer2 43
44 FEIG 33.22 27.74 41.04 50.27 41.94 52.97 25.25 23.74 36.13 -0.35 -0.26 0.30 0.12 0.04 0.34 -0.12 0.18 0.31 37.37 29.12 44.80 51.09 41.94 55.13 41.16 30.39 41.93 -0.50 -0.95 0.42 -0.52 -0.86 0.18 1.61 0.93 0.50 FEIG 44
45 Pushchino 32.69 29.68 24.76 50.27 45.65 37.59 23.74 23.40 20.84 -0.42 0.03 -0.99 0.12 0.44 -1.21 -0.34 0.12 -0.51 32.69 29.68 24.76 50.27 45.65 37.59 23.74 23.40 20.84 -1.46 -0.82 -1.57 -0.67 -0.18 -2.17 -0.73 -0.35 -0.76 Pushchino 45
46 SAM−T02−server 32.42 28.77 13.19 41.71 37.36 28.72 19.70 18.52 0.69 -0.45 -0.11 -1.90 -0.69 -0.46 -2.11 -0.92 -0.74 -1.60 38.78 32.01 25.93 53.67 45.52 43.93 24.50 23.65 5.97 -0.22 -0.27 -1.46 -0.06 -0.20 -1.32 -0.62 -0.31 -1.64 SAM−T02−server 46
47 3Dpro 31.01 23.64 25.22 41.03 34.15 37.46 20.71 16.67 17.70 -0.63 -0.86 -0.95 -0.76 -0.80 -1.23 -0.77 -1.07 -0.68 33.66 28.65 26.59 44.43 36.87 39.21 20.71 17.59 17.70 -1.26 -1.06 -1.39 -1.72 -1.79 -1.95 -1.13 -1.42 -0.95 3Dpro 47
48 FOLDpro 31.01 23.64 25.22 41.03 34.15 37.46 20.71 16.67 17.70 -0.63 -0.86 -0.95 -0.76 -0.80 -1.23 -0.77 -1.07 -0.68 33.66 28.65 26.59 44.43 36.87 39.21 20.71 17.59 17.70 -1.26 -1.06 -1.39 -1.72 -1.79 -1.95 -1.13 -1.42 -0.95 FOLDpro 48
49 rehtnap 29.33 26.50 13.11 45.11 40.76 38.99 0.00 0.00 -13.87 -0.83 -0.44 -1.91 -0.37 -0.09 -1.07 -3.74 -4.01 -2.39 29.50 26.50 25.51 45.11 40.76 39.77 21.72 19.02 18.06 -2.11 -1.57 -1.50 -1.59 -1.07 -1.88 -1.00 -1.16 -0.92 rehtnap 49
50 panther_server 29.15 24.62 8.45 38.86 32.61 23.42 15.40 15.07 -2.85 -0.86 -0.72 -2.28 -0.96 -0.97 -2.64 -1.53 -1.35 -1.79 40.28 31.98 28.77 55.84 45.97 51.20 21.97 18.69 4.02 0.09 -0.28 -1.17 0.33 -0.12 -0.35 -0.96 -1.22 -1.76 panther_server 50
51 LOOPP_Server 28.00 22.64 14.76 43.07 34.83 41.51 0.00 0.00 -13.87 -1.00 -1.01 -1.78 -0.56 -0.73 -0.82 -3.74 -4.01 -2.39 34.01 26.89 25.51 46.74 38.13 47.56 18.18 15.99 -0.56 -1.19 -1.48 -1.50 -1.30 -1.56 -0.84 -1.47 -1.71 -2.03 LOOPP_Server 51
52 MUFOLD−Server 24.56 16.43 24.36 37.36 26.50 32.02 22.73 16.50 28.17 -1.43 -1.93 -1.02 -1.11 -1.63 -1.77 -0.49 -1.10 -0.12 24.56 18.32 24.43 37.36 27.49 32.02 26.01 20.12 28.57 -3.11 -3.51 -1.60 -2.98 -3.51 -2.92 -0.42 -0.95 -0.30 MUFOLD−Server 52
53 ACOMPMOD 21.55 19.02 15.95 31.66 26.40 32.07 18.69 16.50 3.12 -1.80 -1.55 -1.68 -1.65 -1.64 -1.77 -1.06 -1.10 -1.47 37.28 31.01 28.01 50.95 46.15 50.64 18.69 17.42 3.12 -0.52 -0.51 -1.25 -0.55 -0.08 -0.42 -1.40 -1.45 -1.81 ACOMPMOD 53
