T0483

Server only Targets
388 390 392 394
398 400 402 404
406 408 410 412
414 416 418 420
422 424 426 428
430 432 433 435
436 438 439 441
442 444 445 447
448 450 452 453
455 456 458 459
461 463 470 472
475 477 478 479
481 483 485 486
488 490 491 494
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514  

T0483

PAS domain-containing serine/threonine-protein kinase from Homo sapiens

Target type: Server only

Target sequence:

>T0483 PAS kinase, Human, 335 residues
MALEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGEGHHHHHH

Structure:
Method: X-ray, res=2.3Å, R/Rfree=0.24/0.30
Determined by: NYSGRC
PDB ID: 3dls

PyMOL of 3dls

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 982-1083 and 1084-1266. Residue ranges in target: 9-110 and 111-293.

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Protein kinase two-domain fold.

CASP category:

Whole chain: Comparative modeling:medium.

1st domain: Comparative modeling:medium. 2nd domain: Comparative modeling:easy.

Closest templates:

1kob, 2rku, 1y8g, 1koa, 1o6l.

Target sequence - PDB file inconsistencies:

T0483    3dls.pdb    T0483.pdb    PyMOL    PyMOL of domains   

T0483    1 MALEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGEGHHHHHH 335
           ~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
3dlsA  982 --------AVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVF------------------------------------------ 1266

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 9-110 ; pdb 982-1083

2nd domain: target 111-293 ; pdb 1084-1266

Sequence classification:

S_TKc superfamily in CDD.

Server predictions:

