T0430

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0430

Haspin (GSG2A) from Homo sapiens

Target type: Server only

Target sequence:

>T0430 GSG2A, Homo sapiens, 357 residues
MHHHHHHSSGVDLGTENLYFQSMGECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK

Structure:
Method: X-ray, res=1.85Å, R/Rfree=0.17/0.22
Determined by: SGC
PDB ID: 3dlz

3dlz_A cartoon
Cartoon diagram of 430: 3dlz chain A

PyMOL of 3dlz

Domains:  PyMOL of domains

Two domains. Residue ranges in PDB: 470-607 and 608-798. Residue ranges in target: 29-166 and 167-357.

430 domain evaluation plot
Correlation between weighted by the number of residues sum of GDT-TS scores for domain-based evlatuation (y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the weighted sum of domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

Protein kinase two-domain fold.

CASP category:

Whole chain: Fold recognition.

1st domain: Fold recognition. 2nd domain: Fold recognition. Quite an elaborate kinase domain, could be good for human/server prediction.

Closest templates:

1luf, 1t46, 2psq, 2ivs, 3cbl, 2b7a.

Target sequence - PDB file inconsistencies:

T0430    3dlz.pdb    T0430.pdb    PyMOL    PyMOL of domains    

T0430    1 MHHHHHHSSGVDLGTENLYFQSMGECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK 357
           ~~~~~~~~~~~~~~~~~~~~~~~~~~~~|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3dlzA  470 ----------------------------KGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQTIADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNSVHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLEFEFGGIDLEQMRTKLSSLATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGLQVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK 798

We suggest to evaluate this target as a single domain spanning whole chain. However, evolutionarily this is a 2-domain protein:

1st domain: target 29-166 ; pdb 470-607

2nd domain: target 167-357 ; pdb 608-798

Sequence classification:

Protein tyrosine kinase (Pkinase_Tyr) in Pfam.

Server predictions:

T0430:pdb 470-798:seq 29-357:FR;   alignment

distribution of first scores
First models for T0430: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

430_1:pdb 470-607:seq 29-166:FR;   alignment

distribution of first scores
First models for T0430_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