54 FUGUE_KM 21.29 18.93 12.99 29.89 25.86 28.19 17.68 15.49 1.93 -1.83 -1.56 -1.92 -1.82 -1.70 -2.16 -1.21 -1.27 -1.53 35.95 30.12 25.52 49.73 44.29 47.02 18.43 16.25 1.93 -0.79 -0.72 -1.50 -0.77 -0.43 -0.91 -1.44 -1.66 -1.88 FUGUE_KM 54
55 Distill 18.73 14.84 22.79 28.12 22.15 30.17 23.99 20.45 27.40 -2.15 -2.16 -1.14 -1.99 -2.10 -1.96 -0.30 -0.40 -0.16 19.17 15.64 25.93 28.94 23.10 33.35 30.05 26.52 30.29 -4.21 -4.14 -1.46 -4.49 -4.32 -2.74 0.12 0.22 -0.20 Distill 55
56 MUFOLD−MD 16.43 10.07 30.52 16.17 12.77 31.77 45.20 25.17 45.68 -2.44 -2.87 -0.53 -3.13 -3.11 -1.80 2.73 0.43 0.83 19.70 12.63 34.05 20.25 17.16 34.34 53.03 32.83 55.08 -4.10 -4.85 -0.65 -6.05 -5.41 -2.61 3.19 1.38 1.28 MUFOLD−MD 56
57 RBO−Proteus 12.99 10.84 33.85 16.98 11.01 34.61 32.07 26.77 50.75 -2.86 -2.75 -0.27 -3.05 -3.30 -1.51 0.85 0.72 1.10 13.69 12.57 33.85 17.66 13.86 34.61 32.07 27.95 50.75 -5.33 -4.87 -0.67 -6.52 -6.02 -2.57 0.39 0.48 1.02 RBO−Proteus 57
58 CpHModels 9.98 9.63 -15.61 15.35 14.81 -4.91 0.00 0.00 -13.87 -3.24 -2.93 -4.18 -3.21 -2.89 -5.50 -3.74 -4.01 -2.39 9.98 9.63 -15.61 15.35 14.81 -4.91 0.00 0.00 -13.87 -6.08 -5.56 -5.59 -6.93 -5.84 -7.87 -3.90 -4.64 -2.82 CpHModels 58
59 nFOLD3 9.81 9.10 15.13 14.54 13.31 17.41 27.02 22.48 29.20 -3.26 -3.01 -1.75 -3.29 -3.06 -3.25 0.13 -0.04 -0.06 39.93 32.72 25.82 53.40 45.88 46.55 27.02 22.48 29.20 0.02 -0.10 -1.47 -0.11 -0.13 -0.97 -0.29 -0.52 -0.26 nFOLD3 59
60 forecast 9.63 8.57 16.03 11.55 10.28 17.37 22.22 18.52 32.17 -3.28 -3.09 -1.68 -3.57 -3.38 -3.25 -0.56 -0.74 0.10 9.89 8.72 16.92 13.04 12.32 19.57 22.22 20.20 32.17 -6.10 -5.78 -2.35 -7.34 -6.30 -4.59 -0.93 -0.94 -0.08 forecast 60
61 huber−torda−server 8.92 8.22 2.32 13.99 12.54 5.87 18.18 11.95 14.91 -3.37 -3.14 -2.76 -3.34 -3.14 -4.42 -1.14 -1.90 -0.83 9.63 8.22 9.68 14.13 12.54 15.86 26.52 21.72 21.70 -6.16 -5.90 -3.07 -7.15 -6.26 -5.09 -0.35 -0.66 -0.71 huber−torda−server 61
62 RANDOM 8.08 7.01 8.08 11.46 9.69 11.46 20.47 16.79 20.47 -3.47 -3.32 -2.31 -3.58 -3.45 -3.85 -0.81 -1.05 -0.53 8.08 7.01 8.08 11.46 9.69 11.46 20.47 16.79 20.47 -6.47 -6.18 -3.23 -7.63 -6.78 -5.68 -1.16 -1.56 -0.78 RANDOM 62
63 schenk−torda−server 7.42 6.30 12.06 10.60 8.74 16.21 18.43 15.07 23.21 -3.55 -3.42 -1.99 -3.66 -3.55 -3.37 -1.10 -1.35 -0.39 7.51 6.48 12.06 11.14 9.56 16.42 18.43 15.91 23.21 -6.59 -6.31 -2.84 -7.68 -6.81 -5.01 -1.44 -1.73 -0.62 schenk−torda−server 63
64 FAMSD 7.24 6.36 41.34 12.23 11.82 52.69 19.44 16.75 35.60 -3.58 -3.41 0.32 -3.51 -3.22 0.31 -0.96 -1.05 0.28 41.34 35.51 41.34 56.66 50.68 52.98 23.74 22.22 35.60 0.30 0.56 0.08 0.48 0.75 -0.11 -0.73 -0.57 0.12 FAMSD 64