T0483:pdb 982-1266:seq 9-293:CM_medium;   alignment

483_1:pdb 982-1083:seq 9-110:CM_medium;   alignment

483_2:pdb 1084-1266:seq 111-293:CM_easy;   alignment

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0483 483_1 483_2 T0483 483_1 483_2 T0483 483_1 483_2 T0483 483_1 483_2
First score First Z-score Best score Best Z-score
1 LEE−SERVER 74.30 67.16 79.35 66.67 62.42 72.70 83.74 81.74 84.83 1.88 1.47 1.66 0.97 1.28 1.59 1.84 2.03 1.48 74.30 70.70 79.35 66.67 62.42 72.70 84.15 82.33 84.87 1.70 1.88 1.62 0.67 0.95 1.58 1.89 2.03 1.39 LEE−SERVER 1
2 MULTICOM−REFINE 73.95 66.11 76.80 64.95 61.52 67.57 83.20 81.74 83.93 1.81 1.29 1.24 0.46 1.06 0.41 1.74 2.03 1.35 75.09 69.94 76.80 65.69 61.60 67.57 83.47 82.01 83.94 1.88 1.73 1.11 0.31 0.69 -0.03 1.74 1.97 1.23 MULTICOM−REFINE 2
3 MULTICOM−RANK 73.86 70.64 76.48 64.71 61.11 67.31 83.06 81.60 83.68 1.79 2.04 1.19 0.39 0.96 0.35 1.72 2.01 1.32 73.95 70.64 76.77 66.67 61.52 68.21 83.06 81.60 84.00 1.63 1.87 1.10 0.67 0.67 0.18 1.64 1.90 1.24 MULTICOM−RANK 3
4 MULTICOM−CMFR 73.77 66.75 76.36 65.20 61.27 67.05 82.92 80.92 83.61 1.78 1.40 1.17 0.54 1.00 0.29 1.69 1.90 1.31 73.77 66.75 76.36 65.20 61.27 67.39 82.92 80.92 83.61 1.59 1.11 1.02 0.13 0.59 -0.08 1.61 1.77 1.17 MULTICOM−CMFR 4
5 MULTICOM−CLUSTER 72.89 70.09 77.08 64.22 59.31 68.25 83.20 81.74 84.07 1.60 1.95 1.29 0.25 0.52 0.56 1.74 2.03 1.37 73.95 70.09 77.54 69.61 61.52 70.11 83.20 81.74 84.21 1.63 1.76 1.25 1.76 0.67 0.77 1.68 1.92 1.28 MULTICOM−CLUSTER 5
6 LOOPP_Server 72.63 65.56 75.18 69.36 64.79 63.84 81.83 77.55 84.15 1.55 1.20 0.97 1.77 1.86 -0.45 1.50 1.39 1.39 72.63 65.56 77.92 72.79 64.79 71.20 81.83 77.55 84.15 1.34 0.88 1.33 2.94 1.71 1.11 1.37 1.15 1.27 LOOPP_Server 6
7 FALCON 72.46 66.49 74.96 65.20 62.42 69.06 78.69 70.58 80.47 1.52 1.35 0.93 0.54 1.28 0.75 0.94 0.32 0.88 72.46 67.43 74.96 65.93 63.48 69.06 78.69 72.68 80.47 1.30 1.25 0.73 0.40 1.29 0.44 0.67 0.25 0.63 FALCON 7
8 MUProt 72.37 68.63 75.74 63.23 59.48 65.72 82.65 80.56 83.25 1.50 1.71 1.06 -0.04 0.56 -0.02 1.64 1.85 1.26 73.95 68.63 76.93 64.71 61.36 67.52 83.61 82.15 84.25 1.63 1.48 1.13 -0.05 0.62 -0.04 1.77 2.00 1.28 MUProt 8
9 nFOLD3 71.49 67.81 78.51 72.06 68.79 73.40 80.33 77.14 84.03 1.33 1.57 1.52 2.56 2.84 1.75 1.23 1.33 1.37 72.72 69.21 78.51 72.06 68.79 73.40 80.46 78.28 84.03 1.36 1.59 1.45 2.67 2.98 1.80 1.07 1.29 1.25 nFOLD3 9
10 FALCON_CONSENSUS 71.40 66.14 73.92 63.48 60.87 66.17 77.32 72.68 80.45 1.31 1.30 0.76 0.03 0.90 0.08 0.70 0.65 0.87 72.46 67.43 74.96 65.93 63.48 69.06 78.69 72.68 80.47 1.30 1.25 0.73 0.40 1.29 0.44 0.67 0.25 0.63 FALCON_CONSENSUS 10
