T0397

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0397

hypothetical protein MMP0046 from Pfam-B_34464 family Methanococcus maripaludis s2

Target type: Human/Server

Target sequence:

>T0397 hypothetical protein MMP0046, Methanococcus maripaludis s2, 150 residues
MKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTLKKDVLIQYPDKHTLTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE

Structure:
Method: X-ray, res=2.2Å, R/Rfree=0.19/0.24
Determined by: JCSG
PDB ID: 3d4r

3d4r_A cartoon
Cartoon diagram of 397: 3d4r chain A

PyMOL of 3d4r

Domains:  PyMOL of domains

Two domains. Residue ranges: -7-82 and 83-150. Domain boundary well-defined. PDB range matches target sequence range.

3d4r_A cartoon
Cartoon diagram of 397 domains: 3d4r chain A
N- and C-domains are colored blue and red.

397 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

N-domain: novel, has some topological similarity to ferredoxin-like domain with a curved β-sheet and α-helices deteriorated into loops. The ferredoxin-like core is elaborated with a loop and a β-strand (green) inserted into its β-hairpin and a β-strand (red) at its C-terminus.

C-domain: Barrel-sandwich hybrid fold. Contains hammerhead sequence motifs.

3d4r_A:1-82 cartoon
N-domain of 397: 3d4r chain A residues -7-82

CASP category:

Full chain: Fold recognition, if this makes sense as an average between free modeling (N-domain) and hard CM (C-domain).

1st domain: Free modeling; 2nd domain: Comparative modeling: medium.

Closest templates:

No template for N-domain, barrel-sandwich hybrid motif templates for C-domain, e.g. 1dcz.

Target sequence - PDB file inconsistencies:

Additional 8 residues at the N-terminus in the structure, but the numbering agrees with the target (thus strarting from -7).

T0397    3d4r.pdb    T0397.pdb    PyMOL    PyMOL of domains    

T0397    1 --------MKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTLKKDVLIQYPDKHTLTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE 150
           ~~~~~~~~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3d4rA   -7 HENLYFQGMKIPKIYVEGELNDGDRVAIEKDGNAIIFLEKDEEYSGNGKLLYQVIYDDLAKYMSLDTLKKDVLIQYPDKHTLTYLKAGTKLISVPAEGYKVYPIMDFGFRVLKGYRLATLESKKGDLRYVNSPVSGTVIFMNEIPSERANYVFYMLEE 150

Residue change log: change 1, 55, 97, 133, 147, MSE to MET; remove -7-HENLYFQG-0 as it is not present in target sequence;

2-domain protein, both domains used in evaluation:

1st domain: target 1-82 ; pdb 1-82

2nd domain: target 83-150 ; pdb 83-150

Sequence classification:

COG4072 in CDD.

Server predictions:

T0397:pdb 1-150:seq 1-150:FR;   alignment

distribution of first scores
First models for T0397: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

397_1:pdb 1-82:seq 1-82:FM;   alignment

distribution of first scores
First models for T0397_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

