T0446

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0446

pleckstrin-homology domain (YP_001092950.1) from Shewanella loihica

Target type: Human/Server

Target sequence:

>T0446 YP_001092950.1, Shewanella loihica, 124 residues
MGLLDALMGNAAEVNLDELAQELGPIMGDNEQLALAYRVIRDMFVFTNKRLILIDKQGVTGKKVSYHSVPYKAITHFEVETAGTFDMDAELKLWISGQKDPLVKELKKGTDVVGIQKTIANFSL

Structure:
Method: X-ray, res=2.Å, R/Rfree=0.19/0.23
Determined by: JCSG
PDB ID: 3dcx

3dcx_A cartoon
Cartoon diagram of 446: 3dcx chain A

PyMOL of 3dcx

Domains:  PyMOL of domains

Single domain protein.

Structure classification:

PH domain β-barrel fold.

CASP category:

Comparative modeling:hard.

Closest templates:

3b77.

Target sequence - PDB file inconsistencies:

T0446    3dcx.pdb    T0446.pdb    PyMOL    PyMOL of domains    

T0446    1 MGLLDALMGNAAEVNLDELAQELGPIMGDNEQLALAYRVIRDMFVFTNKRLILIDKQGVTGKKVSYHSVPYKAITHFEVETAGTFDMDAELKLWISGQKDPLVKELKKGTDVVGIQKTIANFSL 124
           ~~~~~~~:||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3dcxA    0 -------GGNAAEVNLDELAQELGPIMGDNEQLALAYRVIRDMFVFTNKRLILIDKQGVTGKKVSYHSVPYKAITHFEVETAGTFDMDAELKLWISGQKDPLVKELKKGTDVVGIQKTIANFSL 124

Residue change log: change 0 G to M; change 27, 43, 87, MSE to MET;

Single domain protein: target 8-124 ; pdb 0-124

Sequence classification:

DUF1696 in Pfam.

Server predictions:

T0446:pdb 0-124:seq 8-124:CM_hard;   alignment

distribution of first scores
First models for T0446: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0446 T0446 T0446 T0446
First score First Z-score Best score Best Z-score
1 LEE 70.51 66.95 73.20 2.14 3.10 2.64 70.51 66.95 73.20 2.53 3.34 2.37 LEE 1
2 3DShot2 67.31 60.76 62.01 1.68 2.14 0.74 67.31 60.76 62.01 1.86 2.09 0.30 3DShot2 2
3 SAM−T08−server 65.60 57.76 68.54 1.44 1.68 1.85 65.60 57.76 68.54 1.50 1.48 1.51 SAM−T08−server 3
4 3D−JIGSAW_AEP 64.53 57.84 65.59 1.29 1.69 1.34 64.53 57.84 65.59 1.27 1.50 0.96 3D−JIGSAW_AEP 4
5 FEIG 63.46 54.27 65.95 1.14 1.14 1.41 63.46 54.27 67.55 1.04 0.78 1.32 FEIG 5
6 IBT_LT 63.46 52.07 65.41 1.14 0.80 1.31 63.46 52.07 65.41 1.04 0.33 0.93 IBT_LT 6
7 Zhang 62.39 53.28 63.74 0.98 0.98 1.03 62.39 53.49 64.93 0.82 0.62 0.84 Zhang 7
8 COMA−M 62.18 55.20 61.99 0.95 1.28 0.73 62.18 55.20 61.99 0.77 0.97 0.30 COMA−M 8
9 ZicoFullSTP 62.18 54.34 63.96 0.95 1.15 1.07 62.18 55.13 64.68 0.77 0.95 0.79 ZicoFullSTP 9
10 mufold 61.97 54.13 63.53 0.93 1.12 0.99 61.97 54.13 66.55 0.73 0.75 1.14 mufold 10
11 Zhang−Server 61.97 52.99 63.15 0.93 0.94 0.93 62.39 53.92 64.07 0.82 0.71 0.68 Zhang−Server 11
12 Sternberg 61.97 52.99 63.59 0.93 0.94 1.00 61.97 52.99 63.59 0.73 0.52 0.59 Sternberg 12
13 3DShot1 61.97 50.71 62.84 0.93 0.59 0.88 61.97 50.71 62.84 0.73 0.06 0.45 3DShot1 13
14 3D−JIGSAW_V3 61.75 55.34 63.06 0.89 1.30 0.91 63.03 58.05 63.85 0.95 1.54 0.64 3D−JIGSAW_V3 14
15 Zico 61.33 54.63 64.68 0.83 1.19 1.19 62.18 55.13 64.68 0.77 0.95 0.79 Zico 15
16 ZicoFullSTPFullData 61.33 54.63 64.68 0.83 1.19 1.19 62.18 55.13 64.68 0.77 0.95 0.79 ZicoFullSTPFullData 16
17 SAMUDRALA 61.11 53.56 61.62 0.80 1.03 0.67 61.11 54.34 63.53 0.55 0.79 0.58 SAMUDRALA 17
18 3DShotMQ 61.11 52.28 63.40 0.80 0.83 0.97 61.11 52.28 63.40 0.55 0.37 0.56 3DShotMQ 18
19 fams−ace2 60.90 51.50 62.68 0.77 0.71 0.85 62.18 54.49 62.68 0.77 0.82 0.42 fams−ace2 19
20 METATASSER 60.47 53.49 62.73 0.71 1.02 0.86 64.10 56.41 67.32 1.18 1.21 1.28 METATASSER 20
21 SAM−T08−human 60.47 48.79 63.66 0.71 0.29 1.02 65.60 57.05 69.06 1.50 1.34 1.60 SAM−T08−human 21
22 GeneSilico 60.26 48.01 65.92 0.68 0.17 1.40 60.26 50.14 65.92 0.37 -0.06 1.02 GeneSilico 22
23 HHpred2 60.26 45.01 65.08 0.68 -0.29 1.26 60.26 45.01 65.08 0.37 -1.10 0.87 HHpred2 23
24 SAM−T06−server 60.04 51.35 61.99 0.65 0.69 0.73 60.04 51.35 61.99 0.32 0.19 0.30 SAM−T06−server 24
25 COMA 60.04 50.50 59.49 0.65 0.56 0.31 60.04 50.50 61.99 0.32 0.01 0.30 COMA 25
26 Bates_BMM 60.04 49.57 66.68 0.65 0.41 1.53 60.90 50.50 68.55 0.50 0.01 1.51 Bates_BMM 26
27 TASSER 60.04 48.93 63.13 0.65 0.31 0.93 60.47 52.92 63.13 0.41 0.50 0.51 TASSER 27
28 BAKER−ROBETTA 59.83 51.99 59.60 0.62 0.79 0.33 59.83 53.35 60.29 0.28 0.59 -0.02 BAKER−ROBETTA 28
29 Jones−UCL 59.83 49.15 62.59 0.62 0.35 0.83 59.83 49.15 62.59 0.28 -0.26 0.41 Jones−UCL 29
30 MidwayFolding 59.83 46.44 62.40 0.62 -0.07 0.80 59.83 46.44 62.95 0.28 -0.81 0.47 MidwayFolding 30
31 Elofsson 59.62 49.93 62.75 0.59 0.47 0.86 59.62 51.64 63.18 0.23 0.25 0.52 Elofsson 31
32 MULTICOM 59.40 52.99 60.43 0.56 0.94 0.47 65.81 57.55 69.21 1.54 1.44 1.63 MULTICOM 32
33 EB_AMU_Physics 59.40 51.99 60.49 0.56 0.79 0.48 59.40 51.99 60.49 0.19 0.32 0.02 EB_AMU_Physics 33