11 Zhang−Server 70.17 64.03 78.01 70.10 64.46 71.41 80.60 75.50 83.70 1.07 0.95 1.44 1.98 1.78 1.29 1.28 1.08 1.32 70.79 67.22 78.88 70.34 65.44 71.41 81.69 79.33 85.67 0.93 1.21 1.52 2.03 1.91 1.18 1.34 1.48 1.53 Zhang−Server 11
12 FAMSD 69.74 62.95 73.32 66.91 57.60 67.96 78.69 71.86 80.45 0.99 0.77 0.66 1.04 0.10 0.50 0.94 0.52 0.87 69.74 62.95 73.32 66.91 58.17 67.96 78.69 71.86 80.45 0.70 0.38 0.40 0.76 -0.40 0.10 0.67 0.10 0.62 FAMSD 12
13 rehtnap 68.95 63.57 69.24 64.46 57.11 64.57 75.82 72.36 76.58 0.83 0.87 -0.02 0.32 -0.02 -0.29 0.43 0.60 0.34 68.95 63.57 69.24 64.46 57.11 64.57 76.37 73.09 76.74 0.53 0.50 -0.42 -0.15 -0.74 -0.96 0.15 0.33 -0.02 rehtnap 13
14 GS−KudlatyPred 68.86 65.64 73.58 63.97 61.19 67.60 76.09 72.91 79.54 0.82 1.21 0.71 0.18 0.98 0.41 0.48 0.68 0.75 68.86 65.64 73.58 63.97 61.19 67.60 76.09 72.91 79.54 0.51 0.90 0.46 -0.33 0.56 -0.02 0.09 0.29 0.47 GS−KudlatyPred 14
15 HHpred2 68.77 60.59 74.74 64.22 57.84 70.22 76.50 74.41 78.74 0.80 0.37 0.90 0.25 0.16 1.02 0.55 0.91 0.64 68.77 60.59 74.74 64.22 57.84 70.22 76.50 74.41 78.74 0.49 -0.08 0.69 -0.24 -0.50 0.80 0.18 0.57 0.33 HHpred2 15
16 Fiser−M4T 68.25 64.39 73.60 61.52 54.90 63.62 78.42 75.50 80.60 0.70 1.01 0.71 -0.55 -0.56 -0.51 0.89 1.08 0.90 68.25 64.39 73.60 61.52 54.90 63.62 78.42 75.50 80.60 0.37 0.66 0.46 -1.24 -1.44 -1.26 0.61 0.77 0.65 Fiser−M4T 16
17 circle 67.89 63.22 69.96 65.69 63.07 63.20 75.27 72.54 75.68 0.63 0.81 0.10 0.68 1.44 -0.60 0.33 0.62 0.22 69.91 66.46 72.08 67.40 64.79 68.85 79.78 75.50 80.14 0.74 1.06 0.15 0.94 1.71 0.38 0.91 0.77 0.57 circle 17
18 3Dpro 67.81 64.12 69.39 60.54 53.19 63.67 74.73 70.63 73.66 0.61 0.96 0.01 -0.84 -0.98 -0.49 0.23 0.33 -0.06 67.81 64.12 69.39 60.54 56.78 63.67 74.73 70.63 73.66 0.28 0.60 -0.39 -1.60 -0.84 -1.24 -0.21 -0.13 -0.55 3Dpro 18
19 pro−sp3−TASSER 67.72 61.11 77.35 66.91 61.85 70.05 79.23 72.40 84.15 0.59 0.46 1.33 1.04 1.14 0.98 1.04 0.60 1.39 69.12 62.16 77.35 66.91 63.89 70.55 79.23 75.55 84.15 0.57 0.22 1.22 0.76 1.42 0.91 0.79 0.78 1.27 pro−sp3−TASSER 19
20 3DShot2 67.63 59.97 71.14 59.56 46.00 58.95 78.55 69.99 81.04 0.58 0.27 0.30 -1.13 -2.74 -1.58 0.91 0.23 0.96 67.63 59.97 71.14 59.56 46.00 58.95 78.55 69.99 81.04 0.24 -0.20 -0.04 -1.96 -4.27 -2.72 0.64 -0.24 0.73 3DShot2 20
21 RAPTOR 67.54 62.81 72.83 61.77 60.13 63.36 79.10 71.54 80.43 0.56 0.74 0.58 -0.47 0.72 -0.57 1.01 0.47 0.87 67.54 62.81 72.83 61.77 60.13 63.36 79.10 71.54 80.43 0.22 0.35 0.31 -1.14 0.22 -1.34 0.76 0.04 0.62 RAPTOR 21