430_2:pdb 608-798:seq 167-357:FR;   alignment

distribution of first scores
First models for T0430_2: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0430 430_1 430_2 T0430 430_1 430_2 T0430 430_1 430_2 T0430 430_1 430_2
First score First Z-score Best score Best Z-score
1 FALCON_CONSENSUS 43.31 36.78 38.70 46.74 41.06 39.80 47.25 43.59 43.35 2.03 1.73 2.13 1.28 1.19 0.99 2.41 2.75 2.38 43.31 36.78 38.70 46.74 41.06 39.80 47.25 43.59 43.35 2.26 1.93 1.87 1.17 1.00 0.62 2.29 2.64 1.85 FALCON_CONSENSUS 1
2 FALCON 43.31 36.78 38.70 46.74 41.06 39.80 47.25 43.59 43.35 2.03 1.73 2.13 1.28 1.19 0.99 2.41 2.75 2.38 43.31 36.78 38.70 46.74 41.06 39.80 47.25 43.59 43.35 2.26 1.93 1.87 1.17 1.00 0.62 2.29 2.64 1.85 FALCON 2
3 Pcons_dot_net 42.70 35.64 39.19 46.92 37.86 39.20 46.47 41.14 44.16 1.93 1.54 2.21 1.31 0.69 0.88 2.29 2.33 2.50 42.70 36.65 39.19 46.92 37.86 39.20 47.91 41.62 44.16 2.13 1.89 1.96 1.21 0.29 0.50 2.41 2.25 1.97 Pcons_dot_net 3
4 Pcons_multi 42.70 35.64 39.19 46.92 37.86 39.20 46.47 41.14 44.16 1.93 1.54 2.21 1.31 0.69 0.88 2.29 2.33 2.50 44.91 37.92 39.49 47.10 37.86 39.20 51.18 45.94 46.14 2.61 2.19 2.02 1.25 0.29 0.50 2.98 3.10 2.28 Pcons_multi 4
5 Zhang−Server 36.63 33.13 32.98 45.47 41.24 42.82 35.34 30.89 33.88 0.97 1.11 1.17 1.08 1.22 1.54 0.58 0.58 0.94 36.63 33.18 33.86 47.28 42.81 44.46 35.86 30.98 34.58 0.83 1.08 0.97 1.29 1.38 1.54 0.30 0.15 0.52 Zhang−Server 5
6 COMA 36.32 32.45 35.49 38.77 34.54 36.52 41.36 35.95 39.77 0.92 1.00 1.59 0.01 0.17 0.40 1.50 1.44 1.84 36.32 32.60 36.51 41.85 34.54 40.16 41.36 35.95 39.77 0.76 0.94 1.46 0.06 -0.45 0.69 1.27 1.13 1.31 COMA 6
7 MULTICOM−CLUSTER 36.02 32.88 28.23 42.94 37.86 39.88 34.42 31.20 27.82 0.88 1.07 0.37 0.68 0.69 1.01 0.44 0.63 0.02 36.02 32.88 29.26 43.84 40.22 40.84 34.42 31.20 30.31 0.70 1.01 0.11 0.51 0.81 0.82 0.05 0.19 -0.13 MULTICOM−CLUSTER 7
8 MULTICOM−RANK 36.02 32.57 28.19 42.94 37.86 39.71 34.95 27.97 27.88 0.88 1.02 0.37 0.68 0.69 0.98 0.52 0.08 0.03 36.02 32.57 29.19 43.66 39.80 39.71 34.95 29.01 30.32 0.70 0.93 0.10 0.47 0.72 0.60 0.14 -0.24 -0.13 MULTICOM−RANK 8
9 MULTICOM−CMFR 36.02 30.65 28.82 43.30 39.43 37.66 35.34 31.59 30.79 0.88 0.69 0.47 0.74 0.94 0.60 0.58 0.70 0.47 36.02 30.65 28.82 43.30 39.43 37.94 36.13 32.02 30.79 0.70 0.48 0.03 0.39 0.63 0.25 0.35 0.35 -0.05 MULTICOM−CMFR 9
10 SAM−T08−server 35.87 32.67 37.19 41.30 37.68 38.03 35.86 28.97 41.70 0.85 1.04 1.87 0.42 0.66 0.67 0.66 0.25 2.13 36.47 32.67 37.19 43.30 37.74 38.03 35.86 29.84 41.70 0.80 0.96 1.59 0.39 0.26 0.27 0.30 -0.08 1.60 SAM−T08−server 10