65 mariner1 7.24 6.04 -6.66 11.14 9.28 3.84 10.61 8.25 -5.59 -3.58 -3.46 -3.47 -3.61 -3.49 -4.62 -2.22 -2.55 -1.94 37.46 30.33 27.79 53.94 46.51 52.25 18.94 17.00 3.25 -0.49 -0.67 -1.27 -0.01 -0.02 -0.21 -1.37 -1.53 -1.80 mariner1 65
66 mGenTHREADER 6.54 5.59 36.18 9.10 9.01 48.50 16.16 14.65 26.06 -3.66 -3.53 -0.09 -3.81 -3.52 -0.11 -1.43 -1.42 -0.23 6.54 5.59 36.18 9.10 9.01 48.50 16.16 14.65 26.06 -6.78 -6.52 -0.43 -8.05 -6.91 -0.71 -1.74 -1.96 -0.45 mGenTHREADER 66
67 BHAGEERATH                                                       -3.47 -3.32 -2.31 -3.58 -3.45 -3.85 -0.81 -1.05 -0.53                                                       -6.47 -6.18 -3.23 -7.63 -6.78 -5.68 -1.16 -1.56 -0.78 BHAGEERATH 67
68 Fiser−M4T                                                       -3.47 -3.32 -2.31 -3.58 -3.45 -3.85 -0.81 -1.05 -0.53                                                       -6.47 -6.18 -3.23 -7.63 -6.78 -5.68 -1.16 -1.56 -0.78 Fiser−M4T 68
69 Frankenstein                                                       -3.47 -3.32 -2.31 -3.58 -3.45 -3.85 -0.81 -1.05 -0.53                                                       -6.47 -6.18 -3.23 -7.63 -6.78 -5.68 -1.16 -1.56 -0.78 Frankenstein 69
70 OLGAFS                                                       -3.47 -3.32 -2.31 -3.58 -3.45 -3.85 -0.81 -1.05 -0.53                                                       -6.47 -6.18 -3.23 -7.63 -6.78 -5.68 -1.16 -1.56 -0.78 OLGAFS 70
71 YASARA                                                       -3.47 -3.32 -2.31 -3.58 -3.45 -3.85 -0.81 -1.05 -0.53                                                       -6.47 -6.18 -3.23 -7.63 -6.78 -5.68 -1.16 -1.56 -0.78 YASARA 71
72 mahmood−torda−server                                                       -3.47 -3.32 -2.31 -3.58 -3.45 -3.85 -0.81 -1.05 -0.53                                                       -6.47 -6.18 -3.23 -7.63 -6.78 -5.68 -1.16 -1.56 -0.78 mahmood−torda−server 72
73 pipe_int                                                       -3.47 -3.32 -2.31 -3.58 -3.45 -3.85 -0.81 -1.05 -0.53                                                       -6.47 -6.18 -3.23 -7.63 -6.78 -5.68 -1.16 -1.56 -0.78 pipe_int 73
74 test_http_server_01                                                       -3.47 -3.32 -2.31 -3.58 -3.45 -3.85 -0.81 -1.05 -0.53                                                       -6.47 -6.18 -3.23 -7.63 -6.78 -5.68 -1.16 -1.56 -0.78 test_http_server_01 74