22 Pcons_local 67.46 62.84 72.88 67.16 59.23 70.06 74.59 70.49 76.48 0.54 0.75 0.59 1.12 0.50 0.98 0.21 0.31 0.33 68.07 64.44 74.50 67.16 59.23 70.06 77.19 72.09 80.18 0.34 0.67 0.64 0.85 -0.06 0.75 0.34 0.14 0.58 Pcons_local 22
23 Pcons_dot_net 67.46 62.84 72.88 67.16 59.23 70.06 74.59 70.49 76.48 0.54 0.75 0.59 1.12 0.50 0.98 0.21 0.31 0.33 68.95 64.39 74.50 67.16 64.87 70.06 77.19 72.09 80.47 0.53 0.66 0.64 0.85 1.73 0.75 0.34 0.14 0.63 Pcons_dot_net 23
24 Pcons_multi 67.46 62.84 72.88 67.16 59.23 70.06 74.59 70.49 76.48 0.54 0.75 0.59 1.12 0.50 0.98 0.21 0.31 0.33 71.40 65.56 75.86 67.16 61.11 70.15 78.96 73.18 80.72 1.07 0.88 0.92 0.85 0.54 0.78 0.73 0.34 0.67 Pcons_multi 24
25 Phyre_de_novo 67.28 64.06 71.51 65.20 61.27 71.60 74.18 70.99 73.14 0.51 0.95 0.36 0.54 1.00 1.34 0.14 0.39 -0.13 68.60 64.68 71.72 65.93 61.36 71.70 75.82 72.36 73.56 0.45 0.71 0.08 0.40 0.62 1.27 0.03 0.19 -0.57 Phyre_de_novo 25
26 SAM−T08−server 67.28 60.73 76.05 69.85 57.27 72.72 75.14 71.40 79.56 0.51 0.40 1.12 1.91 0.02 1.60 0.31 0.45 0.75 67.28 60.97 76.05 69.85 60.13 72.72 75.14 71.40 79.56 0.16 -0.01 0.95 1.85 0.22 1.59 -0.12 0.02 0.47 SAM−T08−server 26
27 HHpred5 66.58 55.88 73.04 66.67 60.46 71.63 76.91 67.17 76.10 0.37 -0.41 0.62 0.97 0.80 1.34 0.62 -0.20 0.27 66.58 55.88 73.04 66.67 60.46 71.63 76.91 67.17 76.10 0.01 -0.99 0.35 0.67 0.33 1.24 0.27 -0.76 -0.13 HHpred5 27
28 METATASSER 65.97 60.41 73.77 63.73 56.21 67.22 77.19 71.54 80.38 0.25 0.34 0.74 0.10 -0.24 0.33 0.67 0.47 0.87 66.32 60.53 73.77 63.97 59.48 67.22 77.19 73.22 80.38 -0.05 -0.09 0.49 -0.33 0.02 -0.13 0.34 0.35 0.61 METATASSER 28
29 3D−JIGSAW_AEP 65.26 61.17 73.67 61.52 57.60 68.16 74.04 69.67 77.95 0.11 0.47 0.72 -0.55 0.10 0.54 0.11 0.19 0.53 65.26 61.17 73.92 62.74 58.25 68.35 74.04 69.99 78.25 -0.28 0.03 0.52 -0.78 -0.37 0.22 -0.37 -0.24 0.24 3D−JIGSAW_AEP 29
30 FFASflextemplate 64.74 58.83 71.85 64.95 55.47 67.31 75.27 72.09 76.17 0.01 0.08 0.42 0.46 -0.42 0.35 0.33 0.56 0.28 64.74 58.83 71.85 64.95 56.21 67.47 75.27 72.09 76.17 -0.40 -0.42 0.11 0.04 -1.02 -0.06 -0.09 0.14 -0.12 FFASflextemplate 30
31 COMA 64.56 58.45 72.89 61.27 58.33 65.86 75.41 70.13 78.81 -0.03 0.02 0.59 -0.62 0.28 0.01 0.36 0.26 0.65 64.56 58.45 72.89 63.23 58.33 70.77 75.41 70.13 78.81 -0.44 -0.50 0.32 -0.60 -0.35 0.98 -0.06 -0.22 0.34 COMA 31
32 mGenTHREADER 64.30 58.04 67.80 60.54 53.35 58.52 73.77 63.21 74.64 -0.08 -0.05 -0.26 -0.84 -0.94 -1.68 0.06 -0.80 0.07 64.30 58.04 67.80 60.54 53.35 58.52 73.77 63.21 74.64 -0.49 -0.57 -0.71 -1.60 -1.93 -2.86 -0.43 -1.50 -0.38 mGenTHREADER 32