11 FEIG 35.49 28.80 32.10 42.94 38.23 41.41 35.47 31.37 32.82 0.79 0.38 1.02 0.68 0.75 1.29 0.60 0.66 0.78 36.40 31.13 32.33 48.37 43.90 44.65 35.86 31.37 35.54 0.78 0.59 0.69 1.54 1.63 1.58 0.30 0.22 0.67 FEIG 11
12 pro−sp3−TASSER 34.95 30.90 28.70 40.22 34.42 40.71 33.64 30.06 27.42 0.71 0.74 0.45 0.25 0.15 1.16 0.32 0.44 -0.04 34.95 30.90 29.67 47.65 40.70 45.54 33.64 30.06 28.29 0.47 0.54 0.19 1.38 0.92 1.76 -0.08 -0.03 -0.43 pro−sp3−TASSER 12
13 METATASSER 34.88 31.13 30.58 42.57 38.10 44.55 33.25 29.84 28.32 0.70 0.78 0.77 0.62 0.73 1.86 0.26 0.40 0.10 34.88 31.13 30.58 45.47 38.71 44.61 34.03 31.15 28.32 0.45 0.59 0.36 0.88 0.48 1.57 -0.02 0.18 -0.43 METATASSER 13
14 nFOLD3 34.73 28.62 28.27 43.66 36.53 37.50 35.86 31.94 29.38 0.67 0.35 0.38 0.79 0.48 0.58 0.66 0.76 0.26 34.73 28.62 28.97 43.66 36.53 38.33 36.39 33.07 32.33 0.42 0.00 0.06 0.47 -0.01 0.33 0.40 0.56 0.18 nFOLD3 14
15 panther_server 34.50 29.89 24.33 44.38 40.58 35.00 32.59 28.88 23.73 0.64 0.57 -0.28 0.91 1.12 0.12 0.16 0.23 -0.60 34.50 29.89 25.59 44.38 40.58 37.07 33.90 31.20 24.77 0.37 0.30 -0.57 0.64 0.89 0.08 -0.04 0.19 -0.97 panther_server 15
16 LEE−SERVER 34.12 30.39 28.55 42.39 32.73 38.51 35.34 30.89 29.18 0.58 0.65 0.43 0.59 -0.12 0.76 0.58 0.58 0.23 35.49 32.37 29.82 44.38 40.76 40.65 35.86 30.89 29.88 0.59 0.89 0.22 0.64 0.93 0.79 0.30 0.13 -0.19 LEE−SERVER 16
17 COMA−M 33.97 27.68 32.32 41.85 34.90 37.22 40.18 33.99 34.29 0.55 0.19 1.06 0.51 0.23 0.52 1.32 1.11 1.00 36.02 31.76 36.51 41.85 35.33 40.16 41.75 36.52 39.09 0.70 0.74 1.46 0.06 -0.27 0.69 1.33 1.24 1.21 COMA−M 17
18 3D−JIGSAW_V3 33.74 30.55 25.73 46.74 43.72 40.39 31.55 27.97 23.30 0.52 0.68 -0.04 1.28 1.61 1.10 -0.00 0.08 -0.67 35.71 32.42 27.33 49.09 44.63 43.29 32.07 27.97 23.59 0.63 0.90 -0.24 1.70 1.79 1.31 -0.36 -0.45 -1.15 3D−JIGSAW_V3 18
19 keasar−server 33.66 29.10 30.87 43.48 36.35 35.13 35.99 30.59 31.43 0.50 0.43 0.82 0.77 0.45 0.14 0.68 0.53 0.57 35.41 29.59 35.39 45.11 40.10 39.02 35.99 31.72 37.86 0.57 0.23 1.25 0.80 0.78 0.46 0.33 0.29 1.02 keasar−server 19
20 FAMSD 33.59 29.79 26.19 40.40 36.41 35.54 34.16 29.54 27.02 0.49 0.55 0.03 0.27 0.46 0.22 0.40 0.35 -0.10 34.73 31.18 36.67 42.03 37.20 37.41 39.14 34.86 44.89 0.42 0.61 1.49 0.10 0.14 0.14 0.88 0.91 2.09 FAMSD 20
21 mGenTHREADER 33.59 29.43 25.79 42.03 39.98 23.33 34.16 30.67 31.19 0.49 0.49 -0.03 0.53 1.02 -2.00 0.40 0.54 0.53 33.59 29.43 25.79 42.03 39.98 23.33 34.16 30.67 31.19 0.18 0.19 -0.53 0.10 0.76 -2.65 0.01 0.09 0.01 mGenTHREADER 21
