T0415

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0415

LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator Bacillus cereus

Target type: Human/Server

Target sequence:

>T0415 LytTr DNA-binding domain of putative methyl-accepting/DNA response regulator, Bacillus cereus, 109 residues
GKSVVTLKTTDGWIPVPFSKVMYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCHRSFIVNVNHIKAIYPDTHSTFLLSMDNGERVPVSQSYASYFRKLLGF

Structure:
Method: X-ray, res=2.4Å, R/Rfree=0.18/0.21
Determined by: MCSG
PDB ID: 3d6w

3d6w_A cartoon
Cartoon diagram of 415: 3d6w chain A

PyMOL of 3d6w

Domains:  PyMOL of domains

Single domain protein. Evolutionarily, a duplication with rigid interactions between chromodomain-like duplicates.

415 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

A duplication of chormodomain-like SH3 barrel fold.

CASP category:

Whole chain: Comparative modeling:medium.

1st domain: Comparative modeling:medium. 2nd domain: Comparative modeling:easy.

Closest templates:

3bs1 is the only template.

Target sequence - PDB file inconsistencies:

T0415    3d6w.pdb    T0415.pdb    PyMOL    PyMOL of domains    

T0415    1 GKSVVTLKTTDGWIPVPFSKVMYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCHRSFIVNVNHIKAIYPDTHSTFLLSMDNGERVPVSQSYASYFRKLLGF 109
           |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3d6wA  106 GKSVVTLKTTDGWIPVPFSKVMYLEAKDKKTYVNAEELTGTHKYSLQEFEYLLPKDSFIRCHRSFIVNVNHIKAIYPDTHSTFLLSMDNGERVPVSQSYASYFRKLLGF 214

Residue change log: change 127, 192, MSE to MET;

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein (a duplication with rigid interactions between chromodomain-like duplicates):

1st domain: target 1-54 ; pdb 106-159

2nd domain: target 55-109 ; pdb 160-214

Sequence classification:

LytTr DNA-binding domain in Pfam.

Server predictions:

T0415:pdb 106-214:seq 1-109:CM_medium;   alignment

distribution of first scores
First models for T0415: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

415_1:pdb 106-159:seq 1-54:CM_medium;   alignment

distribution of first scores
First models for T0415_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