397_2:pdb 83-150:seq 83-150:CM_medium;   alignment

distribution of first scores
First models for T0397_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0397 397_1 397_2 T0397 397_1 397_2 T0397 397_1 397_2 T0397 397_1 397_2
First score First Z-score Best score Best Z-score
1 A−TASSER 36.83 32.61 39.88 23.48 22.26 32.20 68.02 61.64 60.38 1.64 1.71 1.31 0.03 0.77 0.71 1.15 1.30 1.00 38.00 32.61 40.26 23.48 22.26 33.08 74.27 69.61 66.03 1.53 1.39 1.10 -0.43 0.07 0.39 1.29 1.50 1.15 A−TASSER 1
2 Chicken_George 36.67 31.06 38.71 26.52 21.85 26.98 73.16 65.44 64.08 1.62 1.50 1.19 0.75 0.65 -0.09 1.41 1.52 1.23 36.67 31.06 42.57 26.52 24.19 35.48 73.16 65.44 64.08 1.36 1.17 1.35 0.19 0.54 0.75 1.23 1.25 1.02 Chicken_George 2
3 FAMS−multi 36.50 31.17 37.30 20.73 18.90 22.45 72.43 65.32 65.45 1.60 1.52 1.04 -0.61 -0.24 -0.78 1.37 1.51 1.32 36.50 31.17 37.42 21.34 18.90 23.25 72.43 65.32 65.67 1.34 1.19 0.79 -0.86 -0.74 -1.05 1.19 1.24 1.13 FAMS−multi 3
4 Elofsson 36.50 30.28 39.08 20.73 19.11 26.75 70.22 62.13 64.77 1.60 1.40 1.23 -0.61 -0.18 -0.12 1.26 1.33 1.28 36.50 31.33 39.08 21.34 19.71 26.75 70.22 63.60 65.14 1.34 1.21 0.97 -0.86 -0.55 -0.53 1.07 1.14 1.09 Elofsson 4
5 HHpred5 36.00 30.78 37.60 20.73 18.80 24.90 69.48 61.15 63.80 1.54 1.47 1.07 -0.61 -0.27 -0.40 1.22 1.27 1.22 36.00 30.78 37.60 20.73 18.80 24.90 69.48 61.15 63.80 1.28 1.13 0.81 -0.98 -0.77 -0.80 1.03 0.99 1.00 HHpred5 5
6 pro−sp3−TASSER 35.83 33.17 38.68 25.30 21.24 27.96 72.79 59.56 63.70 1.52 1.79 1.18 0.46 0.46 0.06 1.39 1.18 1.21 36.67 33.17 40.90 27.44 23.48 33.84 72.79 68.50 63.80 1.36 1.46 1.17 0.37 0.37 0.51 1.21 1.43 1.00 pro−sp3−TASSER 6
7 fams−ace2 35.50 33.94 38.81 25.00 21.24 28.42 71.69 69.24 63.44 1.48 1.89 1.20 0.39 0.46 0.13 1.34 1.74 1.19 35.50 33.94 41.52 33.84 29.78 35.51 71.69 69.24 63.44 1.22 1.57 1.24 1.67 1.90 0.75 1.15 1.48 0.98 fams−ace2 7
8 HHpred2 35.33 29.22 38.14 21.04 19.71 25.65 67.65 57.11 64.03 1.46 1.25 1.13 -0.54 -0.00 -0.29 1.13 1.03 1.23 35.33 29.22 38.14 21.04 19.71 25.65 67.65 57.11 64.03 1.20 0.92 0.87 -0.92 -0.55 -0.69 0.92 0.75 1.02 HHpred2 8
9 Pcons_local 34.67 31.89 36.81 19.82 15.96 22.67 69.85 63.73 65.54 1.38 1.62 0.98 -0.83 -1.13 -0.74 1.24 1.42 1.33 34.67 31.89 36.81 19.82 15.96 22.67 69.85 63.73 65.54 1.12 1.29 0.72 -1.17 -1.46 -1.13 1.05 1.15 1.12 Pcons_local 9
10 nFOLD3 34.67 29.89 35.68 21.34 19.71 21.25 68.38 57.35 63.64 1.38 1.35 0.86 -0.47 -0.00 -0.96 1.16 1.05 1.21 39.17 33.72 40.42 29.88 25.20 30.26 72.06 61.77 69.83 1.67 1.54 1.12 0.87 0.79 -0.02 1.17 1.03 1.41 nFOLD3 10
11 HHpred4 34.67 29.56 37.10 22.56 15.85 24.93 68.75 51.84 62.81 1.38 1.30 1.02 -0.18 -1.16 -0.40 1.18 0.72 1.15 34.67 29.56 37.10 22.56 15.85 24.93 68.75 51.84 62.81 1.12 0.97 0.76 -0.61 -1.48 -0.80 0.98 0.43 0.94 HHpred4 11
12 SAM−T08−human 34.00 28.89 42.24 23.78 21.04 31.54 73.53 62.26 66.69 1.30 1.21 1.56 0.11 0.40 0.61 1.43 1.33 1.40 34.50 30.56 42.24 24.09 22.05 31.54 73.53 64.83 66.87 1.09 1.10 1.32 -0.30 0.02 0.17 1.25 1.21 1.21 SAM−T08−human 12
13 3D−JIGSAW_AEP 33.83 30.39 34.01 19.21 15.75 18.34 69.85 59.56 64.30 1.28 1.41 0.69 -0.97 -1.19 -1.40 1.24 1.18 1.25 33.83 30.39 34.01 19.51 17.48 18.34 69.85 59.56 64.30 1.01 1.08 0.42 -1.23 -1.09 -1.76 1.05 0.90 1.04 3D−JIGSAW_AEP 13
14 Phragment 33.50 26.61 36.56 20.73 19.51 28.58 59.93 47.67 58.09 1.24 0.90 0.96 -0.61 -0.06 0.16 0.73 0.48 0.85 33.50 26.61 38.35 23.78 20.32 30.84 60.66 48.90 60.35 0.97 0.56 0.89 -0.37 -0.40 0.07 0.54 0.26 0.77 Phragment 14
15 GeneSilico 33.00 29.67 44.98 26.83 26.22 38.38 68.02 60.66 65.00 1.18 1.32 1.86 0.82 1.96 1.65 1.15 1.24 1.29 35.50 31.83 44.98 30.18 28.96 38.38 68.02 63.23 65.18 1.22 1.28 1.62 0.93 1.70 1.17 0.94 1.12 1.10 GeneSilico 15
16 Zhang−Server 33.00 29.11 40.04 28.96 19.82 30.90 68.38 59.31 63.38 1.18 1.24 1.33 1.33 0.03 0.51 1.16 1.16 1.19 33.67 31.00 45.13 29.57 22.46 36.66 69.48 63.11 67.54 0.99 1.16 1.63 0.81 0.12 0.92 1.03 1.11 1.26 Zhang−Server 16
17 McGuffin 33.00 29.11 40.04 28.96 19.82 30.90 68.38 59.31 63.38 1.18 1.24 1.33 1.33 0.03 0.51 1.16 1.16 1.19 35.50 30.50 40.04 28.96 19.82 30.90 68.38 59.31 63.38 1.22 1.10 1.08 0.68 -0.52 0.08 0.96 0.88 0.97 McGuffin 17
18 3DShot1 33.00 28.28 30.52 17.99 13.72 20.67 64.71 54.66 54.79 1.18 1.13 0.31 -1.26 -1.81 -1.05 0.97 0.89 0.64 33.00 28.28 30.52 17.99 13.72 20.67 64.71 54.66 54.79 0.91 0.79 0.04 -1.54 -2.00 -1.42 0.76 0.60 0.39 3DShot1 18
19 Hao_Kihara 33.00 27.50 34.56 20.12 18.80 21.66 66.91 59.80 61.95 1.18 1.02 0.74 -0.76 -0.27 -0.90 1.09 1.19 1.10 33.00 27.50 34.56 22.56 21.14 30.21 66.91 59.80 61.95 0.91 0.68 0.48 -0.61 -0.20 -0.03 0.88 0.91 0.88 Hao_Kihara 19
20 AMU−Biology 32.67 26.89 39.01 24.09 22.46 29.30 66.91 54.17 62.90 1.14 0.94 1.22 0.18 0.83 0.27 1.09 0.86 1.16 35.17 30.72 41.51 27.13 25.41 34.02 66.91 54.41 62.90 1.18 1.13 1.24 0.31 0.84 0.53 0.88 0.59 0.94 AMU−Biology 20
21 SAMUDRALA 32.50 30.61 41.08 20.73 17.89 30.80 70.22 66.05 65.23 1.12 1.44 1.44 -0.61 -0.55 0.50 1.26 1.56 1.31 32.67 30.61 41.78 27.44 25.41 31.41 70.22 66.05 66.89 0.87 1.11 1.27 0.37 0.84 0.15 1.07 1.29 1.21 SAMUDRALA 21