22 3D−JIGSAW_AEP 33.51 31.64 23.57 44.02 37.92 37.76 31.81 29.45 21.24 0.48 0.86 -0.41 0.85 0.70 0.62 0.04 0.33 -0.98 33.97 31.64 23.90 44.02 38.71 37.77 31.81 30.32 21.99 0.26 0.71 -0.88 0.56 0.48 0.22 -0.40 0.02 -1.39 3D−JIGSAW_AEP 22
23 circle 33.05 29.25 24.78 39.13 34.66 32.50 34.03 29.41 26.74 0.41 0.46 -0.20 0.07 0.19 -0.33 0.38 0.32 -0.14 34.12 29.53 33.30 43.48 36.11 39.02 39.66 33.99 37.94 0.29 0.22 0.87 0.43 -0.10 0.46 0.97 0.74 1.03 circle 23
24 3DShot2 32.83 29.53 24.80 39.31 31.82 35.79 32.98 29.49 24.65 0.37 0.50 -0.20 0.10 -0.26 0.26 0.22 0.34 -0.46 32.83 29.53 24.80 39.31 31.82 35.79 32.98 29.49 24.65 0.01 0.22 -0.71 -0.51 -1.05 -0.18 -0.20 -0.15 -0.99 3DShot2 24
25 MUProt 32.83 27.81 26.05 40.22 31.34 35.48 34.82 32.11 27.37 0.37 0.21 0.01 0.25 -0.33 0.21 0.50 0.79 -0.05 35.79 30.12 29.12 43.30 40.04 40.74 36.26 32.11 31.11 0.65 0.36 0.09 0.39 0.77 0.80 0.37 0.37 -0.01 MUProt 25
26 MUSTER 32.67 29.53 26.01 38.23 30.25 35.38 33.64 30.24 26.91 0.35 0.50 0.00 -0.07 -0.50 0.19 0.32 0.47 -0.12 34.04 29.84 28.78 44.02 39.37 42.07 35.73 32.98 27.42 0.27 0.29 0.03 0.56 0.62 1.07 0.28 0.54 -0.57 MUSTER 26
27 MULTICOM−REFINE 32.52 28.12 27.33 38.59 29.89 35.12 36.13 28.53 29.61 0.32 0.27 0.22 -0.01 -0.56 0.14 0.70 0.17 0.29 35.71 31.71 29.25 43.66 40.16 37.98 36.13 31.72 30.77 0.63 0.73 0.11 0.47 0.80 0.26 0.35 0.29 -0.06 MULTICOM−REFINE 27
28 SAM−T02−server 32.45 29.41 28.10 40.76 37.86 24.74 32.98 26.70 34.61 0.31 0.48 0.35 0.33 0.69 -1.74 0.22 -0.14 1.05 32.45 29.41 28.78 40.76 38.23 24.74 33.77 30.89 36.17 -0.07 0.19 0.03 -0.18 0.37 -2.37 -0.06 0.13 0.76 SAM−T02−server 28
29 Pcons_local 32.22 28.37 15.63 44.20 40.94 35.58 28.01 24.17 5.64 0.28 0.31 -1.74 0.88 1.17 0.23 -0.55 -0.57 -3.35 42.70 35.64 39.19 46.92 40.94 39.20 46.47 41.14 44.16 2.13 1.66 1.96 1.21 0.97 0.50 2.16 2.15 1.97 Pcons_local 29
30 forecast 31.69 27.53 27.66 41.12 37.26 37.52 32.33 28.66 28.27 0.19 0.17 0.28 0.39 0.60 0.58 0.12 0.20 0.09 31.69 28.45 27.66 41.12 37.74 37.52 32.33 28.84 28.27 -0.23 -0.04 -0.18 -0.10 0.26 0.17 -0.31 -0.27 -0.44 forecast 30
31 Frankenstein 31.54 27.68 23.42 38.41 34.18 34.47 32.85 26.92 23.14 0.17 0.19 -0.43 -0.04 0.11 0.02 0.20 -0.10 -0.69 34.27 29.99 24.30 43.66 38.34 37.07 33.51 27.49 23.92 0.32 0.33 -0.81 0.47 0.39 0.08 -0.11 -0.54 -1.10 Frankenstein 31
32 FFASsuboptimal 31.31 28.47 22.53 39.49 36.59 33.68 30.89 26.79 22.60 0.13 0.32 -0.58 0.13 0.49 -0.12 -0.10 -0.12 -0.77 31.91 29.23 22.53 39.49 37.32 33.68 33.38 30.67 23.67 -0.18 0.15 -1.14 -0.47 0.17 -0.60 -0.13 0.09 -1.13 FFASsuboptimal 32