415_2:pdb 160-214:seq 55-109:CM_easy;   alignment

distribution of first scores
First models for T0415_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0415 415_1 415_2 T0415 415_1 415_2 T0415 415_1 415_2 T0415 415_1 415_2
First score First Z-score Best score Best Z-score
1 mufold 77.29 71.79 83.84 79.63 78.39 84.97 84.55 76.67 85.87 0.77 0.83 0.90 0.61 0.75 0.74 0.91 0.89 0.94 77.29 71.79 85.04 80.09 78.39 85.82 84.55 76.67 86.92 0.72 0.73 0.94 0.57 0.66 0.74 0.82 0.73 0.96 mufold 1
2 Zico 77.29 70.26 84.88 79.17 77.01 85.58 85.00 78.03 86.89 0.77 0.72 0.98 0.57 0.63 0.81 0.95 1.00 1.02 77.98 71.56 84.88 80.09 77.78 85.58 85.00 79.24 86.89 0.77 0.71 0.92 0.57 0.60 0.72 0.86 0.97 0.96 Zico 2
3 ZicoFullSTP 77.29 70.26 84.88 79.17 77.01 85.58 85.00 78.03 86.89 0.77 0.72 0.98 0.57 0.63 0.81 0.95 1.00 1.02 77.98 71.56 84.88 80.09 77.78 85.58 85.00 79.24 86.89 0.77 0.71 0.92 0.57 0.60 0.72 0.86 0.97 0.96 ZicoFullSTP 3
4 ZicoFullSTPFullData 77.29 70.26 84.88 79.17 77.01 85.58 85.00 78.03 86.89 0.77 0.72 0.98 0.57 0.63 0.81 0.95 1.00 1.02 77.98 71.56 84.88 80.09 77.78 85.58 85.00 79.24 86.89 0.77 0.71 0.92 0.57 0.60 0.72 0.86 0.97 0.96 ZicoFullSTPFullData 4
5 3DShotMQ 77.06 71.25 82.97 79.63 78.39 85.47 83.18 76.52 83.28 0.76 0.79 0.83 0.61 0.75 0.79 0.80 0.88 0.72 77.06 71.25 82.97 79.63 78.39 85.47 83.18 76.52 83.28 0.70 0.69 0.76 0.52 0.66 0.71 0.70 0.72 0.62 3DShotMQ 5
6 IBT_LT 76.61 69.42 82.62 79.17 74.85 83.78 84.09 76.52 84.65 0.72 0.65 0.81 0.57 0.45 0.62 0.87 0.88 0.84 76.61 69.42 82.62 79.17 74.85 83.78 84.09 76.52 84.65 0.66 0.54 0.73 0.47 0.31 0.52 0.78 0.72 0.74 IBT_LT 6
7 3D−JIGSAW_AEP 76.61 69.42 78.28 82.87 77.93 82.02 76.82 68.03 79.22 0.72 0.65 0.46 0.92 0.71 0.45 0.27 0.17 0.38 76.61 69.42 78.28 82.87 77.93 82.02 77.27 68.03 79.79 0.66 0.54 0.36 0.87 0.61 0.33 0.16 -0.07 0.29 3D−JIGSAW_AEP 7
8 MULTICOM 76.61 68.50 84.35 78.70 76.54 84.31 81.82 73.94 87.40 0.72 0.59 0.94 0.52 0.59 0.68 0.68 0.66 1.07 76.83 71.33 84.54 78.70 76.54 84.47 82.73 73.94 87.68 0.68 0.69 0.89 0.42 0.48 0.60 0.66 0.48 1.03 MULTICOM 8
9 SAM−T08−human 76.38 71.02 82.50 78.24 74.23 83.43 79.55 70.45 85.43 0.71 0.77 0.80 0.48 0.39 0.59 0.50 0.37 0.90 76.61 71.02 82.50 79.63 76.85 83.45 84.55 77.88 85.58 0.66 0.67 0.72 0.52 0.51 0.49 0.82 0.84 0.83 SAM−T08−human 9
10 TASSER 76.38 70.87 83.47 77.31 75.15 83.16 83.64 78.79 86.99 0.71 0.76 0.87 0.39 0.47 0.56 0.83 1.06 1.03 76.38 70.87 83.47 77.31 75.15 83.16 83.64 78.79 86.99 0.64 0.66 0.80 0.27 0.34 0.45 0.74 0.92 0.97 TASSER 10
11 Jones−UCL 76.38 70.57 80.67 78.24 74.85 83.35 83.64 76.36 82.44 0.71 0.74 0.65 0.48 0.45 0.58 0.83 0.86 0.65 76.38 70.57 80.67 78.24 74.85 83.35 83.64 76.36 82.44 0.64 0.63 0.56 0.37 0.31 0.47 0.74 0.70 0.54 Jones−UCL 11
12 Zhang 76.38 70.26 84.26 78.70 76.54 84.54 85.45 77.58 86.72 0.71 0.72 0.93 0.52 0.59 0.70 0.98 0.96 1.01 76.83 71.64 84.38 79.63 77.47 85.00 85.45 77.88 86.72 0.68 0.72 0.88 0.52 0.57 0.65 0.90 0.84 0.94 Zhang 12
13 SAMUDRALA 76.15 69.42 83.97 79.17 77.01 84.37 84.09 78.03 86.43 0.69 0.65 0.91 0.57 0.63 0.68 0.87 1.00 0.99 77.29 72.55 84.43 80.09 77.47 84.99 85.45 79.70 86.53 0.72 0.80 0.88 0.57 0.57 0.65 0.90 1.01 0.92 SAMUDRALA 13
14 Zhang−Server 75.92 69.80 83.11 79.63 77.47 85.39 84.09 78.03 84.08 0.67 0.68 0.84 0.61 0.67 0.79 0.87 1.00 0.79 77.52 72.02 84.50 80.09 78.86 85.57 85.00 78.33 86.64 0.74 0.75 0.89 0.57 0.70 0.72 0.86 0.88 0.93 Zhang−Server 14
15 FAMS−multi 75.69 71.10 80.86 76.39 73.61 80.68 83.64 78.18 87.15 0.66 0.78 0.67 0.31 0.34 0.31 0.83 1.01 1.05 75.69 71.10 80.86 76.85 75.00 81.02 83.64 78.18 87.15 0.58 0.67 0.58 0.22 0.33 0.22 0.74 0.87 0.98 FAMS−multi 15
16 GeneSilico 75.46 69.04 82.19 79.17 77.62 83.84 83.18 76.52 84.10 0.64 0.63 0.77 0.57 0.69 0.63 0.80 0.88 0.79 75.46 70.41 83.61 79.17 77.62 83.84 83.18 76.52 86.85 0.56 0.62 0.81 0.47 0.58 0.53 0.70 0.72 0.95 GeneSilico 16
17 MidwayFolding 75.46 66.59 78.87 79.17 74.85 81.91 80.91 75.15 80.89 0.64 0.45 0.51 0.57 0.45 0.44 0.61 0.76 0.52 75.46 67.89 78.87 79.17 75.77 82.65 80.91 75.15 80.89 0.56 0.41 0.41 0.47 0.40 0.40 0.49 0.59 0.39 MidwayFolding 17
18 RAPTOR 75.46 66.59 78.87 79.17 74.85 82.21 80.91 75.15 80.89 0.64 0.45 0.51 0.57 0.45 0.47 0.61 0.76 0.52 75.46 67.89 78.87 79.17 75.77 82.93 80.91 75.15 80.89 0.56 0.41 0.41 0.47 0.40 0.43 0.49 0.59 0.39 RAPTOR 18
19 POEMQA 75.46 65.67 81.64 75.46 69.29 81.77 82.73 73.94 84.80 0.64 0.38 0.73 0.22 -0.04 0.42 0.76 0.66 0.85 75.46 66.97 81.64 75.46 71.61 82.87 82.73 77.12 84.80 0.56 0.33 0.64 0.06 -0.00 0.42 0.66 0.77 0.76 POEMQA 19
20 3DShot1 75.23 69.11 79.28 77.78 76.85 82.45 81.36 75.91 79.69 0.63 0.63 0.54 0.44 0.62 0.49 0.65 0.82 0.42 75.23 69.11 79.28 77.78 76.85 82.45 81.36 75.91 79.69 0.55 0.51 0.44 0.32 0.51 0.38 0.53 0.66 0.28 3DShot1 20
21 LevittGroup 75.00 68.58 83.87 75.46 72.07 79.90 83.64 75.15 90.58 0.61 0.59 0.90 0.22 0.20 0.24 0.83 0.76 1.33 76.15 69.11 83.88 76.85 73.46 80.75 83.64 76.36 90.71 0.62 0.51 0.84 0.22 0.18 0.19 0.74 0.70 1.32 LevittGroup 21