22 fais@hgc 32.50 29.06 43.17 29.57 22.46 36.66 68.75 61.15 63.50 1.12 1.23 1.66 1.47 0.83 1.39 1.18 1.27 1.20 35.83 33.17 43.17 29.57 22.46 36.66 72.79 61.15 63.70 1.26 1.46 1.42 0.81 0.12 0.92 1.21 0.99 1.00 fais@hgc 22
23 LEE 32.33 29.11 35.42 21.04 19.41 21.06 69.85 62.74 64.18 1.10 1.24 0.84 -0.54 -0.09 -0.99 1.24 1.36 1.24 32.67 30.22 35.42 23.48 21.04 34.34 70.22 64.46 64.75 0.87 1.06 0.57 -0.43 -0.22 0.58 1.07 1.19 1.07 LEE 23
24 Jones−UCL 32.17 28.94 40.06 23.48 21.85 30.30 70.59 63.48 64.08 1.08 1.22 1.33 0.03 0.65 0.42 1.28 1.41 1.23 36.33 29.39 44.20 27.13 21.95 39.19 70.59 64.95 64.08 1.32 0.94 1.53 0.31 -0.00 1.29 1.09 1.22 1.02 Jones−UCL 24
25 Frankenstein 31.83 28.28 22.70 10.98 9.15 -4.18 69.48 61.64 65.54 1.04 1.13 -0.52 -2.92 -3.19 -4.84 1.22 1.30 1.33 31.83 29.00 23.60 12.80 10.98 -2.01 69.48 63.23 66.92 0.76 0.89 -0.72 -2.59 -2.67 -4.75 1.03 1.12 1.21 Frankenstein 25
26 TASSER 31.67 29.33 40.78 28.96 24.70 32.63 68.38 63.23 63.08 1.02 1.27 1.41 1.33 1.51 0.78 1.16 1.39 1.17 32.00 30.22 40.94 28.96 25.51 33.08 68.38 64.46 66.03 0.79 1.06 1.17 0.68 0.86 0.39 0.96 1.19 1.15 TASSER 26
27 IBT_LT 31.33 29.56 19.00 3.66 3.66 -9.34 68.75 64.83 63.50 0.98 1.30 -0.92 -4.64 -4.84 -5.63 1.18 1.49 1.20 31.33 29.56 19.00 3.66 3.66 -9.34 68.75 64.83 63.50 0.70 0.97 -1.22 -4.44 -4.44 -5.82 0.98 1.21 0.98 IBT_LT 27
28 Pcons_multi 31.17 25.17 34.95 18.90 16.06 20.09 65.07 52.08 64.23 0.96 0.70 0.79 -1.05 -1.10 -1.14 0.99 0.74 1.24 31.17 25.61 34.95 20.73 18.50 21.60 65.07 52.08 64.23 0.68 0.42 0.52 -0.98 -0.84 -1.29 0.78 0.45 1.03 Pcons_multi 28
29 EB_AMU_Physics 31.00 26.89 34.71 19.82 15.35 20.13 66.54 57.48 64.40 0.94 0.94 0.76 -0.83 -1.32 -1.13 1.07 1.05 1.25 31.00 26.89 34.71 19.82 15.35 20.13 66.54 57.48 64.40 0.66 0.60 0.49 -1.17 -1.61 -1.50 0.86 0.77 1.04 EB_AMU_Physics 29
30 RAPTOR 31.00 25.78 36.52 25.30 21.85 29.41 63.23 46.81 56.98 0.94 0.79 0.95 0.46 0.65 0.28 0.90 0.43 0.78 31.00 26.00 38.26 25.30 21.85 31.55 64.34 57.72 61.79 0.66 0.48 0.88 -0.06 -0.03 0.17 0.74 0.79 0.87 RAPTOR 30
31 Poing 30.83 27.39 34.08 25.30 20.73 28.89 56.25 46.94 53.81 0.92 1.01 0.69 0.46 0.31 0.21 0.53 0.44 0.58 30.83 27.67 38.78 26.52 24.09 37.27 56.25 46.94 54.75 0.64 0.71 0.94 0.19 0.52 1.01 0.29 0.14 0.39 Poing 31
32 Pcons_dot_net 30.83 22.72 36.15 22.56 18.80 25.88 61.03 47.67 60.20 0.92 0.37 0.91 -0.18 -0.27 -0.25 0.78 0.48 0.99 35.50 30.50 36.75 29.57 23.88 32.47 64.34 56.01 60.20 1.22 1.10 0.72 0.81 0.47 0.31 0.74 0.68 0.76 Pcons_dot_net 32
33 DBAKER 30.67 25.89 46.40 26.52 23.17 43.22 65.81 55.27 63.23 0.90 0.80 2.01 0.75 1.04 2.39 1.03 0.92 1.18 30.67 26.67 46.40 30.79 26.93 43.22 65.81 57.35 63.38 0.62 0.57 1.77 1.05 1.21 1.88 0.82 0.76 0.97 DBAKER 33
34 CpHModels 30.50 27.50 17.87 0.00 0.00 -9.70 66.54 59.93 61.73 0.88 1.02 -1.04 -5.51 -5.95 -5.68 1.07 1.20 1.08 30.50 27.50 17.87 0.00 0.00 -9.70 66.54 59.93 61.73 0.60 0.68 -1.34 -5.18 -5.33 -5.87 0.86 0.92 0.86 CpHModels 34
35 BAKER−ROBETTA 30.50 26.72 36.75 29.57 23.88 32.47 64.34 56.01 55.22 0.88 0.91 0.98 1.47 1.26 0.75 0.95 0.97 0.67 35.50 30.50 36.75 29.57 23.88 32.47 64.34 56.01 60.20 1.22 1.10 0.72 0.81 0.47 0.31 0.74 0.68 0.76 BAKER−ROBETTA 35
36 SAM−T08−server 30.33 27.11 37.60 23.17 19.51 30.43 66.18 58.33 58.87 0.86 0.97 1.07 -0.04 -0.06 0.44 1.05 1.10 0.90 30.33 27.44 37.60 23.17 19.82 30.79 66.18 59.44 58.87 0.58 0.67 0.81 -0.49 -0.52 0.06 0.84 0.89 0.67 SAM−T08−server 36
37 Zhang 30.33 26.78 45.51 25.61 18.50 39.49 62.50 54.90 65.24 0.86 0.92 1.91 0.54 -0.37 1.82 0.86 0.90 1.31 31.33 26.78 45.51 29.57 24.39 40.46 62.87 54.90 65.24 0.70 0.58 1.67 0.81 0.59 1.48 0.66 0.62 1.10 Zhang 37
38 Zico 30.17 26.50 36.66 28.96 23.07 32.31 63.97 56.62 55.24 0.84 0.88 0.97 1.33 1.01 0.73 0.93 1.00 0.67 35.67 33.67 38.98 34.45 27.34 35.91 72.79 70.83 64.42 1.24 1.53 0.96 1.79 1.31 0.81 1.21 1.57 1.04 Zico 38
39 ZicoFullSTP 30.17 26.50 36.66 28.96 23.07 32.31 63.97 56.62 55.24 0.84 0.88 0.97 1.33 1.01 0.73 0.93 1.00 0.67 35.67 33.67 38.98 34.45 27.34 35.91 72.79 70.83 64.42 1.24 1.53 0.96 1.79 1.31 0.81 1.21 1.57 1.04 ZicoFullSTP 39
40 ZicoFullSTPFullData 30.17 26.50 36.66 28.96 23.07 32.31 63.97 56.62 55.24 0.84 0.88 0.97 1.33 1.01 0.73 0.93 1.00 0.67 35.67 33.67 38.98 34.76 29.47 35.91 72.79 70.83 64.42 1.24 1.53 0.96 1.86 1.82 0.81 1.21 1.57 1.04 ZicoFullSTPFullData 40
41 FFASsuboptimal 29.83 26.17 15.18 0.00 0.00 -9.70 65.81 57.72 57.42 0.80 0.84 -1.32 -5.51 -5.95 -5.68 1.03 1.07 0.81 29.83 26.17 15.18 0.00 0.00 -9.70 65.81 57.72 57.42 0.52 0.50 -1.64 -5.18 -5.33 -5.87 0.82 0.79 0.57 FFASsuboptimal 41
42 LevittGroup 29.83 25.94 37.71 29.27 23.48 33.35 64.34 56.49 56.20 0.80 0.81 1.08 1.40 1.14 0.89 0.95 1.00 0.73 35.50 29.28 38.68 29.27 23.48 33.35 72.43 63.11 64.10 1.22 0.93 0.93 0.74 0.37 0.43 1.19 1.11 1.02 LevittGroup 42