33 BAKER−ROBETTA 64.03 60.70 66.55 64.95 61.85 67.05 70.90 67.62 69.51 -0.13 0.39 -0.46 0.46 1.14 0.29 -0.45 -0.13 -0.63 64.74 60.94 68.57 65.69 61.85 69.09 72.00 69.81 71.86 -0.40 -0.01 -0.55 0.31 0.77 0.45 -0.82 -0.28 -0.87 BAKER−ROBETTA 33
34 GeneSilicoMetaServer 64.03 55.15 71.64 60.05 50.90 61.71 76.09 72.45 79.14 -0.13 -0.53 0.38 -0.98 -1.54 -0.95 0.48 0.61 0.69 64.74 60.23 71.64 63.23 59.07 66.84 76.09 72.45 79.14 -0.40 -0.15 0.07 -0.60 -0.11 -0.25 0.09 0.21 0.40 GeneSilicoMetaServer 34
35 COMA−M 63.95 54.18 70.07 66.42 60.87 70.77 72.40 64.07 72.05 -0.14 -0.69 0.12 0.90 0.90 1.15 -0.18 -0.67 -0.28 67.54 61.37 72.89 66.42 60.87 70.77 76.37 72.91 78.81 0.22 0.07 0.32 0.58 0.46 0.98 0.15 0.29 0.34 COMA−M 35
36 fais−server 63.51 57.66 66.63 63.48 53.51 67.25 70.22 67.94 69.60 -0.23 -0.11 -0.45 0.03 -0.90 0.33 -0.57 -0.08 -0.62 63.51 57.66 70.06 63.97 61.03 67.25 71.72 69.26 73.90 -0.67 -0.65 -0.25 -0.33 0.51 -0.13 -0.88 -0.38 -0.51 fais−server 36
37 pipe_int 63.51 57.25 70.34 62.99 55.31 69.01 73.50 70.04 74.62 -0.23 -0.18 0.17 -0.11 -0.46 0.74 0.02 0.24 0.07 63.51 57.25 70.34 62.99 55.31 69.01 73.50 70.04 74.62 -0.67 -0.73 -0.20 -0.69 -1.31 0.43 -0.49 -0.23 -0.39 pipe_int 37
38 3D−JIGSAW_V3 63.51 54.80 71.92 61.52 54.41 64.05 74.45 63.12 77.99 -0.23 -0.59 0.43 -0.55 -0.68 -0.41 0.19 -0.81 0.54 63.51 56.58 72.24 61.52 57.35 64.67 74.45 65.67 78.28 -0.67 -0.86 0.19 -1.24 -0.66 -0.93 -0.27 -1.04 0.25 3D−JIGSAW_V3 38
39 GS−MetaServer2 63.16 54.03 62.36 62.74 56.94 60.47 70.49 67.94 66.90 -0.30 -0.72 -1.16 -0.19 -0.06 -1.23 -0.52 -0.08 -0.99 71.32 64.18 74.40 68.63 62.17 65.27 81.28 78.46 82.27 1.05 0.62 0.62 1.40 0.87 -0.74 1.25 1.32 0.94 GS−MetaServer2 39
40 HHpred4 63.07 58.16 69.26 62.26 54.41 68.17 73.77 64.12 72.83 -0.32 -0.03 -0.01 -0.33 -0.68 0.54 0.06 -0.66 -0.18 63.07 58.16 69.26 62.26 54.41 68.17 73.77 64.12 72.83 -0.76 -0.55 -0.41 -0.96 -1.60 0.16 -0.43 -1.33 -0.70 HHpred4 40
41 FEIG 62.81 54.09 71.09 64.22 56.21 67.03 73.77 67.58 76.11 -0.37 -0.71 0.29 0.25 -0.24 0.28 0.06 -0.13 0.28 66.49 59.12 71.09 65.93 57.52 69.11 78.42 73.77 78.38 -0.01 -0.37 -0.05 0.40 -0.61 0.46 0.61 0.45 0.27 FEIG 41
42 SAM−T02−server 62.10 57.19 68.47 60.78 52.61 62.64 71.31 66.85 73.87 -0.51 -0.19 -0.14 -0.77 -1.12 -0.73 -0.37 -0.24 -0.03 69.91 66.46 73.08 68.63 58.74 63.52 79.37 76.64 80.78 0.74 1.06 0.36 1.40 -0.22 -1.29 0.82 0.98 0.68 SAM−T02−server 42
43 PSI 62.10 54.44 67.26 60.78 52.78 66.29 70.63 64.16 70.80 -0.51 -0.65 -0.34 -0.77 -1.08 0.11 -0.49 -0.65 -0.46 63.77 56.67 69.01 64.95 59.56 68.45 72.40 66.53 72.32 -0.61 -0.84 -0.46 0.04 0.04 0.25 -0.73 -0.88 -0.79 PSI 43