34 PRI−Yang−KiharA 59.40 49.57 61.20 0.56 0.41 0.60 59.40 49.57 61.20 0.19 -0.17 0.15 PRI−Yang−KiharA 34
35 nFOLD3 59.19 53.63 57.25 0.53 1.04 -0.07 59.62 53.63 61.23 0.23 0.65 0.16 nFOLD3 35
36 GS−KudlatyPred 58.97 51.14 58.39 0.50 0.65 0.12 58.97 51.14 58.39 0.10 0.14 -0.37 GS−KudlatyPred 36
37 FALCON_CONSENSUS 58.97 49.15 58.83 0.50 0.35 0.20 58.97 52.35 59.26 0.10 0.39 -0.21 FALCON_CONSENSUS 37
38 FALCON 58.97 49.15 58.83 0.50 0.35 0.20 58.97 52.35 59.26 0.10 0.39 -0.21 FALCON 38
39 HHpred4 58.76 50.93 62.21 0.47 0.62 0.77 58.76 50.93 62.21 0.05 0.10 0.34 HHpred4 39
40 HHpred5 58.76 50.93 62.21 0.47 0.62 0.77 58.76 50.93 62.21 0.05 0.10 0.34 HHpred5 40
41 fleil 58.76 48.22 61.70 0.47 0.20 0.68 59.40 51.21 62.28 0.19 0.16 0.35 fleil 41
42 Phragment 58.76 47.37 61.36 0.47 0.07 0.63 64.74 55.06 67.78 1.31 0.94 1.37 Phragment 42
43 TJ_Jiang 58.55 49.29 60.25 0.44 0.37 0.44 58.55 49.57 60.25 0.01 -0.17 -0.02 TJ_Jiang 43
44 PS2−manual 58.12 51.14 61.34 0.38 0.65 0.62 62.61 55.06 62.68 0.86 0.94 0.42 PS2−manual 44
45 Kolinski 58.12 50.85 58.94 0.38 0.61 0.21 58.55 50.85 59.02 0.01 0.09 -0.25 Kolinski 45
46 PSI 58.12 50.43 66.20 0.38 0.54 1.45 59.40 51.42 66.29 0.19 0.20 1.09 PSI 46
47 FFASsuboptimal 58.12 49.86 60.86 0.38 0.46 0.54 59.19 49.86 60.86 0.14 -0.11 0.09 FFASsuboptimal 47
48 FAMS−multi 58.12 48.15 61.80 0.38 0.19 0.70 58.55 50.64 62.48 0.01 0.04 0.39 FAMS−multi 48
49 Jiang_Zhu 58.12 47.29 60.64 0.38 0.06 0.50 58.12 47.29 60.64 -0.08 -0.63 0.05 Jiang_Zhu 49
50 LevittGroup 58.12 44.87 61.00 0.38 -0.31 0.56 58.76 47.37 61.51 0.05 -0.62 0.21 LevittGroup 50
51 Chicken_George 57.91 49.36 61.03 0.35 0.38 0.57 59.83 50.71 62.16 0.28 0.06 0.33 Chicken_George 51
52 panther_server 57.91 47.22 55.31 0.35 0.05 -0.40 57.91 47.22 55.31 -0.13 -0.65 -0.94 panther_server 52
53 ABIpro 57.69 52.71 56.99 0.32 0.90 -0.12 57.69 52.71 57.18 -0.18 0.46 -0.59 ABIpro 53
54 Pcons_local 57.69 51.00 55.57 0.32 0.63 -0.36 58.76 51.07 58.76 0.05 0.13 -0.30 Pcons_local 54
55 CpHModels 57.69 49.00 56.76 0.32 0.32 -0.16 57.69 49.00 56.76 -0.18 -0.29 -0.67 CpHModels 55
56 fais@hgc 57.69 47.72 65.91 0.32 0.13 1.40 62.18 56.48 66.49 0.77 1.22 1.13 fais@hgc 56
57 FFASstandard 57.48 49.50 58.22 0.29 0.40 0.09 57.48 49.50 58.22 -0.22 -0.19 -0.40 FFASstandard 57
58 FFASflextemplate 57.48 47.65 57.13 0.29 0.11 -0.09 57.48 49.50 58.22 -0.22 -0.19 -0.40 FFASflextemplate 58
59 RAPTOR 57.48 47.22 59.81 0.29 0.05 0.36 58.97 47.22 60.97 0.10 -0.65 0.11 RAPTOR 59
60 GS−MetaServer2 57.48 46.37 57.28 0.29 -0.08 -0.07 57.69 49.15 58.07 -0.18 -0.26 -0.43 GS−MetaServer2 60
61 FrankensteinLong 57.27 51.21 56.42 0.26 0.66 -0.21 63.46 56.91 66.04 1.04 1.31 1.05 FrankensteinLong 61
62 SAM−T02−server 57.27 48.72 56.87 0.26 0.28 -0.14 57.27 51.07 56.87 -0.26 0.13 -0.65 SAM−T02−server 62
63 pipe_int 56.84 51.57 61.51 0.20 0.72 0.65 56.84 51.57 61.51 -0.35 0.23 0.21 pipe_int 63
64 GeneSilicoMetaServer 56.84 49.15 58.07 0.20 0.35 0.07 57.69 49.15 58.07 -0.18 -0.26 -0.43 GeneSilicoMetaServer 64
65 Phyre2 56.62 42.95 59.60 0.16 -0.61 0.33 62.18 53.06 67.68 0.77 0.53 1.35 Phyre2 65
66 Phyre_de_novo 56.62 42.95 59.60 0.16 -0.61 0.33 62.18 53.06 67.68 0.77 0.53 1.35 Phyre_de_novo 66
67 Hao_Kihara 56.20 49.22 55.15 0.11 0.36 -0.43 58.97 49.22 61.13 0.10 -0.24 0.14 Hao_Kihara 67