22 BioSerf 74.54 71.48 77.31 79.63 75.93 81.86 79.09 70.00 77.68 0.58 0.80 0.39 0.61 0.54 0.43 0.46 0.34 0.25 74.54 71.48 77.31 79.63 75.93 81.86 79.09 70.00 77.68 0.49 0.71 0.27 0.52 0.42 0.31 0.32 0.12 0.09 BioSerf 22
23 SHORTLE 74.54 68.12 83.98 78.24 74.85 84.91 83.64 76.36 86.38 0.58 0.56 0.91 0.48 0.45 0.74 0.83 0.86 0.98 74.54 68.12 83.98 78.24 74.85 84.91 83.64 76.36 86.38 0.49 0.43 0.85 0.37 0.31 0.64 0.74 0.70 0.91 SHORTLE 23
24 LEE 74.31 66.36 81.53 79.17 74.23 80.75 81.82 73.94 86.41 0.56 0.43 0.72 0.57 0.39 0.32 0.68 0.66 0.98 74.31 70.03 81.53 80.56 78.09 82.58 81.82 78.64 86.41 0.47 0.59 0.64 0.62 0.63 0.39 0.57 0.91 0.91 LEE 24
25 EB_AMU_Physics 74.31 66.06 78.59 78.70 76.54 82.07 78.64 66.82 79.49 0.56 0.41 0.49 0.52 0.59 0.45 0.42 0.07 0.40 74.31 66.06 78.59 78.70 76.54 82.07 78.64 66.82 79.49 0.47 0.26 0.38 0.42 0.48 0.34 0.28 -0.18 0.26 EB_AMU_Physics 25
26 Jiang_Zhu 74.08 68.27 77.25 77.31 74.54 81.80 79.09 73.03 77.82 0.54 0.57 0.38 0.39 0.42 0.43 0.46 0.59 0.26 74.08 68.27 77.25 77.31 74.54 81.80 79.09 73.03 77.82 0.45 0.44 0.27 0.27 0.28 0.31 0.32 0.39 0.10 Jiang_Zhu 26
27 CBSU 74.08 67.36 80.00 77.78 75.93 77.06 82.27 75.00 87.43 0.54 0.50 0.60 0.44 0.54 -0.05 0.72 0.75 1.07 75.46 71.48 81.64 78.70 77.16 81.12 84.09 78.64 87.43 0.56 0.71 0.64 0.42 0.54 0.23 0.78 0.91 1.01 CBSU 27
28 SAM−T08−server 74.08 65.67 82.38 75.46 71.14 83.37 84.09 75.00 85.06 0.54 0.38 0.79 0.22 0.12 0.58 0.87 0.75 0.87 74.08 65.67 82.38 75.46 73.61 83.37 84.09 75.00 85.06 0.45 0.22 0.71 0.06 0.19 0.48 0.78 0.58 0.78 SAM−T08−server 28
29 McGuffin 74.08 65.67 82.38 75.46 71.14 83.09 84.09 75.00 85.06 0.54 0.38 0.79 0.22 0.12 0.56 0.87 0.75 0.87 77.52 72.02 84.50 80.09 78.86 85.33 85.00 78.33 86.64 0.74 0.75 0.89 0.57 0.70 0.69 0.86 0.88 0.93 McGuffin 29
30 MULTICOM−CMFR 73.85 68.81 79.40 75.46 71.76 80.20 83.18 65.00 82.63 0.53 0.61 0.55 0.22 0.18 0.27 0.80 -0.08 0.67 73.85 69.27 79.40 77.78 75.62 81.88 83.18 76.52 82.63 0.43 0.52 0.45 0.32 0.39 0.32 0.70 0.72 0.55 MULTICOM−CMFR 30
31 AMU−Biology 73.85 68.65 78.05 76.39 73.92 81.11 78.64 72.88 79.86 0.53 0.60 0.44 0.31 0.36 0.36 0.42 0.57 0.43 73.85 68.65 78.05 76.39 73.92 81.11 78.64 72.88 80.71 0.43 0.47 0.34 0.17 0.22 0.23 0.28 0.38 0.37 AMU−Biology 31
32 HHpred4 73.85 67.43 79.69 78.24 74.85 81.71 79.09 74.55 82.11 0.53 0.51 0.57 0.48 0.45 0.42 0.46 0.71 0.62 73.85 67.43 79.69 78.24 74.85 81.71 79.09 74.55 82.11 0.43 0.37 0.48 0.37 0.31 0.30 0.32 0.53 0.50 HHpred4 32
33 HHpred2 73.85 67.43 79.69 78.24 74.85 81.71 79.09 74.55 82.11 0.53 0.51 0.57 0.48 0.45 0.42 0.46 0.71 0.62 73.85 67.43 79.69 78.24 74.85 81.71 79.09 74.55 82.11 0.43 0.37 0.48 0.37 0.31 0.30 0.32 0.53 0.50 HHpred2 33
34 HHpred5 73.85 67.43 79.69 78.24 74.85 81.71 79.09 74.55 82.11 0.53 0.51 0.57 0.48 0.45 0.42 0.46 0.71 0.62 73.85 67.43 79.69 78.24 74.85 81.71 79.09 74.55 82.11 0.43 0.37 0.48 0.37 0.31 0.30 0.32 0.53 0.50 HHpred5 34
35 fams−ace2 73.62 65.21 81.22 74.54 68.98 81.53 84.09 75.61 84.76 0.51 0.35 0.69 0.13 -0.06 0.40 0.87 0.80 0.85 76.83 71.33 82.72 78.24 76.08 83.89 84.09 77.73 84.76 0.68 0.69 0.74 0.37 0.43 0.53 0.78 0.83 0.76 fams−ace2 35
36 Bilab−UT 73.39 70.64 77.85 77.78 76.54 81.29 80.00 73.94 79.34 0.49 0.74 0.43 0.44 0.59 0.38 0.53 0.66 0.39 73.39 70.64 77.85 77.78 76.54 81.29 80.00 73.94 79.34 0.39 0.64 0.32 0.32 0.48 0.25 0.41 0.48 0.24 Bilab−UT 36
37 Phragment 73.39 69.11 79.61 75.93 75.31 80.22 80.91 73.33 85.13 0.49 0.63 0.57 0.26 0.49 0.27 0.61 0.61 0.88 73.39 70.11 79.61 75.93 75.31 80.22 80.91 75.91 85.13 0.39 0.59 0.47 0.12 0.36 0.13 0.49 0.66 0.79 Phragment 37
38 PS2−server 73.39 68.96 77.92 78.70 73.77 81.63 79.55 74.70 79.21 0.49 0.62 0.43 0.52 0.35 0.41 0.50 0.72 0.38 73.39 68.96 77.92 78.70 73.77 81.63 79.55 74.70 79.21 0.39 0.50 0.33 0.42 0.21 0.29 0.36 0.55 0.23 PS2−server 38
39 Phyre2 73.39 68.96 78.77 75.93 75.31 80.22 80.00 73.64 83.53 0.49 0.62 0.50 0.26 0.49 0.27 0.53 0.64 0.74 73.39 69.11 78.77 75.93 75.31 80.22 80.00 75.91 83.53 0.39 0.51 0.40 0.12 0.36 0.13 0.41 0.66 0.64 Phyre2 39
40 PS2−manual 73.39 68.96 77.92 78.70 73.77 81.32 79.55 74.70 79.21 0.49 0.62 0.43 0.52 0.35 0.38 0.50 0.72 0.38 73.39 68.96 77.92 78.70 73.77 81.32 79.55 74.70 79.21 0.39 0.50 0.33 0.42 0.21 0.25 0.36 0.55 0.23 PS2−manual 40
41 fais−server 73.39 68.81 79.37 78.70 75.62 82.65 79.09 74.85 80.39 0.49 0.61 0.55 0.52 0.51 0.51 0.46 0.74 0.48 73.39 68.81 79.37 78.70 75.62 82.65 79.09 74.85 80.39 0.39 0.49 0.45 0.42 0.39 0.40 0.32 0.56 0.34 fais−server 41
42 Elofsson 73.39 68.81 80.11 78.24 76.70 81.73 81.36 77.12 82.30 0.49 0.61 0.61 0.48 0.61 0.42 0.65 0.93 0.64 74.08 69.95 80.82 79.63 76.70 82.01 81.82 77.73 83.47 0.45 0.58 0.57 0.52 0.49 0.33 0.57 0.83 0.63 Elofsson 42
43 Poing 73.39 68.81 79.66 75.93 75.31 80.22 80.91 73.33 85.23 0.49 0.61 0.57 0.26 0.49 0.27 0.61 0.61 0.88 73.62 69.19 79.66 75.93 75.31 80.22 80.91 73.33 85.23 0.41 0.52 0.47 0.12 0.36 0.13 0.49 0.42 0.80 Poing 43