44 SAM−T06−server 61.32 55.35 68.21 62.99 56.78 68.22 69.13 63.02 69.98 -0.66 -0.50 -0.19 -0.11 -0.10 0.56 -0.76 -0.83 -0.57 62.63 58.25 68.21 64.46 59.40 68.22 71.86 68.22 71.33 -0.86 -0.53 -0.63 -0.15 -0.01 0.18 -0.85 -0.57 -0.96 SAM−T06−server 44
45 Frankenstein 61.14 52.13 71.75 55.88 43.71 62.97 75.55 72.09 78.47 -0.69 -1.03 0.40 -2.21 -3.30 -0.66 0.38 0.56 0.60 61.14 54.50 71.75 62.74 52.45 65.66 75.55 72.09 78.47 -1.19 -1.26 0.09 -0.78 -2.22 -0.62 -0.03 0.14 0.28 Frankenstein 45
46 PS2−server 60.88 54.71 66.24 62.50 59.72 65.84 69.94 67.58 70.08 -0.75 -0.60 -0.51 -0.26 0.62 0.01 -0.62 -0.13 -0.56 66.67 61.17 73.85 65.20 60.21 71.22 73.77 69.85 78.21 0.03 0.03 0.51 0.13 0.25 1.12 -0.43 -0.27 0.24 PS2−server 46
47 MUSTER 60.61 50.91 64.57 66.91 59.72 66.49 66.26 61.61 67.40 -0.80 -1.24 -0.79 1.04 0.62 0.16 -1.27 -1.04 -0.93 72.46 65.50 76.31 70.34 64.54 71.24 79.78 77.05 81.57 1.30 0.87 1.01 2.03 1.63 1.12 0.91 1.06 0.82 MUSTER 47
48 CpHModels 60.00 54.21 60.58 62.01 55.47 62.79 68.44 64.25 63.00 -0.92 -0.69 -1.45 -0.40 -0.42 -0.70 -0.88 -0.64 -1.53 60.00 54.21 60.58 62.01 55.47 62.79 68.44 64.25 63.00 -1.44 -1.32 -2.16 -1.06 -1.26 -1.52 -1.61 -1.30 -2.40 CpHModels 48
49 panther_server 60.00 52.52 58.70 59.31 52.94 59.79 67.76 62.02 62.61 -0.92 -0.97 -1.77 -1.20 -1.04 -1.39 -1.00 -0.98 -1.59 63.07 57.43 62.74 59.31 52.94 59.79 70.36 66.53 69.33 -0.76 -0.69 -1.73 -2.06 -2.06 -2.46 -1.19 -0.88 -1.30 panther_server 49
50 Phyre2 59.47 51.70 62.82 63.73 55.88 69.34 67.08 60.52 62.20 -1.02 -1.10 -1.08 0.10 -0.32 0.82 -1.13 -1.21 -1.64 59.47 52.60 62.82 63.73 55.88 69.45 67.08 60.88 62.20 -1.55 -1.63 -1.71 -0.42 -1.13 0.56 -1.92 -1.93 -2.54 Phyre2 50
51 BioSerf 59.39 51.37 66.74 64.71 57.03 66.82 69.40 65.12 69.96 -1.04 -1.16 -0.43 0.39 -0.04 0.23 -0.71 -0.51 -0.57 59.39 51.37 66.74 64.71 57.03 66.82 69.40 65.12 69.96 -1.57 -1.87 -0.92 -0.05 -0.76 -0.26 -1.40 -1.14 -1.19 BioSerf 51
52 Pushchino 59.30 54.33 56.87 57.35 51.31 51.18 65.03 62.11 64.12 -1.05 -0.67 -2.07 -1.78 -1.44 -3.38 -1.49 -0.97 -1.38 59.30 54.33 56.87 57.35 51.31 51.18 65.03 62.11 64.12 -1.59 -1.29 -2.91 -2.78 -2.58 -5.15 -2.37 -1.70 -2.21 Pushchino 52
53 ACOMPMOD 58.68 52.08 64.55 63.23 57.52 63.20 66.12 57.47 67.90 -1.18 -1.04 -0.80 -0.04 0.08 -0.60 -1.30 -1.67 -0.86 60.97 52.28 71.35 63.23 57.52 68.85 73.91 70.54 76.56 -1.22 -1.69 0.01 -0.60 -0.61 0.38 -0.39 -0.14 -0.05 ACOMPMOD 53