68 SMEG−CCP 56.20 48.50 54.02 0.11 0.25 -0.62 56.20 48.50 54.02 -0.49 -0.39 -1.17 SMEG−CCP 68
69 CBSU 56.20 45.66 57.14 0.11 -0.19 -0.09 59.62 55.48 57.14 0.23 1.02 -0.60 CBSU 69
70 pro−sp3−TASSER 56.20 45.23 55.15 0.11 -0.26 -0.43 61.54 51.28 60.21 0.64 0.17 -0.03 pro−sp3−TASSER 70
71 PS2−server 56.20 39.39 61.49 0.11 -1.16 0.65 60.04 53.63 61.49 0.32 0.65 0.21 PS2−server 71
72 MULTICOM−RANK 55.98 43.95 54.40 0.07 -0.46 -0.56 56.20 48.36 57.57 -0.49 -0.42 -0.52 MULTICOM−RANK 72
73 MUFOLD−Server 55.77 49.36 53.85 0.04 0.38 -0.65 58.12 49.36 60.48 -0.08 -0.22 0.02 MUFOLD−Server 73
74 FUGUE_KM 55.56 46.58 55.80 0.01 -0.05 -0.32 55.56 46.58 55.80 -0.62 -0.78 -0.85 FUGUE_KM 74
75 fais−server 55.56 44.87 58.85 0.01 -0.31 0.20 59.62 54.27 61.48 0.23 0.78 0.20 fais−server 75
76 McGuffin 55.56 44.87 59.11 0.01 -0.31 0.24 61.97 52.99 63.59 0.73 0.52 0.59 McGuffin 76
77 MULTICOM−REFINE 55.34 49.93 52.39 -0.02 0.47 -0.90 55.34 49.93 54.09 -0.67 -0.10 -1.16 MULTICOM−REFINE 77
78 A−TASSER 55.34 46.08 54.27 -0.02 -0.13 -0.58 56.20 48.50 54.27 -0.49 -0.39 -1.13 A−TASSER 78
79 FAMSD 55.34 45.37 53.62 -0.02 -0.24 -0.69 55.34 49.07 53.73 -0.67 -0.27 -1.23 FAMSD 79
80 MULTICOM−CMFR 55.34 44.09 54.14 -0.02 -0.44 -0.60 55.34 48.29 55.47 -0.67 -0.43 -0.91 MULTICOM−CMFR 80
81 JIVE08 55.13 47.29 50.92 -0.05 0.06 -1.15 56.20 51.21 52.92 -0.49 0.16 -1.38 JIVE08 81
82 tripos_08 54.91 47.37 54.72 -0.08 0.07 -0.50 54.91 47.37 54.72 -0.76 -0.62 -1.04 tripos_08 82
83 Bilab−UT 54.49 48.79 58.70 -0.14 0.29 0.17 57.91 50.36 60.28 -0.13 -0.01 -0.02 Bilab−UT 83
84 Pcons_multi 54.49 46.80 66.05 -0.14 -0.02 1.42 54.70 50.50 66.05 -0.81 0.01 1.05 Pcons_multi 84
85 3Dpro 54.49 44.52 56.66 -0.14 -0.37 -0.17 54.49 44.52 56.66 -0.85 -1.20 -0.69 3Dpro 85
86 Poing 54.49 43.23 54.32 -0.14 -0.57 -0.57 63.03 54.49 68.15 0.95 0.82 1.43 Poing 86
87 Frankenstein 54.06 44.37 55.10 -0.20 -0.39 -0.44 61.75 54.70 64.25 0.68 0.86 0.71 Frankenstein 87
88 mGenTHREADER 53.85 46.01 50.67 -0.23 -0.14 -1.19 53.85 46.01 50.67 -0.99 -0.89 -1.79 mGenTHREADER 88
89 MUProt 52.78 48.36 54.09 -0.38 0.22 -0.61 55.56 48.50 54.09 -0.62 -0.39 -1.16 MUProt 89
90 xianmingpan 52.78 44.66 50.48 -0.38 -0.35 -1.22 52.78 44.66 50.48 -1.21 -1.17 -1.83 xianmingpan 90
91 MULTICOM−CLUSTER 52.35 48.36 53.98 -0.44 0.22 -0.63 63.46 57.91 65.40 1.04 1.51 0.93 MULTICOM−CLUSTER 91
92 Softberry 52.35 46.80 53.28 -0.44 -0.02 -0.75 52.35 46.80 53.28 -1.30 -0.73 -1.31 Softberry 92
93 keasar−server 52.35 43.80 55.15 -0.44 -0.48 -0.43 60.90 54.77 61.09 0.50 0.88 0.13 keasar−server 93
94 Pushchino 51.92 41.10 47.08 -0.50 -0.90 -1.80 51.92 41.10 47.08 -1.39 -1.89 -2.46 Pushchino 94
95 rehtnap 50.85 41.17 44.90 -0.66 -0.89 -2.17 50.85 42.24 44.90 -1.62 -1.66 -2.86 rehtnap 95
96 LOOPP_Server 50.64 42.95 44.01 -0.69 -0.61 -2.32 50.64 42.95 44.52 -1.66 -1.51 -2.93 LOOPP_Server 96
97 FOLDpro 50.43 43.59 44.16 -0.71 -0.51 -2.30 54.49 44.52 56.66 -0.85 -1.20 -0.69 FOLDpro 97
98 MUSTER 50.43 39.89 48.91 -0.71 -1.08 -1.49 61.54 53.70 66.53 0.64 0.66 1.14 MUSTER 98
99 circle 50.21 45.23 56.59 -0.75 -0.26 -0.18 55.98 49.15 56.59 -0.54 -0.26 -0.70 circle 99
100 BioSerf 48.93 36.82 52.48 -0.93 -1.56 -0.88 48.93 36.82 52.48 -2.02 -2.75 -1.46 BioSerf 100