43 METATASSER 29.50 25.78 41.06 33.54 27.85 35.43 61.03 52.94 60.62 0.76 0.79 1.44 2.41 2.46 1.20 0.78 0.79 1.01 32.83 29.56 45.35 33.54 27.85 42.74 68.38 61.03 61.66 0.89 0.97 1.66 1.61 1.43 1.81 0.96 0.99 0.86 METATASSER 43
44 MidwayFolding 29.50 22.06 36.58 26.52 21.14 30.65 63.23 46.32 56.98 0.76 0.28 0.96 0.75 0.43 0.47 0.90 0.40 0.78 29.50 22.06 36.58 26.52 21.14 30.65 63.23 46.32 56.98 0.48 -0.07 0.70 0.19 -0.20 0.04 0.68 0.10 0.54 MidwayFolding 44
45 MUSTER 29.17 24.72 33.89 18.29 14.43 24.00 63.97 58.09 58.40 0.72 0.64 0.67 -1.19 -1.59 -0.54 0.93 1.09 0.87 29.17 24.72 33.89 27.13 24.19 29.19 63.97 58.09 58.40 0.44 0.30 0.41 0.31 0.54 -0.18 0.72 0.81 0.64 MUSTER 45
46 Sternberg 27.83 24.72 37.94 25.00 21.34 38.05 57.35 51.47 52.12 0.56 0.64 1.11 0.39 0.49 1.60 0.59 0.70 0.47 27.83 24.72 40.37 30.18 26.83 42.58 57.35 52.45 52.17 0.27 0.30 1.11 0.93 1.18 1.79 0.35 0.47 0.21 Sternberg 46
47 3DShotMQ 27.83 22.61 34.83 30.79 21.44 26.43 59.93 48.41 57.84 0.56 0.36 0.77 1.76 0.52 -0.17 0.73 0.52 0.84 27.83 22.61 34.83 30.79 21.44 26.43 59.93 48.41 57.84 0.27 0.01 0.51 1.05 -0.13 -0.58 0.50 0.23 0.60 3DShotMQ 47
48 Phyre_de_novo 27.67 24.78 37.14 23.78 19.51 32.21 60.66 54.29 56.75 0.54 0.65 1.02 0.11 -0.06 0.71 0.76 0.87 0.77 28.17 24.89 39.51 28.05 25.51 34.60 61.77 54.41 61.42 0.31 0.32 1.02 0.50 0.86 0.62 0.60 0.59 0.84 Phyre_de_novo 48
49 COMA−M 27.50 23.17 30.88 20.73 18.90 24.17 59.56 50.00 52.29 0.52 0.43 0.35 -0.61 -0.24 -0.51 0.71 0.61 0.48 28.83 26.39 33.04 21.04 19.00 25.87 62.13 56.37 55.66 0.39 0.53 0.31 -0.92 -0.72 -0.66 0.62 0.71 0.45 COMA−M 49
50 Phyre2 27.50 22.83 35.52 25.61 20.02 29.68 58.46 48.16 55.53 0.52 0.39 0.85 0.54 0.09 0.33 0.65 0.51 0.69 30.33 27.83 35.52 25.61 20.02 29.68 60.29 55.39 58.19 0.58 0.73 0.58 0.00 -0.47 -0.10 0.52 0.65 0.62 Phyre2 50
51 GS−KudlatyPred 27.17 23.50 17.78 10.98 9.35 -5.72 59.19 50.37 57.85 0.48 0.48 -1.05 -2.92 -3.13 -5.07 0.69 0.64 0.84 27.17 23.50 17.78 10.98 9.35 -5.72 59.19 50.37 57.85 0.19 0.13 -1.35 -2.96 -3.06 -5.29 0.46 0.34 0.60 GS−KudlatyPred 51
52 GS−MetaServer2 27.00 22.67 16.79 8.23 6.20 -6.96 58.82 51.23 57.09 0.46 0.37 -1.15 -3.56 -4.08 -5.26 0.67 0.69 0.79 33.50 30.50 34.07 18.29 15.65 18.65 69.12 62.50 64.36 0.97 1.10 0.43 -1.48 -1.53 -1.72 1.01 1.07 1.04 GS−MetaServer2 52
53 GeneSilicoMetaServer 27.00 22.67 16.79 8.23 6.20 -6.96 58.82 51.23 57.09 0.46 0.37 -1.15 -3.56 -4.08 -5.26 0.67 0.69 0.79 33.50 30.50 34.07 18.29 15.65 18.65 69.12 62.50 64.36 0.97 1.10 0.43 -1.48 -1.53 -1.72 1.01 1.07 1.04 GeneSilicoMetaServer 53
54 StruPPi 26.67 23.67 31.15 16.77 14.53 19.32 57.72 51.10 58.04 0.42 0.50 0.38 -1.55 -1.56 -1.25 0.61 0.68 0.85 26.67 23.67 31.15 16.77 14.53 19.32 57.72 51.10 58.04 0.13 0.16 0.11 -1.79 -1.80 -1.62 0.37 0.39 0.61 StruPPi 54
55 fleil 26.33 22.44 31.67 20.12 17.48 22.05 58.09 49.51 56.40 0.38 0.33 0.44 -0.76 -0.67 -0.84 0.63 0.59 0.74 29.00 26.56 35.10 20.73 18.90 22.49 62.87 57.48 62.38 0.42 0.55 0.54 -0.98 -0.74 -1.16 0.66 0.77 0.91 fleil 55
56 FFASflextemplate 25.67 22.67 9.63 0.00 0.00 -9.70 55.88 49.27 45.99 0.31 0.37 -1.92 -5.51 -5.95 -5.68 0.51 0.57 0.08 25.83 23.06 9.63 0.00 0.00 -9.70 56.25 50.12 45.99 0.02 0.07 -2.24 -5.18 -5.33 -5.87 0.29 0.33 -0.20 FFASflextemplate 56
57 taylor 25.67 21.56 23.96 19.21 14.53 18.98 56.98 47.92 44.54 0.31 0.21 -0.39 -0.97 -1.56 -1.31 0.57 0.49 -0.01 25.67 21.56 23.96 19.21 16.46 20.86 56.98 47.92 44.54 0.00 -0.13 -0.68 -1.29 -1.34 -1.40 0.33 0.20 -0.30 taylor 57
58 FFASstandard 25.33 23.11 9.84 0.00 0.00 -9.70 55.15 50.24 46.36 0.26 0.42 -1.89 -5.51 -5.95 -5.68 0.48 0.63 0.10 26.33 24.44 11.64 5.49 4.67 -8.77 57.35 53.19 49.09 0.09 0.26 -2.02 -4.07 -4.20 -5.74 0.35 0.51 0.01 FFASstandard 58
59 SAM−T02−server 24.00 21.89 6.67 0.00 0.00 -9.70 52.94 48.28 40.91 0.11 0.26 -2.23 -5.51 -5.95 -5.68 0.36 0.51 -0.24 24.00 21.89 7.03 0.00 0.00 -9.70 52.94 48.28 41.25 -0.20 -0.09 -2.53 -5.18 -5.33 -5.87 0.11 0.22 -0.52 SAM−T02−server 59
60 SMEG−CCP 23.83 17.61 36.97 23.17 20.12 33.68 50.73 37.50 54.67 0.09 -0.32 1.00 -0.04 0.12 0.94 0.25 -0.12 0.63 23.83 17.61 36.97 23.17 20.12 33.68 50.73 37.50 54.67 -0.22 -0.68 0.74 -0.49 -0.45 0.48 -0.01 -0.43 0.38 SMEG−CCP 60
61 3DShot2 21.00 17.22 18.20 18.90 15.55 18.65 45.96 37.62 33.39 -0.25 -0.37 -1.00 -1.05 -1.26 -1.36 -0.00 -0.11 -0.72 21.00 17.22 18.20 18.90 15.55 18.65 45.96 37.62 33.39 -0.57 -0.73 -1.31 -1.36 -1.56 -1.72 -0.28 -0.42 -1.06 3DShot2 61
62 Kolinski 20.83 15.61 28.25 26.22 22.15 32.18 42.65 31.13 39.02 -0.27 -0.59 0.07 0.68 0.74 0.71 -0.17 -0.49 -0.36 24.83 20.61 28.25 26.22 22.15 32.18 52.94 43.63 46.24 -0.10 -0.27 -0.21 0.13 0.05 0.26 0.11 -0.06 -0.19 Kolinski 62
63 MUFOLD−MD 19.83 18.61 26.44 33.54 31.10 36.68 26.10 24.39 31.17 -0.39 -0.19 -0.12 2.41 3.44 1.39 -1.03 -0.89 -0.86 19.83 18.61 26.44 33.54 31.10 36.68 34.19 27.82 33.25 -0.72 -0.54 -0.41 1.61 2.22 0.92 -0.93 -1.01 -1.07 MUFOLD−MD 63
64 Sasaki−Cetin−Sasai 19.67 17.50 34.47 25.00 23.48 39.20 37.13 32.48 43.79 -0.41 -0.34 0.74 0.39 1.14 1.78 -0.46 -0.41 -0.06 19.67 17.50 34.47 26.52 23.48 39.20 43.02 32.48 45.86 -0.74 -0.69 0.47 0.19 0.37 1.29 -0.44 -0.73 -0.21 Sasaki−Cetin−Sasai 64