54 FUGUE_KM 58.60 51.93 64.15 62.50 57.76 60.45 67.76 59.47 68.90 -1.19 -1.07 -0.86 -0.26 0.14 -1.24 -1.00 -1.37 -0.72 63.60 57.75 70.15 62.50 57.76 65.64 75.00 71.27 75.62 -0.65 -0.63 -0.24 -0.87 -0.53 -0.63 -0.15 -0.01 -0.21 FUGUE_KM 54
55 Poing 58.07 52.05 60.02 63.73 55.88 69.42 65.16 59.52 57.74 -1.29 -1.05 -1.55 0.10 -0.32 0.83 -1.47 -1.36 -2.26 58.68 52.46 60.06 63.73 55.88 69.42 66.12 60.20 57.92 -1.73 -1.66 -2.27 -0.42 -1.13 0.55 -2.13 -2.05 -3.28 Poing 55
56 Phragment 57.98 51.84 60.96 63.73 55.88 69.25 65.30 59.74 59.32 -1.31 -1.08 -1.39 0.10 -0.32 0.79 -1.44 -1.33 -2.04 58.60 52.69 61.27 63.73 55.88 69.38 66.39 60.75 59.78 -1.75 -1.61 -2.02 -0.42 -1.13 0.54 -2.07 -1.95 -2.96 Phragment 56
57 FFASstandard 57.54 50.99 63.02 62.26 58.99 62.38 64.48 59.20 67.36 -1.40 -1.22 -1.05 -0.33 0.44 -0.79 -1.59 -1.41 -0.93 61.75 58.13 64.89 62.74 58.99 63.01 70.08 68.17 69.61 -1.05 -0.56 -1.30 -0.78 -0.14 -1.45 -1.25 -0.58 -1.26 FFASstandard 57
58 keasar−server 57.02 49.36 64.61 65.20 50.65 66.97 65.57 61.29 66.89 -1.50 -1.49 -0.79 0.54 -1.60 0.27 -1.39 -1.09 -1.00 68.60 64.44 73.69 65.20 59.48 70.16 76.50 72.31 78.26 0.45 0.67 0.48 0.13 0.02 0.79 0.18 0.18 0.24 keasar−server 58
59 YASARA 56.84 50.88 61.78 60.54 58.74 63.36 63.80 60.06 62.58 -1.54 -1.24 -1.26 -0.84 0.38 -0.57 -1.71 -1.28 -1.59 56.84 50.88 61.80 60.54 58.74 63.97 63.80 60.06 62.61 -2.13 -1.96 -1.92 -1.60 -0.22 -1.15 -2.65 -2.08 -2.47 YASARA 59
60 FFASsuboptimal 56.32 48.36 63.94 65.93 60.38 65.47 64.34 57.97 66.89 -1.64 -1.66 -0.90 0.75 0.78 -0.08 -1.61 -1.60 -1.00 57.54 50.99 63.94 65.93 60.70 65.47 65.30 61.29 67.36 -1.98 -1.94 -1.49 0.40 0.41 -0.68 -2.31 -1.85 -1.65 FFASsuboptimal 60
61 huber−torda−server 56.23 45.35 50.79 53.43 49.51 48.58 64.07 55.33 56.54 -1.65 -2.16 -3.08 -2.94 -1.88 -3.98 -1.66 -2.00 -2.42 63.60 60.61 67.14 62.50 59.40 64.92 71.04 67.99 72.29 -0.65 -0.08 -0.84 -0.87 -0.01 -0.85 -1.03 -0.61 -0.79 huber−torda−server 61
62 Distill 54.39 48.01 55.15 51.96 49.18 51.71 63.39 59.38 61.36 -2.01 -1.72 -2.36 -3.37 -1.96 -3.26 -1.78 -1.38 -1.76 55.44 48.57 57.10 57.35 55.23 55.06 66.94 61.75 63.74 -2.44 -2.41 -2.87 -2.78 -1.33 -3.94 -1.95 -1.76 -2.27 Distill 62
63 MUFOLD−Server 49.83 39.88 51.79 45.59 38.89 45.16 62.30 53.55 62.03 -2.91 -3.07 -2.92 -5.25 -4.48 -4.77 -1.98 -2.27 -1.67 54.56 46.37 57.13 64.46 60.70 66.56 69.54 64.66 69.58 -2.63 -2.84 -2.86 -0.15 0.41 -0.34 -1.37 -1.23 -1.26 MUFOLD−Server 63
64 OLGAFS 47.72 44.62 40.62 51.72 47.96 38.23 48.91 45.63 43.71 -3.32 -2.28 -4.77 -3.44 -2.26 -6.37 -4.36 -3.48 -4.19 47.72 44.94 40.75 51.72 48.77 38.29 50.27 49.00 44.29 -4.14 -3.11 -6.16 -4.87 -3.39 -9.18 -5.66 -4.12 -5.65 OLGAFS 64
