T0400

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0400

NP_373092.1 Staphylococcus aureus

Target type: Server only

Target sequence:

>T0400 NP_373092.1, Staphylococcus aureus, 162 residues
MAINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNSGGQFWLAINNHQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTIDKFISAQYFYSNNGFREIKRGDLPSSFPKLDVDNRFYYRNLKD

Structure:
Method: X-ray, res=2.4Å, R/Rfree=0.21/0.25
Determined by: JCSG
PDB ID: 3d8p

3d8p_A cartoon
Cartoon diagram of 400: 3d8p chain A residues

PyMOL of 3d8p

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

Acyl-CoA N-acyltransferases (Nat) fold.

CASP category:

Comparative modeling:easy.

Closest templates:

1z4e, 2fe7, 2eui, 2q7b, 2dxq.

Target sequence - PDB file inconsistencies:

T0400    3d8p.pdb    T0400.pdb    PyMOL    PyMOL of domains    

T0400    1 MAINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNSGGQFWLAINNHQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTIDKFISAQYFYSNNGFREIKRGDLPSSFPKLDVDNRFYYRNLKD 162
           ~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~||||||||||~
3d8pA    2 -AINIIEYNRSYKEELIEFILSIQKNEFNIKIDRDDQPDLENIEHNYLNSGGQFWLAINNHQNIVGTIGLIRLDNNMSALKKMFVDKGYRNLKIGKKLLDKVIMTCKEQNIDGIYLGTIDKFISAQYFYSNNGFREIKRGDLPSSFPKL--DNRFYYRNLK- 161

Residue change log: change 77, 83, 104, MSE to MET;

Single domain protein: target 2-149, 152-161 ; pdb 2-149, 152-161

Sequence classification:

Acetyltransferase (GNAT) family Acetyltransf_1 in Pfam.

Server predictions:

T0400:pdb 2-161:seq 2-161:CM_easy;   alignment

distribution of first scores
First models for T0400: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0400 T0400 T0400 T0400
First score First Z-score Best score Best Z-score
1 PS2−server 88.92 87.45 88.12 1.37 1.66 1.41 88.92 87.45 88.12 1.54 1.76 1.68 PS2−server 1
2 RAPTOR 88.61 86.92 87.52 1.34 1.61 1.34 88.61 86.92 87.78 1.50 1.69 1.63 RAPTOR 2
3 Fiser−M4T 88.13 74.84 87.40 1.29 0.56 1.33 88.13 74.84 87.40 1.43 0.29 1.57 Fiser−M4T 3
4 HHpred5 86.71 84.92 88.33 1.14 1.44 1.44 86.71 84.92 88.33 1.22 1.46 1.72 HHpred5 4
5 fais−server 86.23 81.59 87.00 1.09 1.15 1.29 86.23 81.59 87.00 1.15 1.07 1.50 fais−server 5
6 MUFOLD−Server 84.97 73.36 83.46 0.95 0.44 0.89 85.13 74.05 83.55 0.99 0.20 0.93 MUFOLD−Server 6
7 Zhang−Server 84.65 80.12 84.50 0.92 1.02 1.00 84.65 82.12 84.50 0.92 1.14 1.09 Zhang−Server 7
8 YASARA 84.65 76.95 84.16 0.92 0.75 0.97 86.23 82.96 87.44 1.15 1.23 1.57 YASARA 8
9 HHpred2 84.33 79.27 83.73 0.88 0.95 0.92 84.33 79.27 83.73 0.87 0.81 0.96 HHpred2 9
10 BAKER−ROBETTA 84.33 73.26 83.49 0.88 0.43 0.89 85.13 74.58 83.65 0.99 0.26 0.95 BAKER−ROBETTA 10
11 MUProt 84.18 74.79 83.87 0.87 0.56 0.93 84.18 76.58 84.14 0.85 0.49 1.03 MUProt 11
12 MUSTER 84.02 80.64 81.61 0.85 1.07 0.68 84.02 80.64 81.61 0.82 0.96 0.61 MUSTER 12
13 MULTICOM−REFINE 84.02 74.84 83.84 0.85 0.56 0.93 85.13 79.80 84.27 0.99 0.87 1.05 MULTICOM−REFINE 13
14 LOOPP_Server 84.02 74.00 82.92 0.85 0.49 0.83 84.02 74.00 82.92 0.82 0.19 0.83 LOOPP_Server 14
15 MULTICOM−CMFR 83.70 73.58 82.33 0.82 0.46 0.76 83.70 78.22 83.79 0.78 0.68 0.97 MULTICOM−CMFR 15
16 nFOLD3 83.70 72.63 81.79 0.82 0.37 0.70 83.70 79.01 82.17 0.78 0.77 0.70 nFOLD3 16
17 FEIG 83.39 78.43 83.39 0.78 0.88 0.88 83.39 78.43 83.39 0.73 0.71 0.90 FEIG 17
18 Pushchino 83.39 77.06 81.76 0.78 0.76 0.70 83.39 77.06 81.76 0.73 0.55 0.63 Pushchino 18
19 HHpred4 83.23 81.22 83.41 0.77 1.12 0.88 83.23 81.22 83.41 0.71 1.03 0.91 HHpred4 19
20 Pcons_multi 83.23 77.53 82.99 0.77 0.80 0.83 83.23 81.54 84.28 0.71 1.07 1.05 Pcons_multi 20
21 Phyre_de_novo 83.07 82.02 84.87 0.75 1.19 1.05 83.07 82.02 84.87 0.68 1.12 1.15 Phyre_de_novo 21
22 pipe_int 83.07 78.53 81.08 0.75 0.88 0.62 83.07 78.53 81.08 0.68 0.72 0.52 pipe_int 22
23 FAMSD 82.91 80.80 82.26 0.73 1.08 0.75 83.70 80.80 82.79 0.78 0.98 0.80 FAMSD 23
24 Pcons_dot_net 82.75 80.43 82.50 0.72 1.05 0.78 82.75 80.43 82.50 0.64 0.94 0.76 Pcons_dot_net 24
25 MULTICOM−CLUSTER 82.75 79.48 83.26 0.72 0.97 0.86 82.75 79.48 83.26 0.64 0.83 0.88 MULTICOM−CLUSTER 25
26 FFASsuboptimal 82.75 73.15 80.56 0.72 0.42 0.56 82.75 78.53 81.04 0.64 0.72 0.52 FFASsuboptimal 26
27 3DShot2 82.44 76.53 79.41 0.68 0.71 0.43 82.44 76.53 79.41 0.59 0.49 0.25 3DShot2 27
28 CpHModels 82.44 73.58 78.26 0.68 0.46 0.30 82.44 73.58 78.26 0.59 0.14 0.06 CpHModels 28
29 FFASflextemplate 81.33 78.90 76.88 0.56 0.92 0.15 81.33 78.90 76.88 0.43 0.76 -0.17 FFASflextemplate 29
30 FFASstandard 81.17 77.37 78.98 0.55 0.78 0.38 82.44 78.96 79.32 0.59 0.77 0.23 FFASstandard 30
31 pro−sp3−TASSER 80.38 77.11 79.57 0.46 0.76 0.45 84.18 82.28 83.28 0.85 1.15 0.89 pro−sp3−TASSER 31
32 3D−JIGSAW_V3 79.75 76.69 74.60 0.39 0.72 -0.11 79.91 76.85 74.60 0.22 0.52 -0.55 3D−JIGSAW_V3 32
33 Poing 78.48 74.05 76.57 0.26 0.50 0.11 78.48 74.05 76.57 0.01 0.20 -0.22 Poing 33
34 Phyre2 78.48 74.05 76.57 0.26 0.50 0.11 78.48 74.05 76.57 0.01 0.20 -0.22 Phyre2 34
35 Phragment 78.48 74.05 76.57 0.26 0.50 0.11 78.48 74.05 76.57 0.01 0.20 -0.22 Phragment 35
36 FUGUE_KM 78.48 66.03 74.98 0.26 -0.20 -0.07 78.48 66.03 74.98 0.01 -0.73 -0.48 FUGUE_KM 36
37 3Dpro 76.90 69.73 69.17 0.09 0.12 -0.72 76.90 69.73 69.17 -0.22 -0.30 -1.44 3Dpro 37
38 Distill 76.74 74.21 72.08 0.07 0.51 -0.40 76.74 74.21 72.08 -0.24 0.22 -0.96 Distill 38