65 MULTICOM 19.67 17.22 29.05 33.84 27.74 35.79 27.94 25.49 37.14 -0.41 -0.37 0.16 2.48 2.42 1.26 -0.94 -0.82 -0.48 19.67 17.22 29.05 34.45 29.98 35.79 29.41 26.47 37.17 -0.74 -0.73 -0.12 1.79 1.95 0.79 -1.19 -1.09 -0.80 MULTICOM 65
66 POEMQA 19.50 17.28 29.30 33.54 26.83 36.30 29.04 25.98 37.11 -0.43 -0.37 0.18 2.41 2.15 1.34 -0.88 -0.79 -0.49 32.17 28.06 35.38 33.54 27.03 36.30 61.03 49.76 58.44 0.81 0.76 0.57 1.61 1.23 0.87 0.56 0.31 0.64 POEMQA 66
67 POEM 19.50 17.28 29.30 33.54 26.83 36.30 29.04 25.98 37.11 -0.43 -0.37 0.18 2.41 2.15 1.34 -0.88 -0.79 -0.49 32.17 28.06 35.38 33.54 27.03 36.30 61.03 49.76 58.44 0.81 0.76 0.57 1.61 1.23 0.87 0.56 0.31 0.64 POEM 67
68 Bates_BMM 19.50 16.94 29.07 34.15 27.03 35.76 28.68 25.61 37.20 -0.43 -0.41 0.16 2.55 2.21 1.25 -0.90 -0.82 -0.48 19.67 17.11 29.07 34.45 27.54 35.76 28.68 25.61 37.26 -0.74 -0.75 -0.12 1.79 1.35 0.79 -1.23 -1.14 -0.79 Bates_BMM 68
69 SHORTLE 19.50 16.72 27.43 28.96 23.37 33.37 29.78 27.57 36.55 -0.43 -0.44 -0.02 1.33 1.10 0.89 -0.84 -0.70 -0.52 19.50 16.72 27.43 28.96 23.37 33.37 29.78 27.57 36.55 -0.76 -0.80 -0.30 0.68 0.34 0.44 -1.17 -1.03 -0.84 SHORTLE 69
70 SAINT1 19.17 18.11 31.71 29.27 24.59 40.80 38.97 32.11 36.42 -0.47 -0.25 0.44 1.40 1.47 2.02 -0.36 -0.43 -0.53 19.17 18.11 31.71 29.27 24.59 40.80 38.97 32.11 36.42 -0.80 -0.61 0.17 0.74 0.64 1.53 -0.66 -0.75 -0.85 SAINT1 70
71 MUProt 18.50 15.72 26.95 21.95 20.02 31.42 35.29 24.63 37.24 -0.55 -0.58 -0.07 -0.33 0.09 0.59 -0.55 -0.87 -0.48 27.50 24.06 33.02 29.27 23.58 33.47 55.88 48.28 50.83 0.23 0.21 0.31 0.74 0.39 0.45 0.27 0.22 0.12 MUProt 71
72 Handl−Lovell 18.50 15.39 32.24 29.88 23.78 38.11 33.09 29.41 40.98 -0.55 -0.62 0.50 1.54 1.23 1.61 -0.67 -0.59 -0.24 19.33 17.61 32.24 30.79 25.71 40.58 34.56 30.76 41.81 -0.78 -0.68 0.23 1.05 0.91 1.49 -0.91 -0.83 -0.49 Handl−Lovell 72
73 mufold 18.50 14.28 24.13 31.40 25.91 37.20 25.73 22.67 26.31 -0.55 -0.77 -0.37 1.90 1.87 1.47 -1.05 -0.99 -1.17 18.50 14.28 24.13 31.40 25.91 37.20 29.04 26.59 30.08 -0.88 -1.14 -0.66 1.18 0.96 1.00 -1.21 -1.08 -1.28 mufold 73
74 keasar−server 18.00 14.56 24.46 31.40 23.88 38.21 25.37 23.41 25.91 -0.61 -0.74 -0.33 1.90 1.26 1.63 -1.07 -0.95 -1.20 19.00 15.56 24.46 32.01 26.52 38.21 26.10 24.02 26.82 -0.82 -0.96 -0.62 1.30 1.11 1.15 -1.38 -1.24 -1.50 keasar−server 74
75 FALCON 17.50 14.44 27.28 26.83 25.20 39.72 25.37 22.67 29.32 -0.67 -0.75 -0.03 0.82 1.66 1.86 -1.07 -0.99 -0.98 20.33 18.44 27.28 32.32 30.29 39.72 26.84 24.14 35.58 -0.66 -0.56 -0.32 1.36 2.02 1.37 -1.33 -1.23 -0.91 FALCON 75
76 Zhou−SPARKS 16.17 14.94 27.38 23.78 21.85 38.61 26.84 24.14 30.95 -0.83 -0.68 -0.02 0.11 0.65 1.69 -0.99 -0.90 -0.88 16.17 14.94 27.38 23.78 21.85 38.61 26.84 24.14 30.95 -1.17 -1.05 -0.30 -0.37 -0.03 1.20 -1.33 -1.23 -1.22 Zhou−SPARKS 76
77 mGenTHREADER 16.17 13.50 20.03 29.88 25.00 34.05 25.00 19.85 21.50 -0.83 -0.88 -0.81 1.54 1.60 0.99 -1.09 -1.15 -1.48 16.17 13.50 20.03 29.88 25.00 34.05 25.00 19.85 21.50 -1.17 -1.24 -1.11 0.87 0.74 0.54 -1.44 -1.49 -1.86 mGenTHREADER 77
78 MULTICOM−RANK 16.17 13.28 22.21 19.82 14.43 30.23 27.57 21.57 29.01 -0.83 -0.91 -0.57 -0.83 -1.59 0.41 -0.96 -1.05 -1.00 27.83 26.28 39.01 21.65 19.11 32.83 62.13 57.23 59.82 0.27 0.51 0.96 -0.80 -0.69 0.36 0.62 0.76 0.73 MULTICOM−RANK 78
79 RBO−Proteus 15.50 14.33 22.17 25.61 21.14 32.31 26.10 23.41 27.45 -0.91 -0.77 -0.58 0.54 0.43 0.73 -1.03 -0.95 -1.10 19.67 16.78 29.21 35.06 30.39 36.15 28.68 26.23 37.42 -0.74 -0.79 -0.11 1.92 2.05 0.84 -1.23 -1.11 -0.78 RBO−Proteus 79
80 BioSerf 15.33 14.94 19.53 24.39 22.66 27.07 25.00 19.85 26.14 -0.93 -0.68 -0.86 0.25 0.89 -0.07 -1.09 -1.15 -1.18 15.33 14.94 19.53 24.39 22.66 27.07 25.00 19.85 26.14 -1.27 -1.05 -1.16 -0.24 0.17 -0.49 -1.44 -1.49 -1.55 BioSerf 80
81 LEE−SERVER 15.00 13.83 22.73 24.70 22.46 32.72 25.37 22.30 27.26 -0.97 -0.83 -0.52 0.32 0.83 0.79 -1.07 -1.01 -1.11 15.83 14.00 23.35 24.70 22.66 33.32 25.73 23.28 28.08 -1.21 -1.18 -0.74 -0.18 0.17 0.43 -1.40 -1.28 -1.42 LEE−SERVER 81
82 keasar 15.00 12.22 21.84 25.61 20.53 31.70 26.10 22.67 27.18 -0.97 -1.05 -0.61 0.54 0.25 0.63 -1.03 -0.99 -1.12 31.00 27.11 40.19 35.98 29.88 34.22 64.34 55.76 63.20 0.66 0.63 1.09 2.10 1.92 0.56 0.74 0.67 0.96 keasar 82
83 FEIG 15.00 12.00 23.82 21.95 19.11 34.26 23.53 19.61 28.30 -0.97 -1.08 -0.40 -0.33 -0.18 1.02 -1.17 -1.17 -1.05 26.17 24.78 38.50 32.93 26.83 41.36 56.25 52.57 49.81 0.07 0.31 0.91 1.49 1.18 1.61 0.29 0.48 0.06 FEIG 83
84 FAMSD 15.00 11.67 17.78 20.43 17.28 24.02 27.21 25.00 27.35 -0.97 -1.13 -1.05 -0.69 -0.73 -0.54 -0.97 -0.85 -1.11 36.67 33.00 38.77 23.78 21.75 27.46 72.79 65.93 67.13 1.36 1.44 0.94 -0.37 -0.05 -0.43 1.21 1.28 1.23 FAMSD 84
85 FALCON_CONSENSUS 14.83 13.83 26.28 21.04 20.22 31.77 27.21 24.75 35.58 -0.99 -0.83 -0.14 -0.54 0.15 0.64 -0.97 -0.87 -0.58 20.33 18.44 26.36 32.32 30.29 37.62 27.21 24.75 35.58 -0.66 -0.56 -0.42 1.36 2.02 1.06 -1.31 -1.19 -0.91 FALCON_CONSENSUS 85