65 mariner1 27.98 22.78 22.85 22.79 17.65 20.10 34.56 30.87 28.77 -7.18 -5.91 -7.72 -11.98 -9.69 -10.55 -6.91 -5.73 -6.25 67.37 62.75 70.50 65.44 64.46 69.71 74.86 68.76 78.12 0.18 0.34 -0.16 0.22 1.60 0.64 -0.18 -0.47 0.22 mariner1 65
66 FOLDpro 17.89 16.96 25.37 18.87 16.50 25.70 27.46 26.18 33.00 -9.16 -6.88 -7.31 -13.14 -9.97 -9.26 -8.17 -6.45 -5.67 58.60 52.69 55.72 52.94 48.69 53.92 68.58 58.65 66.48 -1.75 -1.61 -3.14 -4.42 -3.41 -4.29 -1.58 -2.34 -1.80 FOLDpro 66
67 MUFOLD−MD 17.63 16.73 43.20 39.46 34.07 54.40 26.78 25.23 44.92 -9.21 -6.92 -4.34 -7.06 -5.66 -2.63 -8.29 -6.59 -4.03 18.16 16.73 43.20 40.69 35.38 54.40 26.78 25.23 44.92 -10.63 -8.58 -5.67 -8.96 -7.65 -4.14 -10.90 -8.50 -5.54 MUFOLD−MD 67
68 RBO−Proteus 17.19 15.26 42.03 34.07 31.45 55.63 25.68 23.22 42.07 -9.29 -7.16 -4.54 -8.65 -6.31 -2.35 -8.49 -6.90 -4.42 17.19 15.85 42.08 36.03 33.58 56.18 25.68 23.22 42.36 -10.84 -8.75 -5.89 -10.69 -8.22 -3.59 -11.14 -8.87 -5.98 RBO−Proteus 68
69 RANDOM 8.96 7.40 8.96 17.49 15.18 17.49 12.89 11.49 12.89 -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44 8.96 7.40 8.96 17.49 15.18 17.49 12.89 11.49 12.89 -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 RANDOM 69
70 schenk−torda−server 6.93 5.35 5.46 14.71 13.07 12.34 9.84 7.47 8.82 -11.30 -8.81 -10.61 -14.36 -10.81 -12.35 -11.31 -9.30 -9.01 7.19 6.99 6.54 14.71 13.07 18.11 10.93 10.11 8.88 -13.04 -10.47 -13.06 -18.60 -14.74 -15.50 -14.43 -11.29 -11.79 schenk−torda−server 70
71 BHAGEERATH                                                       -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44                                                       -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 BHAGEERATH 71
72 forecast                                                       -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44                                                       -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 forecast 72
73 mahmood−torda−server                                                       -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44                                                       -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 mahmood−torda−server 73
74 test_http_server_01                                                       -10.90 -8.47 -10.03 -13.54 -10.29 -11.16 -10.76 -8.69 -8.44                                                       -12.65 -10.39 -12.57 -17.57 -14.07 -15.69 -13.99 -11.04 -11.09 test_http_server_01 74