33 CpHModels 31.23 28.24 26.53 41.85 38.71 34.87 33.64 31.89 28.49 0.12 0.29 0.09 0.51 0.82 0.10 0.32 0.75 0.12 31.23 28.24 26.53 41.85 38.71 34.87 33.64 31.89 28.49 -0.33 -0.09 -0.39 0.06 0.48 -0.36 -0.08 0.33 -0.40 CpHModels 33
34 FFASstandard 31.00 26.90 21.63 38.41 34.66 31.71 31.55 26.92 22.00 0.08 0.06 -0.73 -0.04 0.19 -0.48 -0.00 -0.10 -0.86 31.84 27.13 24.19 39.49 35.99 36.84 31.55 27.14 22.66 -0.20 -0.35 -0.83 -0.47 -0.13 0.03 -0.45 -0.61 -1.29 FFASstandard 34
35 FFASflextemplate 31.00 26.90 21.63 38.41 34.66 31.71 31.55 26.92 22.00 0.08 0.06 -0.73 -0.04 0.19 -0.48 -0.00 -0.10 -0.86 32.37 28.01 21.63 40.22 35.33 31.71 31.55 27.40 22.00 -0.08 -0.14 -1.30 -0.31 -0.27 -0.99 -0.45 -0.56 -1.39 FFASflextemplate 35
36 HHpred5 30.77 28.70 25.60 42.39 36.72 36.42 26.70 24.35 25.83 0.05 0.36 -0.07 0.59 0.51 0.38 -0.75 -0.54 -0.28 30.77 28.70 25.60 42.39 36.72 36.42 26.70 24.35 25.83 -0.43 0.02 -0.57 0.19 0.03 -0.05 -1.30 -1.16 -0.81 HHpred5 36
37 BAKER−ROBETTA 30.32 27.33 32.61 45.47 40.88 46.72 27.09 24.39 30.43 -0.02 0.13 1.11 1.08 1.16 2.25 -0.69 -0.53 0.42 31.84 28.45 34.68 48.55 43.36 46.72 40.58 36.91 41.01 -0.20 -0.04 1.12 1.58 1.51 1.99 1.13 1.32 1.50 BAKER−ROBETTA 37
38 GS−KudlatyPred 30.17 24.27 18.11 38.23 35.09 24.73 31.02 27.44 20.75 -0.05 -0.39 -1.32 -0.07 0.26 -1.74 -0.08 -0.01 -1.05 30.17 24.27 18.11 38.23 35.09 24.73 31.02 27.44 20.75 -0.56 -1.02 -1.96 -0.76 -0.33 -2.37 -0.54 -0.55 -1.58 GS−KudlatyPred 38
39 PS2−server 29.25 26.27 29.94 26.81 24.52 24.87 40.97 32.81 39.45 -0.19 -0.05 0.66 -1.89 -1.40 -1.72 1.44 0.91 1.79 31.23 26.93 29.94 34.60 30.25 26.89 40.97 35.25 39.91 -0.33 -0.40 0.24 -1.58 -1.40 -1.95 1.20 0.99 1.33 PS2−server 39
40 HHpred2 29.18 25.38 30.50 42.39 35.20 39.37 29.19 24.13 31.93 -0.20 -0.20 0.75 0.59 0.27 0.91 -0.37 -0.58 0.65 29.18 25.38 30.50 42.39 35.20 39.37 29.19 24.13 31.93 -0.77 -0.76 0.35 0.19 -0.30 0.53 -0.86 -1.20 0.12 HHpred2 40
41 GS−MetaServer2 28.27 24.06 17.86 29.71 24.82 22.78 31.15 25.13 22.23 -0.35 -0.42 -1.36 -1.43 -1.36 -2.10 -0.06 -0.41 -0.83 29.56 25.25 22.22 39.13 32.61 26.38 31.94 26.66 26.05 -0.69 -0.79 -1.19 -0.55 -0.88 -2.05 -0.38 -0.70 -0.77 GS−MetaServer2 41
42 GeneSilicoMetaServer 28.19 24.85 19.22 32.25 26.33 27.64 30.89 25.48 20.86 -0.36 -0.29 -1.14 -1.02 -1.12 -1.22 -0.10 -0.35 -1.04 32.52 28.98 21.69 42.03 36.29 33.57 33.51 29.93 25.94 -0.05 0.09 -1.29 0.10 -0.06 -0.62 -0.11 -0.06 -0.79 GeneSilicoMetaServer 42