44 Sternberg 73.39 68.50 79.80 76.85 73.77 79.96 80.45 72.27 85.50 0.49 0.59 0.58 0.35 0.35 0.24 0.57 0.52 0.91 73.39 68.50 79.80 76.85 73.77 79.96 80.45 72.27 85.50 0.39 0.46 0.49 0.22 0.21 0.11 0.45 0.32 0.83 Sternberg 44
45 Phyre_de_novo 73.39 68.50 79.80 76.85 73.77 80.29 80.45 72.27 85.50 0.49 0.59 0.58 0.35 0.35 0.28 0.57 0.52 0.91 73.39 69.88 79.80 76.85 74.54 80.37 81.36 72.27 85.50 0.39 0.57 0.49 0.22 0.28 0.15 0.53 0.32 0.83 Phyre_de_novo 45
46 MUSTER 73.39 67.74 76.42 79.17 77.01 82.25 79.55 74.70 75.38 0.49 0.53 0.32 0.57 0.63 0.47 0.50 0.72 0.06 73.39 67.74 76.42 79.17 77.01 82.25 79.55 74.70 75.38 0.39 0.40 0.20 0.47 0.52 0.36 0.36 0.55 -0.13 MUSTER 46
47 pro−sp3−TASSER 73.39 66.51 80.96 75.00 71.61 81.80 80.91 74.24 83.74 0.49 0.44 0.67 0.18 0.16 0.43 0.61 0.69 0.76 73.39 66.51 80.96 76.39 74.23 82.33 80.91 74.24 83.74 0.39 0.29 0.59 0.17 0.25 0.36 0.49 0.51 0.66 pro−sp3−TASSER 47
48 DBAKER 73.39 66.06 82.45 77.31 75.15 82.09 81.82 73.94 87.35 0.49 0.41 0.79 0.39 0.47 0.46 0.68 0.66 1.06 74.31 66.97 82.45 77.78 75.31 82.20 82.73 75.76 87.35 0.47 0.33 0.71 0.32 0.36 0.35 0.66 0.65 1.00 DBAKER 48
49 MUProt 73.17 70.87 80.19 78.24 75.15 82.01 80.91 76.97 82.34 0.48 0.76 0.61 0.48 0.47 0.45 0.61 0.91 0.64 73.62 71.18 80.24 78.24 76.70 82.25 81.36 79.55 82.50 0.41 0.68 0.52 0.37 0.49 0.36 0.53 0.99 0.54 MUProt 49
50 MULTICOM−REFINE 73.17 69.95 80.09 78.24 76.70 82.25 80.91 78.48 82.03 0.48 0.69 0.61 0.48 0.61 0.47 0.61 1.04 0.62 73.62 71.18 80.09 78.24 76.70 82.25 81.82 78.94 82.39 0.41 0.68 0.51 0.37 0.49 0.36 0.57 0.94 0.53 MULTICOM−REFINE 50
51 Bates_BMM 73.17 61.85 81.89 78.24 76.39 82.84 79.55 67.73 82.93 0.48 0.10 0.75 0.48 0.58 0.53 0.50 0.15 0.69 77.75 68.04 83.52 85.19 77.62 88.14 80.00 67.73 82.93 0.75 0.42 0.81 1.13 0.58 1.00 0.41 -0.09 0.58 Bates_BMM 51
52 COMA−M 72.94 69.27 78.59 78.24 74.85 82.15 78.18 74.24 79.94 0.46 0.64 0.49 0.48 0.45 0.46 0.38 0.69 0.44 74.08 69.27 78.59 79.63 75.62 82.15 78.18 74.39 79.94 0.45 0.52 0.38 0.52 0.39 0.34 0.24 0.52 0.30 COMA−M 52
53 COMA 72.94 69.27 78.59 78.24 74.85 82.15 78.18 74.24 79.94 0.46 0.64 0.49 0.48 0.45 0.46 0.38 0.69 0.44 74.08 69.27 78.59 79.63 75.62 82.15 78.18 74.39 79.94 0.45 0.52 0.38 0.52 0.39 0.34 0.24 0.52 0.30 COMA 53
54 MULTICOM−CLUSTER 72.94 66.97 79.74 75.46 71.45 82.10 80.91 74.85 81.73 0.46 0.48 0.58 0.22 0.15 0.46 0.61 0.74 0.59 74.08 71.48 79.74 78.70 77.16 82.16 80.91 75.15 81.73 0.45 0.71 0.48 0.42 0.54 0.35 0.49 0.59 0.47 MULTICOM−CLUSTER 54
55 MULTICOM−RANK 72.94 66.82 77.58 78.70 77.16 82.16 77.73 67.42 77.55 0.46 0.47 0.41 0.52 0.65 0.46 0.35 0.12 0.24 73.17 68.58 78.19 79.63 77.16 82.50 80.00 76.97 78.31 0.37 0.47 0.35 0.52 0.54 0.38 0.41 0.76 0.15 MULTICOM−RANK 55
56 ABIpro 72.94 64.83 78.15 77.78 75.62 80.73 77.73 62.58 80.05 0.46 0.32 0.45 0.44 0.51 0.32 0.35 -0.28 0.45 72.94 64.83 78.62 77.78 75.62 80.78 78.18 69.09 80.98 0.35 0.15 0.39 0.32 0.39 0.20 0.24 0.03 0.40 ABIpro 56
57 Chicken_George 72.71 65.98 78.60 78.70 77.16 81.77 78.64 70.45 79.36 0.45 0.40 0.49 0.52 0.65 0.42 0.42 0.37 0.39 75.92 69.95 83.11 79.63 77.47 85.14 84.09 78.48 85.50 0.60 0.58 0.77 0.52 0.57 0.67 0.78 0.90 0.83 Chicken_George 57
58 Kolinski 72.48 66.82 73.74 77.31 74.54 79.37 75.45 70.91 73.73 0.43 0.47 0.10 0.39 0.42 0.18 0.16 0.41 -0.08 72.48 66.82 73.74 77.78 76.85 79.37 75.45 70.91 73.74 0.32 0.32 -0.03 0.32 0.51 0.04 -0.01 0.20 -0.29 Kolinski 58
59 BAKER−ROBETTA 72.48 66.51 80.03 79.17 78.55 83.82 78.18 68.48 81.06 0.43 0.44 0.60 0.57 0.77 0.63 0.38 0.21 0.53 74.08 66.51 81.69 80.09 78.86 84.56 80.00 71.97 83.35 0.45 0.29 0.65 0.57 0.70 0.61 0.41 0.30 0.62 BAKER−ROBETTA 59
60 FAMSD 72.48 66.06 75.60 75.46 72.07 81.45 76.82 65.61 75.60 0.43 0.41 0.25 0.22 0.20 0.39 0.27 -0.03 0.08 72.48 67.05 75.69 75.46 72.69 81.60 76.82 65.61 75.80 0.32 0.34 0.13 0.06 0.10 0.28 0.11 -0.29 -0.09 FAMSD 60
61 circle 72.48 65.75 75.03 76.39 73.30 81.66 77.27 66.67 74.72 0.43 0.39 0.21 0.31 0.31 0.41 0.31 0.06 0.00 72.71 66.44 76.22 76.39 73.30 81.66 79.09 68.18 77.02 0.34 0.29 0.18 0.17 0.16 0.29 0.32 -0.05 0.02 circle 61
62 keasar−server 72.25 69.34 77.46 77.31 74.85 81.78 76.82 73.48 77.80 0.41 0.65 0.40 0.39 0.45 0.42 0.27 0.62 0.26 72.25 69.34 77.63 77.78 75.31 81.78 78.18 73.48 79.61 0.30 0.53 0.30 0.32 0.36 0.30 0.24 0.44 0.27 keasar−server 62
63 Softberry 72.25 68.58 77.76 75.93 74.69 80.04 78.18 73.94 81.13 0.41 0.59 0.42 0.26 0.43 0.25 0.38 0.66 0.54 72.25 68.58 77.76 75.93 74.69 80.04 78.18 73.94 81.13 0.30 0.47 0.31 0.12 0.30 0.12 0.24 0.48 0.41 Softberry 63
64 GS−MetaServer2 72.02 67.43 76.09 78.24 76.39 81.34 75.91 67.42 74.67 0.40 0.51 0.29 0.48 0.58 0.38 0.20 0.12 -0.00 72.02 67.43 76.09 78.24 76.39 81.34 75.91 67.42 74.67 0.28 0.37 0.17 0.37 0.46 0.26 0.03 -0.12 -0.20 GS−MetaServer2 64
65 FFASflextemplate 72.02 66.67 75.62 75.93 73.15 81.20 75.45 68.18 75.06 0.40 0.45 0.25 0.26 0.30 0.37 0.16 0.18 0.03 72.02 66.67 75.62 78.24 73.15 81.53 75.45 68.18 75.06 0.28 0.31 0.13 0.37 0.15 0.28 -0.01 -0.05 -0.16 FFASflextemplate 65