39 METATASSER 74.37 62.45 76.96 -0.18 -0.51 0.15 78.80 73.84 78.46 0.06 0.17 0.09 METATASSER 39
40 BioSerf 73.42 66.35 75.71 -0.28 -0.17 0.01 73.42 66.35 75.71 -0.73 -0.70 -0.36 BioSerf 40
41 SAM−T08−server 72.31 65.98 76.62 -0.40 -0.20 0.12 72.31 65.98 76.62 -0.89 -0.74 -0.21 SAM−T08−server 41
42 circle 72.15 57.86 72.64 -0.42 -0.91 -0.33 83.39 79.38 77.75 0.73 0.82 -0.03 circle 42
43 3D−JIGSAW_AEP 72.15 57.38 73.43 -0.42 -0.95 -0.24 72.63 64.35 73.88 -0.85 -0.93 -0.67 3D−JIGSAW_AEP 43
44 FALCON_CONSENSUS 70.25 55.38 72.75 -0.62 -1.12 -0.32 71.52 64.77 73.24 -1.01 -0.88 -0.77 FALCON_CONSENSUS 44
45 FALCON 70.25 55.38 72.75 -0.62 -1.12 -0.32 71.52 64.77 73.24 -1.01 -0.88 -0.77 FALCON 45
46 LEE−SERVER 69.94 57.17 72.74 -0.65 -0.97 -0.32 70.41 58.97 73.05 -1.17 -1.55 -0.80 LEE−SERVER 46
47 GeneSilicoMetaServer 68.83 54.38 71.53 -0.77 -1.21 -0.46 78.96 68.83 76.74 0.08 -0.41 -0.19 GeneSilicoMetaServer 47
48 COMA−M 68.20 64.19 70.42 -0.84 -0.36 -0.58 73.26 64.19 72.69 -0.75 -0.95 -0.86 COMA−M 48
49 Pcons_local 67.56 53.96 71.02 -0.91 -1.25 -0.52 71.83 64.24 71.02 -0.96 -0.94 -1.14 Pcons_local 49
50 mGenTHREADER 67.25 56.17 70.10 -0.94 -1.06 -0.62 67.25 56.17 70.10 -1.64 -1.88 -1.29 mGenTHREADER 50
51 PSI 67.25 55.75 68.71 -0.94 -1.09 -0.78 73.10 62.76 73.22 -0.78 -1.11 -0.77 PSI 51
52 ACOMPMOD 67.09 55.48 69.41 -0.96 -1.12 -0.70 67.09 56.91 69.41 -1.66 -1.79 -1.40 ACOMPMOD 52
53 Frankenstein 66.93 55.06 66.59 -0.98 -1.15 -1.01 68.35 63.03 69.41 -1.48 -1.08 -1.40 Frankenstein 53
54 keasar−server 66.14 61.92 69.64 -1.06 -0.56 -0.67 70.89 61.97 71.98 -1.10 -1.21 -0.98 keasar−server 54
55 rehtnap 66.14 57.28 59.28 -1.06 -0.96 -1.84 66.30 57.28 65.01 -1.78 -1.75 -2.13 rehtnap 55
56 MULTICOM−RANK 64.87 53.69 62.10 -1.20 -1.27 -1.52 81.65 78.53 79.78 0.48 0.72 0.31 MULTICOM−RANK 56
57 GS−KudlatyPred 64.72 58.39 63.95 -1.21 -0.86 -1.31 64.72 58.39 63.95 -2.01 -1.62 -2.30 GS−KudlatyPred 57
58 GS−MetaServer2 64.24 58.86 64.81 -1.26 -0.82 -1.21 68.20 62.02 71.60 -1.50 -1.20 -1.04 GS−MetaServer2 58
59 SAM−T02−server 63.92 50.84 56.52 -1.30 -1.52 -2.15 63.92 54.85 61.14 -2.13 -2.03 -2.77 SAM−T02−server 59
60 SAM−T06−server 62.82 52.80 61.49 -1.42 -1.35 -1.59 66.30 61.76 68.50 -1.78 -1.23 -1.55 SAM−T06−server 60
61 forecast 55.22 43.20 57.06 -2.23 -2.18 -2.09 67.25 55.27 71.35 -1.64 -1.98 -1.08 forecast 61
62 COMA 50.63 46.20 56.29 -2.72 -1.92 -2.18 67.25 58.17 72.69 -1.64 -1.65 -0.86 COMA 62
63 FOLDpro 47.31 37.92 48.61 -3.07 -2.64 -3.04 50.95 41.46 49.91 -4.03 -3.59 -4.62 FOLDpro 63
64 panther_server 44.46 37.08 34.91 -3.38 -2.71 -4.58 78.01 71.89 71.26 -0.06 -0.05 -1.10 panther_server 64
65 MUFOLD−MD 41.14 33.02 48.14 -3.73 -3.06 -3.09 41.14 33.02 55.29 -5.47 -4.57 -3.73 MUFOLD−MD 65
66 mariner1 39.72 24.84 36.55 -3.89 -3.77 -4.40 65.19 58.65 72.00 -1.94 -1.59 -0.98 mariner1 66
67 RBO−Proteus 30.54 23.68 44.13 -4.87 -3.87 -3.55 41.61 34.60 51.33 -5.40 -4.39 -4.39 RBO−Proteus 67
68 schenk−torda−server 14.87 13.45 18.98 -6.54 -4.76 -6.38 14.87 13.45 18.98 -9.32 -6.84 -9.73 schenk−torda−server 68
69 RANDOM 14.53 12.25 14.53 -6.58 -4.87 -6.88 14.53 12.25 14.53 -9.37 -6.98 -10.46 RANDOM 69
70 OLGAFS 13.77 13.55 10.33 -6.66 -4.75 -7.36 13.77 13.55 10.54 -9.48 -6.83 -11.12 OLGAFS 70
71 mahmood−torda−server 11.55 10.71 17.94 -6.90 -5.00 -6.50 13.77 12.18 24.76 -9.48 -6.99 -8.77 mahmood−torda−server 71
72 BHAGEERATH                   -6.58 -4.87 -6.88                   -9.37 -6.98 -10.46 BHAGEERATH 72
73 huber−torda−server                   -6.58 -4.87 -6.88                   -9.37 -6.98 -10.46 huber−torda−server 73
74 test_http_server_01                   -6.58 -4.87 -6.88                   -9.37 -6.98 -10.46 test_http_server_01 74