43 Phragment 27.89 25.43 24.54 40.40 38.34 29.64 27.62 25.09 28.75 -0.41 -0.19 -0.24 0.27 0.77 -0.85 -0.61 -0.41 0.16 30.47 26.67 27.65 40.40 38.34 35.97 28.93 25.09 29.34 -0.49 -0.46 -0.18 -0.26 0.39 -0.14 -0.91 -1.01 -0.27 Phragment 43
44 HHpred4 27.74 26.06 24.30 39.13 36.72 36.52 24.74 22.82 23.45 -0.43 -0.08 -0.28 0.07 0.51 0.40 -1.05 -0.80 -0.64 27.74 26.06 24.30 39.13 36.72 36.52 24.74 22.82 23.45 -1.08 -0.60 -0.81 -0.55 0.03 -0.03 -1.64 -1.46 -1.17 HHpred4 44
45 SAM−T06−server 26.90 24.42 21.36 38.04 31.76 28.79 26.44 23.91 24.68 -0.56 -0.36 -0.78 -0.10 -0.27 -1.01 -0.79 -0.62 -0.46 29.48 25.25 21.36 38.04 31.76 28.79 30.50 26.05 24.68 -0.70 -0.79 -1.35 -0.80 -1.07 -1.57 -0.63 -0.83 -0.98 SAM−T06−server 45
46 Poing 26.82 24.24 27.44 40.40 34.84 36.83 27.62 25.13 28.66 -0.58 -0.39 0.24 0.27 0.22 0.45 -0.61 -0.41 0.15 29.56 25.71 29.23 40.40 37.62 40.53 28.93 25.13 29.59 -0.69 -0.68 0.11 -0.26 0.23 0.76 -0.91 -1.01 -0.24 Poing 46
47 Phyre2 26.67 24.14 28.43 39.85 36.72 38.24 27.62 25.13 29.40 -0.60 -0.41 0.41 0.19 0.51 0.71 -0.61 -0.41 0.26 30.17 26.55 29.00 42.57 37.98 38.24 28.93 25.13 30.07 -0.56 -0.48 0.07 0.23 0.31 0.31 -0.91 -1.01 -0.16 Phyre2 47
48 RAPTOR 26.60 21.25 22.30 30.25 22.40 32.08 31.55 27.09 23.00 -0.61 -0.90 -0.62 -1.34 -1.74 -0.41 -0.00 -0.07 -0.71 32.37 29.03 22.42 41.12 35.57 32.08 32.98 30.54 24.22 -0.08 0.10 -1.16 -0.10 -0.22 -0.91 -0.20 0.06 -1.05 RAPTOR 48
49 Phyre_de_novo 26.44 23.56 28.82 38.23 35.99 39.26 27.49 25.00 29.32 -0.64 -0.51 0.47 -0.07 0.40 0.89 -0.63 -0.43 0.25 30.70 26.93 28.93 41.67 37.92 39.26 28.53 25.57 30.13 -0.44 -0.40 0.05 0.02 0.30 0.51 -0.98 -0.92 -0.15 Phyre_de_novo 49
50 FUGUE_KM 26.29 22.19 13.95 27.72 23.73 17.02 31.94 28.45 20.27 -0.66 -0.74 -2.02 -1.75 -1.53 -3.14 0.06 0.16 -1.13 26.29 22.19 14.86 31.70 29.65 18.81 31.94 28.45 22.08 -1.39 -1.51 -2.56 -2.23 -1.53 -3.55 -0.38 -0.35 -1.38 FUGUE_KM 50
51 PSI 24.92 21.55 27.12 30.07 24.27 35.69 29.97 22.56 28.79 -0.88 -0.85 0.19 -1.37 -1.44 0.25 -0.25 -0.85 0.17 33.28 28.62 29.15 44.75 40.10 39.14 33.25 29.45 29.93 0.11 0.00 0.09 0.72 0.78 0.49 -0.15 -0.15 -0.18 PSI 51
52 pipe_int 24.54 20.75 27.31 37.14 33.51 39.85 24.21 22.38 26.10 -0.94 -0.98 0.22 -0.25 0.01 1.00 -1.13 -0.88 -0.24 24.54 20.75 27.31 37.14 33.51 39.85 24.21 22.38 26.10 -1.76 -1.85 -0.25 -1.00 -0.68 0.63 -1.73 -1.55 -0.77 pipe_int 52
53 ACOMPMOD 24.54 19.58 18.10 32.61 24.76 25.79 22.25 19.63 19.93 -0.94 -1.18 -1.32 -0.97 -1.37 -1.55 -1.43 -1.35 -1.18 33.89 28.17 34.87 42.03 33.58 37.63 42.67 37.26 41.55 0.24 -0.10 1.16 0.10 -0.66 0.19 1.49 1.39 1.58 ACOMPMOD 53