66 FFASsuboptimal 72.02 66.67 75.62 75.93 73.15 81.20 75.45 68.18 75.06 0.40 0.45 0.25 0.26 0.30 0.37 0.16 0.18 0.03 72.02 66.67 75.87 78.24 73.77 81.53 75.45 68.94 76.20 0.28 0.31 0.15 0.37 0.21 0.28 -0.01 0.02 -0.05 FFASsuboptimal 66
67 Pcons_local 72.02 66.06 74.88 79.17 76.70 81.17 75.00 65.61 73.24 0.40 0.41 0.19 0.57 0.61 0.36 0.12 -0.03 -0.12 72.02 66.06 74.88 79.17 76.70 81.17 75.00 65.61 75.40 0.28 0.26 0.06 0.47 0.49 0.24 -0.05 -0.29 -0.13 Pcons_local 67
68 Pcons_dot_net 72.02 66.06 74.88 79.17 76.70 81.17 75.00 65.61 73.24 0.40 0.41 0.19 0.57 0.61 0.36 0.12 -0.03 -0.12 74.08 66.51 81.69 80.09 78.86 84.56 80.00 69.70 83.35 0.45 0.29 0.65 0.57 0.70 0.61 0.41 0.09 0.62 Pcons_dot_net 68
69 Pcons_multi 72.02 66.06 74.88 79.17 76.70 81.17 75.00 65.61 73.24 0.40 0.41 0.19 0.57 0.61 0.36 0.12 -0.03 -0.12 72.71 66.06 78.60 79.17 77.16 82.07 78.64 70.45 81.72 0.34 0.26 0.38 0.47 0.54 0.34 0.28 0.16 0.47 Pcons_multi 69
70 tripos_08 72.02 63.15 75.07 77.31 72.38 77.39 79.55 70.45 79.57 0.40 0.20 0.21 0.39 0.23 -0.02 0.50 0.37 0.41 72.02 63.15 75.07 77.31 72.38 77.39 79.55 70.45 79.57 0.28 0.02 0.08 0.27 0.07 -0.17 0.36 0.16 0.26 tripos_08 70
71 FEIG 71.79 66.90 73.41 76.85 70.68 76.26 78.18 70.61 76.83 0.38 0.47 0.08 0.35 0.08 -0.13 0.38 0.39 0.18 73.85 67.12 80.36 76.85 74.38 82.05 80.91 70.61 83.80 0.43 0.34 0.53 0.22 0.27 0.33 0.49 0.17 0.66 FEIG 71
72 fleil 71.79 66.74 79.14 76.39 75.15 81.17 78.64 73.48 81.74 0.38 0.46 0.53 0.31 0.47 0.36 0.42 0.62 0.59 73.85 70.18 79.14 80.09 79.17 83.37 80.00 74.85 81.74 0.43 0.60 0.43 0.57 0.73 0.48 0.41 0.56 0.47 fleil 72
73 3D−JIGSAW_V3 71.56 65.60 78.21 76.39 73.30 80.96 76.82 68.33 79.91 0.36 0.38 0.46 0.31 0.31 0.34 0.27 0.20 0.44 71.79 67.05 78.21 76.39 73.30 80.96 76.82 69.24 79.91 0.26 0.34 0.35 0.17 0.16 0.22 0.11 0.05 0.30 3D−JIGSAW_V3 73
74 CpHModels 71.33 65.67 73.90 77.78 73.46 81.95 72.27 65.30 69.90 0.35 0.38 0.12 0.44 0.32 0.44 -0.10 -0.05 -0.40 71.33 65.67 73.90 77.78 73.46 81.95 72.27 65.30 69.90 0.22 0.22 -0.02 0.32 0.18 0.32 -0.30 -0.32 -0.65 CpHModels 74
75 Abagyan 71.33 64.30 69.51 77.31 76.39 78.95 74.55 66.67 63.98 0.35 0.28 -0.23 0.39 0.58 0.14 0.08 0.06 -0.90 72.25 64.30 71.36 78.24 76.39 82.19 75.00 67.58 65.54 0.30 0.11 -0.24 0.37 0.46 0.35 -0.05 -0.11 -1.06 Abagyan 75
76 MUFOLD−Server 71.10 64.53 75.69 75.46 72.99 81.23 76.36 67.88 76.52 0.33 0.30 0.26 0.22 0.28 0.37 0.23 0.16 0.15 71.10 64.53 75.69 75.46 72.99 81.23 76.36 67.88 76.52 0.20 0.13 0.13 0.06 0.13 0.24 0.07 -0.08 -0.02 MUFOLD−Server 76
77 panther_server 71.10 63.46 72.17 75.00 74.07 78.37 74.55 62.42 70.62 0.33 0.22 -0.02 0.18 0.38 0.08 0.08 -0.29 -0.34 71.10 63.46 72.17 75.00 74.07 78.37 74.55 62.42 70.62 0.20 0.04 -0.17 0.01 0.24 -0.07 -0.09 -0.58 -0.58 panther_server 77
78 3Dpro 70.87 63.84 74.79 77.78 75.31 80.99 75.45 63.64 73.45 0.32 0.25 0.19 0.44 0.49 0.35 0.16 -0.19 -0.11 70.87 63.84 74.79 77.78 75.31 80.99 75.45 63.64 73.45 0.18 0.07 0.06 0.32 0.36 0.22 -0.01 -0.47 -0.31 3Dpro 78
79 FOLDpro 70.87 63.84 74.79 77.78 75.31 80.99 75.45 63.64 73.45 0.32 0.25 0.19 0.44 0.49 0.35 0.16 -0.19 -0.11 70.87 63.84 74.79 77.78 75.31 80.99 75.45 63.64 73.45 0.18 0.07 0.06 0.32 0.36 0.22 -0.01 -0.47 -0.31 FOLDpro 79
80 PSI 70.64 67.74 75.50 77.31 74.85 82.04 75.00 68.64 74.12 0.30 0.53 0.24 0.39 0.45 0.45 0.12 0.22 -0.05 70.64 67.74 75.50 77.31 74.85 82.04 75.00 68.64 74.12 0.16 0.40 0.12 0.27 0.31 0.33 -0.05 -0.01 -0.25 PSI 80
81 GS−KudlatyPred 70.64 63.91 77.41 78.24 75.46 83.18 75.00 65.61 75.97 0.30 0.25 0.39 0.48 0.50 0.56 0.12 -0.03 0.11 70.64 63.91 77.41 78.24 75.46 83.18 75.00 65.61 75.97 0.16 0.08 0.28 0.37 0.37 0.46 -0.05 -0.29 -0.08 GS−KudlatyPred 81
82 Hao_Kihara 70.64 63.30 75.29 78.70 76.54 82.67 74.09 61.97 72.57 0.30 0.21 0.23 0.52 0.59 0.51 0.05 -0.33 -0.18 70.64 63.30 75.29 78.70 76.54 82.67 74.09 61.97 72.57 0.16 0.03 0.10 0.42 0.48 0.40 -0.14 -0.62 -0.40 Hao_Kihara 82
83 xianmingpan 70.41 63.23 67.64 70.37 66.97 70.87 74.55 67.88 70.28 0.28 0.20 -0.38 -0.26 -0.24 -0.67 0.08 0.16 -0.37 70.41 63.23 67.64 70.37 66.97 70.87 74.55 67.88 70.28 0.14 0.02 -0.56 -0.49 -0.46 -0.88 -0.09 -0.08 -0.61 xianmingpan 83
84 GeneSilicoMetaServer 70.18 65.75 70.73 75.00 73.15 80.41 72.73 65.76 67.27 0.27 0.39 -0.13 0.18 0.30 0.29 -0.07 -0.02 -0.63 72.02 67.43 76.09 78.24 76.39 81.34 75.91 67.42 74.67 0.28 0.37 0.17 0.37 0.46 0.26 0.03 -0.12 -0.20 GeneSilicoMetaServer 84
85 FFASstandard 70.18 63.15 74.50 78.24 72.99 81.53 73.64 62.73 72.80 0.27 0.20 0.16 0.48 0.28 0.40 0.01 -0.27 -0.16 72.02 66.67 75.62 78.24 73.15 81.53 75.45 68.18 75.06 0.28 0.31 0.13 0.37 0.15 0.28 -0.01 -0.05 -0.16 FFASstandard 85
86 fais@hgc 70.18 61.16 78.86 75.00 68.52 82.82 79.55 68.64 82.52 0.27 0.05 0.51 0.18 -0.10 0.53 0.50 0.22 0.66 72.94 61.77 78.86 77.31 73.92 83.01 80.45 70.76 82.52 0.35 -0.10 0.41 0.27 0.22 0.44 0.45 0.19 0.54 fais@hgc 86
87 A−TASSER 70.18 61.16 76.50 73.61 71.14 80.07 76.36 65.45 77.95 0.27 0.05 0.32 0.05 0.12 0.25 0.23 -0.04 0.27 76.61 72.32 76.85 75.46 72.38 80.30 84.55 76.06 78.72 0.66 0.78 0.23 0.06 0.07 0.14 0.82 0.67 0.18 A−TASSER 87