101 AMU−Biology 48.72 42.73 53.93 -0.96 -0.65 -0.64 51.50 43.95 58.67 -1.48 -1.31 -0.32 AMU−Biology 101
102 StruPPi 48.08 34.54 50.82 -1.05 -1.91 -1.16 48.08 34.54 50.82 -2.20 -3.21 -1.76 StruPPi 102
103 ACOMPMOD 47.65 43.52 46.39 -1.11 -0.52 -1.92 47.65 43.52 53.15 -2.29 -1.40 -1.33 ACOMPMOD 103
104 DBAKER 47.22 38.96 52.89 -1.17 -1.23 -0.81 55.56 45.94 64.17 -0.62 -0.91 0.70 DBAKER 104
105 Wolfson−FOBIA 45.30 39.32 42.35 -1.44 -1.17 -2.60 45.30 39.32 42.35 -2.79 -2.25 -3.33 Wolfson−FOBIA 105
106 Pcons_dot_net 45.09 37.25 50.45 -1.47 -1.49 -1.23 58.97 48.58 58.86 0.10 -0.37 -0.28 Pcons_dot_net 106
107 Distill 43.38 39.81 52.77 -1.72 -1.10 -0.83 43.38 39.81 52.77 -3.20 -2.15 -1.40 Distill 107
108 FLOUDAS 41.88 32.91 39.01 -1.93 -2.16 -3.17 45.30 37.18 49.10 -2.79 -2.68 -2.08 FLOUDAS 108
109 Ozkan−Shell 41.03 38.32 61.76 -2.05 -1.33 0.69 59.19 48.50 64.35 0.14 -0.39 0.73 Ozkan−Shell 109
110 DelCLab 38.89 34.90 34.57 -2.36 -1.85 -3.92 47.86 44.73 44.40 -2.25 -1.15 -2.95 DelCLab 110
111 forecast 37.82 30.27 38.98 -2.51 -2.57 -3.17 47.01 37.89 46.99 -2.43 -2.54 -2.47 forecast 111
112 ProtAnG 32.69 29.13 48.22 -3.24 -2.75 -1.61 32.69 29.13 48.22 -5.45 -4.31 -2.24 ProtAnG 112
113 POEM 32.69 27.42 39.99 -3.24 -3.01 -3.00 59.62 49.50 62.70 0.23 -0.19 0.43 POEM 113
114 MUFOLD−MD 30.98 27.85 47.23 -3.48 -2.94 -1.77 35.90 29.91 47.70 -4.78 -4.15 -2.34 MUFOLD−MD 114
115 mariner1 28.42 21.51 29.77 -3.84 -3.92 -4.74 55.77 49.86 58.26 -0.58 -0.11 -0.39 mariner1 115
116 POEMQA 27.14 20.66 49.32 -4.03 -4.05 -1.42 27.14 22.86 51.21 -6.63 -5.58 -1.69 POEMQA 116
117 SHORTLE 26.28 23.57 51.57 -4.15 -3.61 -1.04 67.09 56.98 67.79 1.81 1.33 1.37 SHORTLE 117
118 RBO−Proteus 25.86 22.15 47.80 -4.21 -3.82 -1.68 26.92 23.22 50.65 -6.67 -5.51 -1.80 RBO−Proteus 118
119 DistillSN 24.57 20.30 29.65 -4.39 -4.11 -4.76 25.00 21.01 36.10 -7.08 -5.95 -4.48 DistillSN 119
120 keasar 24.14 20.01 49.21 -4.45 -4.15 -1.44 68.80 62.39 70.06 2.17 2.42 1.79 keasar 120
121 Zhou−SPARKS 23.29 18.02 42.05 -4.57 -4.46 -2.65 23.29 18.02 42.05 -7.44 -6.56 -3.38 Zhou−SPARKS 121
122 MeilerLabRene 18.59 15.60 26.60 -5.24 -4.84 -5.28 25.00 20.01 30.30 -7.08 -6.16 -5.55 MeilerLabRene 122
123 mahmood−torda−server 18.38 15.03 22.99 -5.27 -4.92 -5.89 18.38 15.17 22.99 -8.47 -7.13 -6.90 mahmood−torda−server 123
124 Scheraga 17.73 14.89 22.39 -5.36 -4.95 -5.99 20.73 16.74 28.90 -7.98 -6.82 -5.81 Scheraga 124
125 RANDOM 16.79 14.45 16.79 -5.50 -5.01 -6.94 16.79 14.45 16.79 -8.81 -7.28 -8.05 RANDOM 125
126 TWPPLAB 15.81 14.24 22.56 -5.64 -5.05 -5.96 15.81 14.24 22.56 -9.02 -7.32 -6.98 TWPPLAB 126
127 huber−torda−server 15.60 11.75 9.33 -5.67 -5.43 -8.21 16.45 13.53 17.12 -8.88 -7.47 -7.99 huber−torda−server 127
128 OLGAFS 13.68 10.68 9.22 -5.94 -5.60 -8.23 14.53 12.46 9.86 -9.29 -7.68 -9.33 OLGAFS 128
129 psiphifoldings 11.97 11.40 21.06 -6.18 -5.49 -6.22 11.97 11.40 21.06 -9.83 -7.90 -7.26 psiphifoldings 129
130 Abagyan                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 Abagyan 130
131 BHAGEERATH                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 BHAGEERATH 131
132 FEIG_REFINE                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 FEIG_REFINE 132
133 Fiser−M4T                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 Fiser−M4T 133