54 Fiser−M4T 23.18 18.82 9.01 36.96 27.23 26.12 20.42 18.15 3.31 -1.15 -1.31 -2.85 -0.27 -0.98 -1.49 -1.71 -1.60 -3.70 23.18 18.82 9.01 36.96 27.23 26.12 20.42 18.15 3.31 -2.06 -2.31 -3.65 -1.04 -2.07 -2.10 -2.39 -2.38 -4.22 Fiser−M4T 54
55 Distill 18.09 13.20 23.22 25.91 19.20 31.03 20.55 17.41 26.54 -1.95 -2.26 -0.47 -2.04 -2.24 -0.60 -1.69 -1.73 -0.17 19.68 15.10 24.61 28.26 21.62 33.58 21.60 17.67 27.96 -2.81 -3.18 -0.75 -3.01 -3.31 -0.62 -2.19 -2.48 -0.48 Distill 55
56 MUFOLD−Server 14.51 10.41 17.42 15.94 13.53 22.26 20.55 15.31 22.96 -2.52 -2.74 -1.44 -3.62 -3.13 -2.19 -1.69 -2.09 -0.72 14.67 11.98 18.58 15.94 13.77 22.73 21.34 17.06 25.19 -3.88 -3.92 -1.87 -5.80 -5.06 -2.77 -2.23 -2.60 -0.90 MUFOLD−Server 56
57 3Dpro 14.44 11.80 12.80 30.07 24.88 28.11 12.30 10.95 10.45 -2.53 -2.50 -2.21 -1.37 -1.35 -1.13 -2.96 -2.83 -2.62 21.28 19.20 16.88 30.07 24.88 28.11 25.00 22.77 23.44 -2.46 -2.22 -2.19 -2.60 -2.59 -1.70 -1.59 -1.47 -1.17 3Dpro 57
58 fais−server 14.44 10.99 15.91 32.61 25.36 29.83 13.87 8.73 14.72 -2.53 -2.64 -1.69 -0.97 -1.27 -0.82 -2.72 -3.21 -1.97 27.13 23.53 28.36 38.41 31.28 38.15 28.53 26.61 30.83 -1.21 -1.20 -0.05 -0.72 -1.17 0.29 -0.98 -0.71 -0.05 fais−server 58
59 FOLDpro 14.21 12.92 13.73 16.67 14.61 18.03 23.04 20.77 19.44 -2.57 -2.31 -2.05 -3.51 -2.96 -2.96 -1.31 -1.15 -1.25 14.44 13.30 14.93 30.07 24.88 28.11 23.30 22.77 23.44 -3.93 -3.61 -2.55 -2.60 -2.59 -1.70 -1.89 -1.47 -1.17 FOLDpro 59
60 RBO−Proteus 10.18 9.27 23.56 18.48 17.63 31.34 17.28 15.71 27.36 -3.20 -2.93 -0.41 -3.22 -2.48 -0.54 -2.20 -2.02 -0.05 11.02 9.57 24.05 20.29 18.90 31.86 17.54 15.75 27.87 -4.67 -4.49 -0.85 -4.82 -3.92 -0.96 -2.90 -2.86 -0.50 RBO−Proteus 60
61 mariner1 8.89 6.36 10.32 20.29 14.25 23.87 9.29 8.33 8.77 -3.41 -3.42 -2.63 -2.93 -3.02 -1.90 -3.42 -3.28 -2.87 32.45 27.74 30.86 40.76 38.47 36.39 32.59 28.58 33.74 -0.07 -0.20 0.41 -0.18 0.42 -0.06 -0.27 -0.33 0.39 mariner1 61
62 LOOPP_Server 8.81 7.90 15.87 14.31 12.62 24.29 12.70 9.60 18.50 -3.42 -3.16 -1.70 -3.88 -3.27 -1.82 -2.90 -3.06 -1.39 31.61 25.84 26.88 27.36 21.80 31.26 39.79 31.50 36.78 -0.25 -0.65 -0.33 -3.22 -3.27 -1.08 0.99 0.25 0.86 LOOPP_Server 62
63 huber−torda−server 7.60 6.99 -0.57 12.14 9.96 4.95 10.86 9.86 3.62 -3.61 -3.32 -4.45 -4.23 -3.69 -5.34 -3.18 -3.02 -3.65 8.89 7.47 4.25 16.12 14.19 10.38 14.40 14.31 9.94 -5.12 -4.98 -4.53 -5.76 -4.96 -5.22 -3.45 -3.14 -3.22 huber−torda−server 63
64 RANDOM 7.60 6.73 7.60 14.36 12.20 14.36 13.39 11.76 13.39 -3.61 -3.36 -3.08 -3.88 -3.34 -3.63 -2.79 -2.69 -2.17 7.60 6.73 7.60 14.36 12.20 14.36 13.39 11.76 13.39 -5.40 -5.16 -3.91 -6.16 -5.40 -4.43 -3.62 -3.64 -2.69 RANDOM 64