88 mGenTHREADER 69.72 66.67 71.22 76.39 73.30 81.74 70.91 68.79 67.89 0.23 0.45 -0.10 0.31 0.31 0.42 -0.22 0.24 -0.57 69.72 66.67 71.22 76.39 73.30 81.74 70.91 68.79 67.89 0.09 0.31 -0.25 0.17 0.16 0.30 -0.43 0.00 -0.84 mGenTHREADER 88
89 Ozkan−Shell 69.72 62.08 80.53 81.02 76.70 84.27 75.00 55.91 85.23 0.23 0.12 0.64 0.74 0.61 0.67 0.12 -0.83 0.88 80.96 75.00 87.86 91.67 86.42 90.93 85.00 82.58 87.55 1.02 1.00 1.18 1.84 1.44 1.30 0.86 1.27 1.02 Ozkan−Shell 89
90 nFOLD3 69.50 64.60 73.43 76.39 73.30 81.74 70.91 63.64 72.12 0.22 0.30 0.08 0.31 0.31 0.42 -0.22 -0.19 -0.22 72.71 64.60 73.43 79.63 75.31 82.01 77.27 70.00 72.12 0.34 0.14 -0.06 0.52 0.36 0.33 0.16 0.12 -0.44 nFOLD3 90
91 SMEG−CCP 68.81 61.77 69.43 71.76 64.97 68.26 76.36 71.82 74.87 0.17 0.10 -0.24 -0.13 -0.41 -0.93 0.23 0.49 0.01 68.81 61.77 69.43 71.76 64.97 68.26 76.36 71.82 74.87 0.01 -0.10 -0.40 -0.34 -0.65 -1.17 0.07 0.28 -0.18 SMEG−CCP 91
92 FUGUE_KM 68.12 60.93 72.13 75.46 73.92 81.30 69.09 58.79 69.15 0.12 0.04 -0.02 0.22 0.36 0.38 -0.37 -0.59 -0.47 68.12 60.93 72.13 75.46 73.92 81.30 69.09 58.79 69.15 -0.05 -0.17 -0.17 0.06 0.22 0.25 -0.59 -0.92 -0.72 FUGUE_KM 92
93 LOOPP_Server 67.20 61.39 65.00 77.78 74.07 81.08 64.09 55.91 54.46 0.06 0.07 -0.59 0.44 0.38 0.35 -0.78 -0.83 -1.70 67.20 61.39 65.00 77.78 74.07 81.08 64.09 55.91 54.46 -0.12 -0.13 -0.78 0.32 0.24 0.23 -1.05 -1.18 -2.11 LOOPP_Server 93
94 SAM−T02−server 66.97 63.76 67.66 75.00 73.46 80.25 66.82 59.24 61.55 0.04 0.24 -0.38 0.18 0.32 0.27 -0.55 -0.56 -1.11 66.97 63.76 67.66 75.00 73.46 80.25 66.82 59.24 61.55 -0.14 0.07 -0.56 0.01 0.18 0.14 -0.80 -0.87 -1.44 SAM−T02−server 94
95 Pushchino 66.51 64.07 63.27 74.07 73.15 77.75 67.73 65.61 56.97 0.01 0.27 -0.72 0.09 0.30 0.02 -0.48 -0.03 -1.49 66.51 64.07 63.27 74.07 73.15 77.75 67.73 65.61 56.97 -0.18 0.09 -0.93 -0.09 0.15 -0.13 -0.72 -0.29 -1.87 Pushchino 95
96 TJ_Jiang 64.45 49.47 77.67 78.70 74.69 82.24 64.55 47.88 77.64 -0.14 -0.80 0.41 0.52 0.43 0.47 -0.74 -1.50 0.25 69.72 64.53 78.84 78.70 74.69 82.24 75.00 64.70 80.26 0.09 0.13 0.40 0.42 0.30 0.35 -0.05 -0.37 0.33 TJ_Jiang 96
97 StruPPi 62.84 53.52 68.00 77.78 73.15 78.57 63.64 56.36 64.00 -0.25 -0.50 -0.35 0.44 0.30 0.10 -0.82 -0.79 -0.90 62.84 53.52 68.00 77.78 73.15 78.57 64.09 56.36 64.00 -0.48 -0.78 -0.53 0.32 0.15 -0.04 -1.05 -1.14 -1.21 StruPPi 97
98 rehtnap 62.62 58.18 66.21 75.93 73.46 78.83 58.64 51.97 59.94 -0.27 -0.16 -0.49 0.26 0.32 0.13 -1.23 -1.16 -1.24 62.62 58.72 66.61 75.93 73.46 79.52 58.64 51.97 61.08 -0.50 -0.35 -0.65 0.12 0.18 0.06 -1.55 -1.54 -1.48 rehtnap 98
99 SAM−T06−server 62.16 51.91 64.16 56.94 50.46 53.64 80.00 73.94 81.75 -0.30 -0.62 -0.65 -1.52 -1.67 -2.39 0.53 0.66 0.59 66.28 64.45 64.78 75.46 73.61 81.31 80.00 73.94 81.75 -0.20 0.12 -0.80 0.06 0.19 0.25 0.41 0.48 0.47 SAM−T06−server 99
100 YASARA 59.86 50.38 62.28 56.48 46.30 53.35 74.09 71.97 78.50 -0.47 -0.73 -0.80 -1.57 -2.03 -2.42 0.05 0.50 0.32 59.86 51.22 62.28 56.48 46.30 53.45 75.00 72.27 79.16 -0.73 -0.97 -1.02 -2.01 -2.47 -2.78 -0.05 0.32 0.23 YASARA 100
101 Distill 58.49 50.84 57.80 64.35 62.81 59.37 65.00 58.03 64.94 -0.56 -0.70 -1.16 -0.83 -0.60 -1.82 -0.70 -0.66 -0.82 59.63 50.84 61.60 67.59 66.67 62.66 70.00 61.82 70.40 -0.75 -1.01 -1.08 -0.80 -0.48 -1.77 -0.51 -0.64 -0.60 Distill 101
102 MUFOLD−MD 49.54 46.33 68.31 70.37 58.95 79.19 77.27 68.48 76.45 -1.20 -1.03 -0.33 -0.26 -0.93 0.16 0.31 0.21 0.15 52.52 46.33 70.78 72.22 64.81 82.06 77.27 68.48 81.66 -1.34 -1.38 -0.29 -0.29 -0.67 0.33 0.16 -0.02 0.46 MUFOLD−MD 102
103 ProtAnG 49.54 45.57 45.71 68.06 61.27 57.52 37.27 34.85 40.21 -1.20 -1.08 -2.11 -0.48 -0.73 -2.01 -2.99 -2.57 -2.90 49.54 45.57 45.71 68.06 61.27 57.52 37.27 34.85 40.21 -1.59 -1.44 -2.44 -0.74 -1.01 -2.33 -3.50 -3.12 -3.46 ProtAnG 103
104 Fiser−M4T 48.39 42.12 43.95 65.74 59.57 71.92 34.09 32.58 23.07 -1.28 -1.33 -2.25 -0.69 -0.88 -0.56 -3.25 -2.76 -4.34 48.39 42.12 43.95 65.74 59.57 71.92 34.09 32.58 23.07 -1.68 -1.73 -2.59 -1.00 -1.18 -0.77 -3.80 -3.33 -5.08 Fiser−M4T 104
105 DelCLab 47.94 45.03 47.61 54.63 46.91 51.69 53.18 40.76 52.65 -1.31 -1.12 -1.96 -1.74 -1.98 -2.59 -1.68 -2.08 -1.85 47.94 45.03 47.65 56.02 46.91 51.69 53.64 41.21 52.87 -1.72 -1.49 -2.28 -2.06 -2.41 -2.97 -2.01 -2.53 -2.26 DelCLab 105
106 METATASSER 45.41 42.20 55.62 76.39 72.99 79.87 54.09 44.39 49.82 -1.49 -1.33 -1.33 0.31 0.28 0.23 -1.60 -1.78 -2.09 74.08 68.73 78.52 78.24 76.39 82.36 81.82 73.94 80.82 0.45 0.48 0.38 0.37 0.46 0.37 0.57 0.48 0.38 METATASSER 106
107 FALCON_CONSENSUS 43.58 38.46 61.21 68.06 63.43 72.32 67.73 59.24 71.56 -1.62 -1.60 -0.89 -0.48 -0.54 -0.52 -0.48 -0.56 -0.26 71.33 67.51 75.28 78.70 76.54 82.69 75.91 71.97 73.23 0.22 0.38 0.10 0.42 0.48 0.40 0.03 0.30 -0.34 FALCON_CONSENSUS 107
108 FALCON 43.58 38.46 61.21 68.06 63.43 72.32 67.73 59.24 71.56 -1.62 -1.60 -0.89 -0.48 -0.54 -0.52 -0.48 -0.56 -0.26 71.33 67.51 75.28 78.70 76.54 82.69 75.91 71.97 73.23 0.22 0.38 0.10 0.42 0.48 0.40 0.03 0.30 -0.34 FALCON 108