86 MULTICOM−CMFR 14.50 12.72 16.79 22.56 19.71 25.35 22.06 17.89 24.12 -1.03 -0.99 -1.15 -0.18 -0.00 -0.33 -1.24 -1.27 -1.31 14.50 13.33 22.02 22.87 20.43 31.26 29.41 22.43 31.48 -1.38 -1.27 -0.89 -0.55 -0.37 0.13 -1.19 -1.33 -1.19 MULTICOM−CMFR 86
87 DistillSN 14.50 11.83 16.62 25.61 20.73 21.53 21.69 17.52 27.29 -1.03 -1.11 -1.17 0.54 0.31 -0.92 -1.26 -1.29 -1.11 15.17 13.39 20.45 27.13 22.87 26.84 30.88 24.51 30.29 -1.29 -1.26 -1.06 0.31 0.22 -0.52 -1.11 -1.21 -1.27 DistillSN 87
88 circle 14.17 12.00 21.37 20.43 19.00 23.73 25.00 20.71 34.62 -1.07 -1.08 -0.66 -0.69 -0.21 -0.58 -1.09 -1.10 -0.64 18.33 13.89 23.64 31.10 24.59 36.12 27.21 25.00 34.62 -0.90 -1.19 -0.71 1.12 0.64 0.84 -1.31 -1.18 -0.97 circle 88
89 FLOUDAS 14.17 11.94 24.04 21.34 18.29 29.78 28.68 24.75 33.66 -1.07 -1.09 -0.38 -0.47 -0.43 0.34 -0.90 -0.87 -0.70 15.83 13.61 24.04 22.26 20.32 29.78 31.62 27.70 34.99 -1.21 -1.23 -0.67 -0.67 -0.40 -0.09 -1.07 -1.02 -0.95 FLOUDAS 89
90 ACOMPMOD 14.17 11.28 14.07 19.51 15.35 18.27 26.10 18.75 25.96 -1.07 -1.18 -1.44 -0.90 -1.32 -1.41 -1.03 -1.22 -1.20 16.67 15.11 18.97 19.51 16.57 21.14 36.40 33.33 36.12 -1.11 -1.02 -1.22 -1.23 -1.31 -1.35 -0.81 -0.68 -0.87 ACOMPMOD 90
91 forecast 14.00 11.78 14.62 25.30 19.71 20.51 22.43 19.00 24.66 -1.09 -1.11 -1.38 0.46 -0.00 -1.07 -1.22 -1.20 -1.28 14.33 11.78 21.30 25.30 21.85 32.07 26.84 23.41 30.90 -1.40 -1.48 -0.97 -0.06 -0.03 0.25 -1.33 -1.28 -1.23 forecast 91
92 huber−torda−server 14.00 11.67 21.35 21.34 17.48 22.66 25.73 20.59 34.97 -1.09 -1.13 -0.66 -0.47 -0.67 -0.74 -1.05 -1.11 -0.62 17.17 13.83 21.35 30.18 24.09 22.66 29.78 24.88 36.14 -1.05 -1.20 -0.96 0.93 0.52 -1.13 -1.17 -1.19 -0.87 huber−torda−server 92
93 MUFOLD−Server 14.00 11.33 22.77 22.87 19.21 36.19 23.53 19.00 24.27 -1.09 -1.17 -0.51 -0.11 -0.15 1.32 -1.17 -1.20 -1.30 15.33 12.39 23.19 22.87 19.21 36.69 29.41 26.72 32.68 -1.27 -1.40 -0.76 -0.55 -0.67 0.92 -1.19 -1.08 -1.10 MUFOLD−Server 93
94 TWPPLAB 13.83 11.28 15.31 17.99 15.35 17.26 28.68 25.49 29.06 -1.11 -1.18 -1.31 -1.26 -1.32 -1.57 -0.90 -0.82 -1.00 13.83 11.28 15.31 17.99 15.35 17.26 28.68 25.49 29.06 -1.46 -1.55 -1.62 -1.54 -1.61 -1.92 -1.23 -1.15 -1.35 TWPPLAB 94
95 xianmingpan 13.67 12.78 18.43 24.09 20.22 29.67 24.27 22.30 22.79 -1.13 -0.98 -0.98 0.18 0.15 0.32 -1.13 -1.01 -1.40 13.67 12.78 21.86 24.09 20.63 30.32 24.27 22.30 28.95 -1.48 -1.34 -0.91 -0.30 -0.32 -0.01 -1.48 -1.34 -1.36 xianmingpan 95
96 MULTICOM−CLUSTER 13.67 11.83 23.00 22.26 19.11 30.39 29.78 26.84 29.95 -1.13 -1.11 -0.49 -0.25 -0.18 0.43 -0.84 -0.74 -0.94 27.00 22.94 32.64 33.54 30.49 41.28 55.52 47.18 50.66 0.17 0.06 0.27 1.61 2.07 1.60 0.25 0.15 0.11 MULTICOM−CLUSTER 96
97 MULTICOM−REFINE 13.67 11.61 23.05 22.87 20.12 30.47 29.41 26.96 30.04 -1.13 -1.14 -0.48 -0.11 0.12 0.45 -0.86 -0.74 -0.94 27.17 23.72 33.09 29.27 23.58 33.47 55.88 44.61 50.94 0.19 0.16 0.32 0.74 0.39 0.45 0.27 -0.00 0.13 MULTICOM−REFINE 97
98 Wolynes 13.50 11.83 29.31 23.78 20.83 33.84 26.84 21.45 39.08 -1.15 -1.11 0.18 0.11 0.34 0.96 -0.99 -1.06 -0.36 18.33 17.22 33.45 30.79 28.66 43.83 32.72 27.57 39.08 -0.90 -0.73 0.36 1.05 1.63 1.97 -1.01 -1.03 -0.67 Wolynes 98
99 RANDOM 13.21 10.75 13.21 19.60 16.84 19.60 24.48 20.53 24.48 -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29 13.21 10.75 13.21 19.60 16.84 19.60 24.48 20.53 24.48 -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 RANDOM 99
100 PSI 13.17 12.39 23.71 23.78 21.34 30.32 26.10 24.51 32.37 -1.19 -1.03 -0.41 0.11 0.49 0.42 -1.03 -0.88 -0.79 16.33 13.67 25.29 25.61 21.34 32.73 27.94 24.63 33.55 -1.15 -1.22 -0.53 0.00 -0.15 0.34 -1.27 -1.20 -1.05 PSI 100
101 JIVE08 13.17 12.17 15.26 17.07 16.67 20.75 29.04 26.84 25.79 -1.19 -1.06 -1.31 -1.48 -0.92 -1.04 -0.88 -0.74 -1.21 14.17 12.94 15.84 22.56 19.92 23.51 29.78 27.08 25.79 -1.42 -1.32 -1.56 -0.61 -0.50 -1.01 -1.17 -1.05 -1.57 JIVE08 101
102 igor 13.17 11.56 13.59 21.95 19.82 22.94 21.32 17.28 20.31 -1.19 -1.14 -1.49 -0.33 0.03 -0.70 -1.28 -1.31 -1.56 13.17 11.56 13.59 21.95 19.82 22.94 21.32 17.28 20.31 -1.54 -1.51 -1.81 -0.74 -0.52 -1.09 -1.64 -1.64 -1.94 igor 102
103 PRI−Yang−KiharA 13.17 11.44 16.01 22.56 19.92 21.69 28.68 23.77 26.39 -1.19 -1.16 -1.23 -0.18 0.06 -0.89 -0.90 -0.92 -1.17 13.17 11.44 16.01 22.56 19.92 21.69 28.68 23.77 26.39 -1.54 -1.53 -1.55 -0.61 -0.50 -1.27 -1.23 -1.25 -1.53 PRI−Yang−KiharA 103
104 PS2−server 13.17 10.83 20.02 18.60 15.55 19.78 26.10 22.18 35.91 -1.19 -1.24 -0.81 -1.12 -1.26 -1.18 -1.03 -1.02 -0.56 16.00 14.33 25.57 26.83 23.68 38.35 28.68 25.73 35.91 -1.19 -1.13 -0.50 0.25 0.42 1.17 -1.23 -1.14 -0.89 PS2−server 104
105 PS2−manual 13.17 10.83 20.02 18.60 15.55 19.78 26.10 22.18 35.91 -1.19 -1.24 -0.81 -1.12 -1.26 -1.18 -1.03 -1.02 -0.56 16.00 14.33 25.57 26.83 23.68 38.35 28.68 25.73 35.91 -1.19 -1.13 -0.50 0.25 0.42 1.17 -1.23 -1.14 -0.89 PS2−manual 105
106 3D−JIGSAW_V3 13.00 12.44 10.16 18.90 14.63 7.52 26.84 25.61 29.38 -1.21 -1.02 -1.86 -1.05 -1.53 -3.05 -0.99 -0.82 -0.98 13.67 12.89 10.98 18.90 15.85 7.52 27.21 25.61 30.99 -1.48 -1.33 -2.09 -1.36 -1.48 -3.35 -1.31 -1.14 -1.22 3D−JIGSAW_V3 106