65 schenk−torda−server 7.29 6.13 8.90 14.13 12.02 14.31 11.65 9.03 13.68 -3.66 -3.46 -2.86 -3.91 -3.37 -3.64 -3.06 -3.16 -2.13 7.29 6.13 9.48 14.31 12.62 17.67 11.65 9.03 13.68 -5.47 -5.30 -3.56 -6.17 -5.31 -3.78 -3.93 -4.18 -2.65 schenk−torda−server 65
66 OLGAFS 5.32 3.75 -18.02 0.00 0.00 -17.22 9.16 6.46 -10.93 -3.97 -3.87 -7.37 -6.16 -5.25 -9.36 -3.44 -3.60 -5.86 5.32 4.31 -18.02 0.00 0.00 -17.22 9.16 7.42 -10.93 -5.89 -5.73 -8.67 -9.41 -8.11 -10.70 -4.36 -4.50 -6.38 OLGAFS 66
67 Pushchino 0.00 0.00 -26.55 0.00 0.00 -17.22 0.00 0.00 -26.10 -4.81 -4.50 -8.80 -6.16 -5.25 -9.36 -4.85 -4.70 -8.17 0.00 0.00 -26.55 0.00 0.00 -17.22 0.00 0.00 -26.10 -7.03 -6.74 -10.26 -9.41 -8.11 -10.70 -5.96 -5.97 -8.69 Pushchino 67
68 BHAGEERATH                                                       -3.61 -3.36 -3.08 -3.88 -3.34 -3.63 -2.79 -2.69 -2.17                                                       -5.40 -5.16 -3.91 -6.16 -5.40 -4.43 -3.62 -3.64 -2.69 BHAGEERATH 68
69 BioSerf                                                       -3.61 -3.36 -3.08 -3.88 -3.34 -3.63 -2.79 -2.69 -2.17                                                       -5.40 -5.16 -3.91 -6.16 -5.40 -4.43 -3.62 -3.64 -2.69 BioSerf 69
70 MUFOLD−MD                                                       -3.61 -3.36 -3.08 -3.88 -3.34 -3.63 -2.79 -2.69 -2.17                                                       -5.40 -5.16 -3.91 -6.16 -5.40 -4.43 -3.62 -3.64 -2.69 MUFOLD−MD 70
71 YASARA                                                       -3.61 -3.36 -3.08 -3.88 -3.34 -3.63 -2.79 -2.69 -2.17                                                       -5.40 -5.16 -3.91 -6.16 -5.40 -4.43 -3.62 -3.64 -2.69 YASARA 71
72 mahmood−torda−server                                                       -3.61 -3.36 -3.08 -3.88 -3.34 -3.63 -2.79 -2.69 -2.17                                                       -5.40 -5.16 -3.91 -6.16 -5.40 -4.43 -3.62 -3.64 -2.69 mahmood−torda−server 72
73 rehtnap                                                       -3.61 -3.36 -3.08 -3.88 -3.34 -3.63 -2.79 -2.69 -2.17                                                       -1.52 -1.53 -3.91 -1.54 -1.09 -4.43 -0.68 -0.55 -2.69 rehtnap 73
74 test_http_server_01                                                       -3.61 -3.36 -3.08 -3.88 -3.34 -3.63 -2.79 -2.69 -2.17                                                       -5.40 -5.16 -3.91 -6.16 -5.40 -4.43 -3.62 -3.64 -2.69 test_http_server_01 74