109 3DShot2 43.35 33.87 39.33 72.22 61.73 69.47 30.91 25.30 30.80 -1.64 -1.93 -2.62 -0.09 -0.69 -0.81 -3.52 -3.36 -3.69 43.35 33.87 39.33 72.22 61.73 69.47 30.91 25.30 30.80 -2.10 -2.41 -2.99 -0.29 -0.97 -1.03 -4.09 -4.00 -4.35 3DShot2 109
110 JIVE08 40.60 36.24 42.34 64.81 56.48 56.09 55.91 48.33 50.89 -1.83 -1.76 -2.38 -0.78 -1.15 -2.15 -1.45 -1.46 -2.00 40.60 36.24 53.29 64.81 56.48 67.36 59.09 53.94 60.73 -2.33 -2.22 -1.79 -1.10 -1.48 -1.26 -1.51 -1.36 -1.52 JIVE08 110
111 POEM 37.38 29.28 63.82 61.57 56.94 79.34 68.64 55.00 68.86 -2.06 -2.27 -0.68 -1.09 -1.11 0.18 -0.40 -0.91 -0.49 50.46 45.03 81.64 78.24 70.22 86.33 73.64 66.06 84.80 -1.51 -1.49 0.64 0.37 -0.14 0.80 -0.18 -0.25 0.76 POEM 111
112 Sasaki−Cetin−Sasai 35.55 28.67 58.13 67.13 65.89 77.43 51.82 46.36 59.70 -2.19 -2.31 -1.13 -0.56 -0.33 -0.01 -1.79 -1.62 -1.26 44.04 38.84 60.68 71.30 66.36 82.31 51.82 46.36 61.18 -2.05 -2.00 -1.16 -0.39 -0.51 0.36 -2.17 -2.06 -1.47 Sasaki−Cetin−Sasai 112
113 SAINT1 34.40 32.65 48.11 47.22 40.43 62.89 57.27 50.91 54.12 -2.27 -2.02 -1.92 -2.44 -2.54 -1.47 -1.34 -1.24 -1.73 34.40 32.65 48.11 47.22 40.43 62.89 57.27 50.91 54.12 -2.85 -2.51 -2.24 -3.02 -3.04 -1.75 -1.67 -1.64 -2.14 SAINT1 113
114 Handl−Lovell 33.03 25.54 55.23 41.20 39.04 67.64 61.82 46.67 63.71 -2.37 -2.54 -1.36 -3.00 -2.66 -0.99 -0.97 -1.60 -0.92 39.45 36.54 55.23 41.20 39.04 67.64 77.73 72.27 78.47 -2.43 -2.19 -1.62 -3.68 -3.17 -1.23 0.20 0.32 0.16 Handl−Lovell 114
115 RBO−Proteus 30.73 28.06 54.69 43.06 37.81 64.51 55.91 50.76 65.93 -2.53 -2.36 -1.40 -2.83 -2.77 -1.31 -1.45 -1.26 -0.74 49.31 35.24 71.70 59.72 57.56 79.21 76.82 65.00 81.45 -1.61 -2.30 -0.21 -1.66 -1.37 0.02 0.11 -0.34 0.44 RBO−Proteus 115
116 FLOUDAS 30.05 25.77 37.21 32.41 29.32 44.17 45.00 39.24 49.95 -2.58 -2.52 -2.78 -3.83 -3.50 -3.34 -2.35 -2.21 -2.08 32.34 27.60 40.09 46.30 35.80 46.95 45.00 39.24 54.48 -3.02 -2.93 -2.93 -3.12 -3.49 -3.48 -2.80 -2.71 -2.11 FLOUDAS 116
117 keasar 28.67 25.31 55.07 43.52 36.42 64.18 55.91 49.55 66.04 -2.68 -2.56 -1.37 -2.78 -2.89 -1.34 -1.45 -1.36 -0.73 73.39 62.00 79.13 77.31 74.54 81.02 80.45 69.55 82.35 0.39 -0.08 0.43 0.27 0.28 0.22 0.45 0.07 0.53 keasar 117
118 DistillSN 27.98 23.01 34.46 43.98 38.12 44.00 35.45 30.45 43.48 -2.73 -2.72 -3.00 -2.74 -2.74 -3.36 -3.14 -2.94 -2.63 27.98 23.01 34.46 43.98 38.12 44.94 38.18 31.36 45.94 -3.38 -3.31 -3.41 -3.38 -3.26 -3.70 -3.42 -3.44 -2.92 DistillSN 118
119 forecast 23.16 19.04 31.43 32.87 29.48 39.18 45.91 37.73 46.49 -3.07 -3.01 -3.24 -3.79 -3.49 -3.84 -2.28 -2.34 -2.37 28.67 23.78 38.71 35.19 30.25 39.71 53.64 45.00 61.06 -3.32 -3.25 -3.04 -4.34 -4.03 -4.27 -2.01 -2.18 -1.49 forecast 119
120 huber−torda−server 22.48 20.64 16.73 31.94 30.09 28.34 30.45 25.00 28.70 -3.12 -2.90 -4.40 -3.87 -3.43 -4.93 -3.55 -3.39 -3.87 22.48 20.64 23.66 31.94 30.09 34.95 36.82 31.36 38.16 -3.84 -3.51 -4.34 -4.69 -4.04 -4.79 -3.55 -3.44 -3.65 huber−torda−server 120
121 ShakAbInitio 22.25 17.51 28.70 34.26 31.79 40.80 37.73 31.97 38.38 -3.13 -3.12 -3.46 -3.65 -3.29 -3.68 -2.95 -2.81 -3.05 22.25 17.97 33.60 35.19 32.41 44.82 39.09 38.48 42.57 -3.86 -3.73 -3.48 -4.34 -3.82 -3.71 -3.34 -2.78 -3.23 ShakAbInitio 121
122 Zhou−SPARKS 19.27 17.28 30.67 31.94 28.24 36.32 34.55 30.30 44.75 -3.34 -3.14 -3.30 -3.87 -3.60 -4.13 -3.22 -2.95 -2.52 19.27 17.28 30.67 31.94 28.24 36.32 34.55 30.30 44.75 -4.10 -3.79 -3.73 -4.69 -4.22 -4.64 -3.75 -3.54 -3.03 Zhou−SPARKS 122
123 Wolynes 19.27 15.14 33.36 34.72 28.24 41.74 31.82 28.64 46.48 -3.34 -3.30 -3.09 -3.61 -3.60 -3.59 -3.44 -3.09 -2.37 20.87 17.89 33.36 35.65 30.09 41.74 33.64 28.64 46.48 -3.97 -3.74 -3.50 -4.29 -4.04 -4.05 -3.84 -3.69 -2.86 Wolynes 123
124 ACOMPMOD 18.81 16.44 24.75 37.50 32.25 43.09 29.09 24.24 30.89 -3.38 -3.20 -3.77 -3.35 -3.25 -3.45 -3.67 -3.45 -3.68 30.96 24.31 41.02 37.50 32.25 44.93 59.09 51.52 68.91 -3.13 -3.21 -2.85 -4.08 -3.83 -3.70 -1.51 -1.58 -0.74 ACOMPMOD 124
125 MeilerLabRene 18.58 16.21 26.63 30.09 26.70 36.19 33.18 29.55 36.15 -3.39 -3.22 -3.62 -4.05 -3.73 -4.14 -3.33 -3.01 -3.24 22.02 20.03 29.88 37.04 34.26 42.27 33.18 29.55 40.29 -3.88 -3.56 -3.80 -4.13 -3.64 -3.99 -3.88 -3.61 -3.45 MeilerLabRene 125
126 PRI−Yang−KiharA 18.12 14.98 21.83 27.32 24.69 25.86 29.55 27.42 37.96 -3.43 -3.31 -4.00 -4.31 -3.90 -5.18 -3.63 -3.19 -3.09 18.12 14.98 21.83 27.32 24.69 25.86 29.55 27.42 37.96 -4.20 -3.98 -4.49 -5.20 -4.57 -5.78 -4.21 -3.80 -3.67 PRI−Yang−KiharA 126
127 mariner1 17.89 15.83 19.43 27.78 22.99 27.11 27.73 22.88 33.80 -3.44 -3.25 -4.19 -4.26 -4.05 -5.05 -3.78 -3.57 -3.44 24.77 19.57 25.34 44.44 35.80 43.71 30.91 23.64 33.80 -3.65 -3.60 -4.19 -3.33 -3.49 -3.84 -4.09 -4.15 -4.06 mariner1 127
128 RANDOM 17.69 14.65 17.69 27.45 23.91 27.45 31.07 25.98 31.07 -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67 17.69 14.65 17.69 27.45 23.91 27.45 31.07 25.98 31.07 -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 RANDOM 128