134 HCA                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 HCA 134
135 Handl−Lovell                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 Handl−Lovell 135
136 KudlatyPredHuman                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 KudlatyPredHuman 136
137 LEE−SERVER                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 LEE−SERVER 137
138 Linnolt−UH−CMB                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 Linnolt−UH−CMB 138
139 NIM2                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 NIM2 139
140 Nano_team                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 Nano_team 140
141 NirBenTal                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 NirBenTal 141
142 PHAISTOS                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 PHAISTOS 142
143 POISE                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 POISE 143
144 PZ−UAM                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 PZ−UAM 144
145 ProteinShop                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 ProteinShop 145
146 RPFM                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 RPFM 146
147 SAINT1                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 SAINT1 147
148 Sasaki−Cetin−Sasai                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 Sasaki−Cetin−Sasai 148
149 ShakAbInitio                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 ShakAbInitio 149
150 TsaiLab                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 TsaiLab 150
151 UCDavisGenome                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 UCDavisGenome 151
152 Wolynes                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 Wolynes 152
153 YASARA                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 YASARA 153
154 YASARARefine                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 YASARARefine 154
155 dill_ucsf                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 dill_ucsf 155
156 dill_ucsf_extended                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 dill_ucsf_extended 156
157 igor                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 igor 157
158 jacobson                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 jacobson 158
159 mti                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 mti 159
160 mumssp                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 mumssp 160
161 ricardo                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 ricardo 161
162 rivilo                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 rivilo 162
163 schenk−torda−server                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 schenk−torda−server 163
164 sessions                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 sessions 164
165 taylor                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 taylor 165
166 test_http_server_01                   -5.50 -5.01 -6.94                   -8.81 -7.28 -8.05 test_http_server_01 166