107 Softberry 13.00 10.22 16.03 17.38 14.33 21.48 26.84 19.48 25.97 -1.21 -1.32 -1.23 -1.41 -1.62 -0.92 -0.99 -1.18 -1.19 13.00 10.22 16.03 17.38 14.33 21.48 26.84 19.48 25.97 -1.56 -1.70 -1.54 -1.66 -1.85 -1.30 -1.33 -1.51 -1.56 Softberry 107
108 ABIpro 12.83 11.89 17.19 21.65 19.92 25.87 19.12 14.34 24.08 -1.23 -1.10 -1.11 -0.40 0.06 -0.26 -1.39 -1.48 -1.32 12.83 11.89 17.48 21.95 20.22 26.02 19.48 17.03 24.73 -1.58 -1.47 -1.39 -0.74 -0.42 -0.64 -1.74 -1.66 -1.64 ABIpro 108
109 FOLDpro 12.83 11.89 16.04 21.95 20.22 25.88 18.38 12.50 21.84 -1.23 -1.10 -1.23 -0.33 0.15 -0.25 -1.43 -1.59 -1.46 13.50 12.17 16.04 21.95 20.22 26.01 19.85 18.75 21.84 -1.50 -1.43 -1.54 -0.74 -0.42 -0.64 -1.72 -1.56 -1.84 FOLDpro 109
110 Jiang_Zhu 12.83 11.39 12.91 19.82 15.55 20.33 27.94 24.27 21.41 -1.23 -1.17 -1.57 -0.83 -1.26 -1.10 -0.94 -0.90 -1.49 12.83 11.39 12.91 19.82 15.55 20.33 27.94 24.27 21.41 -1.58 -1.54 -1.88 -1.17 -1.56 -1.47 -1.27 -1.22 -1.87 Jiang_Zhu 110
111 mahmood−torda−server 12.83 10.11 14.59 23.48 18.50 23.81 17.65 14.22 21.54 -1.23 -1.34 -1.39 0.03 -0.37 -0.57 -1.47 -1.48 -1.48 12.83 10.11 14.59 23.48 18.50 23.81 21.69 16.18 22.83 -1.58 -1.71 -1.70 -0.43 -0.84 -0.96 -1.62 -1.71 -1.77 mahmood−torda−server 111
112 3Dpro 12.67 11.89 17.41 21.65 20.12 25.53 19.85 16.54 24.75 -1.25 -1.10 -1.09 -0.40 0.12 -0.31 -1.36 -1.35 -1.27 12.83 11.89 17.41 22.26 20.22 25.98 22.06 18.26 24.75 -1.58 -1.47 -1.39 -0.67 -0.42 -0.65 -1.60 -1.58 -1.64 3Dpro 112
113 ProtAnG 12.67 11.22 21.11 20.43 17.79 25.69 24.63 20.34 31.98 -1.25 -1.19 -0.69 -0.69 -0.58 -0.28 -1.11 -1.13 -0.81 12.67 11.22 21.11 20.43 17.79 25.69 24.63 20.34 31.98 -1.60 -1.56 -0.99 -1.05 -1.01 -0.69 -1.46 -1.46 -1.15 ProtAnG 113
114 Bilab−UT 12.67 10.78 16.97 20.12 17.48 23.29 25.37 21.94 26.55 -1.25 -1.25 -1.13 -0.76 -0.67 -0.65 -1.07 -1.03 -1.16 13.17 11.39 17.14 21.34 18.09 25.09 25.37 21.94 26.55 -1.54 -1.54 -1.42 -0.86 -0.94 -0.78 -1.42 -1.36 -1.52 Bilab−UT 114
115 Pushchino 12.67 9.00 10.54 21.04 18.39 16.23 27.94 19.48 21.94 -1.25 -1.49 -1.82 -0.54 -0.40 -1.73 -0.94 -1.18 -1.45 12.67 9.00 10.54 21.04 18.39 16.23 27.94 19.48 21.94 -1.60 -1.86 -2.14 -0.92 -0.87 -2.07 -1.27 -1.51 -1.83 Pushchino 115
116 fais−server 12.50 11.44 14.04 21.04 19.11 23.27 20.59 17.16 20.79 -1.27 -1.16 -1.44 -0.54 -0.18 -0.65 -1.32 -1.31 -1.53 17.17 15.28 25.04 25.00 20.43 39.03 27.57 23.41 31.28 -1.05 -1.00 -0.56 -0.12 -0.37 1.27 -1.29 -1.28 -1.20 fais−server 116
117 schenk−torda−server 12.50 11.28 12.51 19.51 19.11 21.54 20.59 18.02 19.28 -1.27 -1.18 -1.61 -0.90 -0.18 -0.92 -1.32 -1.26 -1.62 13.33 11.39 14.64 20.12 19.11 22.56 20.59 18.26 22.55 -1.52 -1.54 -1.70 -1.11 -0.69 -1.15 -1.68 -1.58 -1.79 schenk−torda−server 117
118 MeilerLabRene 12.50 9.72 17.23 18.29 16.77 24.92 22.79 19.85 25.51 -1.27 -1.39 -1.10 -1.19 -0.89 -0.40 -1.20 -1.15 -1.22 16.17 12.61 17.39 23.17 21.55 25.09 32.72 25.37 26.07 -1.17 -1.37 -1.39 -0.49 -0.10 -0.78 -1.01 -1.16 -1.55 MeilerLabRene 118
119 mariner1 12.50 8.94 15.15 24.09 17.07 25.71 18.38 15.69 20.55 -1.27 -1.50 -1.33 0.18 -0.80 -0.28 -1.43 -1.40 -1.54 14.50 13.17 21.30 24.09 19.21 25.71 30.15 27.21 34.29 -1.38 -1.29 -0.97 -0.30 -0.67 -0.69 -1.15 -1.05 -1.00 mariner1 119
120 TJ_Jiang 12.33 11.61 12.56 20.73 17.89 18.67 25.37 21.94 22.99 -1.29 -1.14 -1.60 -0.61 -0.55 -1.35 -1.07 -1.03 -1.38 16.83 15.11 18.88 28.35 25.81 31.68 25.37 21.94 28.33 -1.09 -1.02 -1.23 0.56 0.93 0.19 -1.42 -1.36 -1.40 TJ_Jiang 120
121 Distill 12.33 8.33 24.12 20.12 15.24 29.84 24.63 17.40 33.57 -1.29 -1.58 -0.37 -0.76 -1.35 0.35 -1.11 -1.30 -0.71 14.17 12.17 25.35 26.52 21.65 30.66 27.57 23.04 34.95 -1.42 -1.43 -0.53 0.19 -0.08 0.04 -1.29 -1.30 -0.95 Distill 121
122 SAM−T06−server 12.17 9.06 14.42 18.90 17.68 17.70 23.90 17.52 26.91 -1.31 -1.48 -1.40 -1.05 -0.61 -1.50 -1.15 -1.29 -1.14 23.00 19.22 14.42 18.90 17.68 17.70 50.73 42.40 41.08 -0.33 -0.46 -1.72 -1.36 -1.04 -1.86 -0.01 -0.13 -0.54 SAM−T06−server 122
123 DelCLab 12.00 9.22 11.55 17.68 15.65 19.22 19.12 16.91 20.24 -1.33 -1.46 -1.71 -1.33 -1.23 -1.27 -1.39 -1.33 -1.56 12.00 10.44 11.72 17.68 15.75 19.50 19.48 18.02 20.37 -1.69 -1.67 -2.01 -1.60 -1.51 -1.59 -1.74 -1.60 -1.94 DelCLab 123
124 ProteinShop 11.50 10.00 2.44 21.04 18.29 23.65 0.00 0.00 -1.34 -1.39 -1.35 -2.68 -0.54 -0.43 -0.59 -2.39 -2.32 -2.94 14.33 13.00 7.04 26.22 23.78 32.39 0.00 0.00 -1.34 -1.40 -1.31 -2.52 0.13 0.44 0.29 -2.82 -2.68 -3.41 ProteinShop 124
125 pipe_int 11.50 9.78 13.06 18.90 15.85 21.27 20.96 19.12 21.21 -1.39 -1.38 -1.55 -1.05 -1.16 -0.96 -1.30 -1.20 -1.50 13.00 11.44 15.92 19.51 17.18 26.70 20.96 19.12 21.21 -1.56 -1.53 -1.56 -1.23 -1.16 -0.54 -1.66 -1.53 -1.88 pipe_int 125
126 CBSU 11.50 9.61 15.38 17.68 13.62 20.39 23.53 21.20 26.21 -1.39 -1.41 -1.30 -1.33 -1.84 -1.09 -1.17 -1.08 -1.18 13.00 10.61 15.38 18.29 16.26 20.39 23.90 22.06 26.54 -1.56 -1.64 -1.61 -1.48 -1.38 -1.46 -1.50 -1.36 -1.52 CBSU 126