129 TWPPLAB 17.20 13.69 21.01 29.63 21.30 29.57 26.82 20.15 30.87 -3.49 -3.40 -4.06 -4.09 -4.20 -4.81 -3.85 -3.79 -3.69 17.20 13.69 21.01 29.63 21.30 29.57 26.82 20.15 30.87 -4.28 -4.09 -4.56 -4.94 -4.90 -5.37 -4.46 -4.47 -4.34 TWPPLAB 129
130 dill_ucsf 16.74 14.60 17.01 25.00 23.77 28.54 24.55 21.52 26.57 -3.52 -3.34 -4.38 -4.53 -3.98 -4.91 -4.04 -3.68 -4.05 19.04 17.20 20.60 28.24 23.77 34.90 26.82 24.55 29.52 -4.12 -3.80 -4.60 -5.10 -4.66 -4.79 -4.46 -4.07 -4.47 dill_ucsf 130
131 OLGAFS 16.51 14.30 11.73 25.46 18.36 19.88 28.18 23.64 26.29 -3.54 -3.36 -4.80 -4.48 -4.45 -5.78 -3.74 -3.50 -4.07 16.51 14.98 12.14 25.46 19.29 19.88 29.55 25.45 27.06 -4.33 -3.98 -5.33 -5.40 -5.09 -6.43 -4.21 -3.98 -4.70 OLGAFS 131
132 schenk−torda−server 16.51 13.69 20.61 23.15 18.83 29.56 30.00 24.24 34.79 -3.54 -3.40 -4.09 -4.70 -4.41 -4.81 -3.59 -3.45 -3.36 17.43 15.67 20.61 28.24 27.01 31.89 30.00 25.30 34.79 -4.26 -3.92 -4.60 -5.10 -4.34 -5.12 -4.17 -4.00 -3.97 schenk−torda−server 132
133 psiphifoldings 15.37 13.46 25.21 25.93 22.53 32.31 30.00 25.76 39.42 -3.62 -3.42 -3.73 -4.44 -4.09 -4.53 -3.59 -3.33 -2.97 15.37 13.46 25.21 25.93 22.53 32.31 30.00 25.76 39.42 -4.43 -4.11 -4.20 -5.35 -4.78 -5.07 -4.17 -3.95 -3.53 psiphifoldings 133
134 Frankenstein 13.99 11.31 12.64 26.85 20.37 27.12 25.00 21.82 22.13 -3.72 -3.57 -4.72 -4.35 -4.28 -5.05 -4.00 -3.65 -4.42 18.81 17.81 22.47 36.57 30.71 40.28 31.82 28.18 36.03 -4.14 -3.75 -4.44 -4.19 -3.98 -4.21 -4.00 -3.73 -3.85 Frankenstein 134
135 mahmood−torda−server 12.38 9.79 14.39 21.30 17.59 23.70 23.64 18.48 28.54 -3.83 -3.69 -4.59 -4.87 -4.52 -5.39 -4.12 -3.93 -3.88 18.58 16.44 22.43 27.32 25.15 31.94 30.45 22.58 36.84 -4.16 -3.86 -4.44 -5.20 -4.52 -5.11 -4.13 -4.25 -3.78 mahmood−torda−server 135
136 BHAGEERATH                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 BHAGEERATH 136
137 FEIG_REFINE                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 FEIG_REFINE 137
138 FrankensteinLong                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 FrankensteinLong 138
139 HCA                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 HCA 139
140 KudlatyPredHuman                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 KudlatyPredHuman 140
141 LEE−SERVER                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 LEE−SERVER 141
142 Linnolt−UH−CMB                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 Linnolt−UH−CMB 142
143 NIM2                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 NIM2 143
144 Nano_team                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 Nano_team 144
145 NirBenTal                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 NirBenTal 145
146 PHAISTOS                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 PHAISTOS 146
147 POISE                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 POISE 147
148 PZ−UAM                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 PZ−UAM 148
149 ProteinShop                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 ProteinShop 149
150 RPFM                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 RPFM 150
151 Scheraga                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 Scheraga 151
152 TsaiLab                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 TsaiLab 152
153 UCDavisGenome                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 UCDavisGenome 153
154 Wolfson−FOBIA                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 Wolfson−FOBIA 154
155 YASARARefine                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 YASARARefine 155
156 dill_ucsf_extended                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 dill_ucsf_extended 156
157 igor                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 igor 157
158 jacobson                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 jacobson 158
159 mti                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 mti 159
160 mumssp                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 mumssp 160
161 pipe_int                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 pipe_int 161
162 ricardo                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 ricardo 162
163 rivilo                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 rivilo 163
164 sessions                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 sessions 164
165 taylor                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 taylor 165
166 test_http_server_01                                                       -3.46 -3.33 -4.33 -4.29 -3.97 -5.02 -3.50 -3.31 -3.67                                                       -4.24 -4.01 -4.85 -5.18 -4.64 -5.60 -4.07 -3.93 -4.32 test_http_server_01 166