127 COMA 11.17 10.06 10.10 19.51 15.45 20.55 18.75 16.30 15.97 -1.43 -1.35 -1.86 -0.90 -1.29 -1.07 -1.41 -1.36 -1.83 27.83 24.28 33.04 20.73 19.31 25.87 60.29 50.73 55.66 0.27 0.24 0.31 -0.98 -0.64 -0.66 0.52 0.37 0.45 COMA 127
128 OLGAFS 10.67 9.33 8.68 16.46 16.06 16.73 17.28 14.34 17.44 -1.49 -1.45 -2.02 -1.62 -1.10 -1.65 -1.49 -1.48 -1.74 10.83 9.50 8.68 16.77 16.06 16.73 17.65 14.71 18.09 -1.83 -1.80 -2.35 -1.79 -1.43 -2.00 -1.84 -1.80 -2.09 OLGAFS 128
129 LOOPP_Server 10.67 9.28 4.67 14.02 11.99 0.97 23.53 21.20 25.29 -1.49 -1.45 -2.44 -2.20 -2.33 -4.05 -1.17 -1.08 -1.24 14.50 12.72 10.11 15.55 14.23 1.33 28.31 22.43 34.84 -1.38 -1.35 -2.19 -2.03 -1.88 -4.26 -1.25 -1.33 -0.96 LOOPP_Server 129
130 rehtnap 10.50 9.06 -9.67 0.00 0.00 -9.70 23.16 19.98 9.22 -1.51 -1.48 -3.97 -5.51 -5.95 -5.68 -1.18 -1.15 -2.26 12.33 10.78 -9.21 0.00 0.00 -9.70 27.21 23.77 10.11 -1.65 -1.62 -4.30 -5.18 -5.33 -5.87 -1.31 -1.25 -2.63 rehtnap 130
131 psiphifoldings 9.50 8.50 15.29 16.77 14.94 24.47 18.38 14.95 22.06 -1.63 -1.56 -1.31 -1.55 -1.44 -0.47 -1.43 -1.44 -1.44 9.50 8.50 15.29 16.77 14.94 24.47 18.38 14.95 22.06 -1.99 -1.93 -1.62 -1.79 -1.70 -0.87 -1.80 -1.78 -1.82 psiphifoldings 131
132 panther_server 9.50 8.28 -7.72 17.38 15.14 4.34 0.00 0.00 -1.34 -1.63 -1.59 -3.77 -1.41 -1.38 -3.54 -2.39 -2.32 -2.94 9.50 8.28 -7.51 17.38 15.14 4.74 0.00 0.00 -1.34 -1.99 -1.96 -4.11 -1.66 -1.66 -3.76 -2.82 -2.68 -3.41 panther_server 132
133 Abagyan                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 Abagyan 133
134 BHAGEERATH                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 BHAGEERATH 134
135 FEIG_REFINE                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 FEIG_REFINE 135
136 FUGUE_KM                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       0.02 0.08 -1.85 -1.23 -1.48 -1.58 0.17 0.12 -1.66 FUGUE_KM 136
137 Fiser−M4T                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 Fiser−M4T 137
138 FrankensteinLong                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 FrankensteinLong 138
139 HCA                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 HCA 139
140 KudlatyPredHuman                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 KudlatyPredHuman 140
141 Linnolt−UH−CMB                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 Linnolt−UH−CMB 141
142 NIM2                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 NIM2 142
143 Nano_team                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 Nano_team 143
144 NirBenTal                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 NirBenTal 144
145 Ozkan−Shell                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 Ozkan−Shell 145
146 PHAISTOS                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 PHAISTOS 146
147 POISE                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 POISE 147
148 PZ−UAM                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 PZ−UAM 148
149 RPFM                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 RPFM 149
150 Scheraga                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 Scheraga 150
151 ShakAbInitio                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 ShakAbInitio 151
152 TsaiLab                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 TsaiLab 152
153 UCDavisGenome                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 UCDavisGenome 153
154 Wolfson−FOBIA                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 Wolfson−FOBIA 154
155 YASARA                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 YASARA 155
156 YASARARefine                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 YASARARefine 156
157 dill_ucsf                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 dill_ucsf 157
158 dill_ucsf_extended                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 dill_ucsf_extended 158
159 jacobson                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 jacobson 159
160 mti                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 mti 160
161 mumssp                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 mumssp 161
162 ricardo                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 ricardo 162
163 rivilo                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 rivilo 163
164 sessions                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 sessions 164
165 test_http_server_01                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 test_http_server_01 165
166 tripos_08                                                       -1.18 -1.25 -1.53 -0.88 -0.87 -1.21 -1.12 -1.11 -1.29                                                       -1.54 -1.62 -1.85 -1.21 -1.24 -1.58 -1.47 -1.45 -1.66 tripos_08 166