T0401

X-ray Targets
387 388 389 390
391 392 393 394
395 396 397 398
399 400 401 402
403 404 405 406
407 408 409 410
411 412 413 414
415 416 417 418
419 420 421 422
423 424 425 426
427 428 429 430
431 432 433 434
435 436 438 439
440 441 442 443
444 445 446 447
448 449 450 451
452 453 454 455
456 457 458 459
461 463 465 470
477 478 479 481
483 485 486 487
488 489 490 491
493 494 495 496
497 501 502 503
504 505 506 507
508 509 510 511
512 513 514

T0401

putative glucan synthesis regulator of Smi1/Knr4 family (YP_211376.1) from Bacteroides fragilis

Target type: Human/Server

Target sequence:

>T0401 YP_211376.1, Bacteroides fragilis, 143 residues
MEVIESKWYKKDGASSASIDDVEKLLNTTLPKQYKSFLLWSNGGEGKLGDNYIYIWAIEDVIAYNHDYGIQKYLQKEYWAFGMDGDIGYILHLSDNSIYRVDLGDLDITSIKYIAPSFDDFLGKAIYLNFNKLQNVANNNLTT

Structure:
Method: X-ray, res=1.45Å, R/Rfree=0.16/0.18
Determined by: JCSG
PDB ID: 3d5p

3d5p_AB cartoon
Cartoon diagram of 401: 3d5p chains A (rainbow) and B (white)

PyMOL of 3d5p

Domains:  PyMOL of domains

Single domain protein. However, N-terminal segment is swapped with another chain. Resides 0-4 (PDB numbering) can be removed for domain evaluation.

401 domain evaluation plot
Correlation between GDT-TS scores for domain-based evlatuation (without 5 N-terminal residues, y, vertical axis) and whole chain GDT-TS (x, horizontal axis).

To compute the weighted sum, GDT-TS for each domain was multiplied by the domain length, and this sum was divided by the sum of domain lengths. Each point represents first server model. Green, gray and black points are top 10, bottom 25% and the rest of prediction models. Blue line is the best-fit slope line (intersection 0) to the top 10 server models. Red line is the diagonal. Slope and root mean square y-x distance for the top 10 models (average difference between the domain GDT-TS scores and the whole chain GDT-TS score) are shown above the plot.

Structure classification:

SMI1/KNR4-like fold.

3d5p_A cartoon
Cartoon diagram of 401: 3d5p chain A

CASP category:

Whole chain: Comparative modeling:hard.

1st domain (with N-terminal segment seq:1-4 removed): Comparative modeling:hard.

Closest templates:

2pag 2prv, 2icg.

Target sequence - PDB file inconsistencies:

T0401    3d5p.pdb    T0401.pdb    PyMOL    PyMOL of domains    

T0401    1 -MEVIESKWYKKDGASSASIDDVEKLLNTTLPKQYKSFLLWSNGGEGKLGDNYIYIWAIEDVIAYNHDYGIQKYLQKEYWAFGMDGDIGYILHLSDNSIYRVDLGDLDITSIKYIAPSFDDFLGKAIYLNFNKLQNVANNNLTT 143
           ~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||~~~~~~~~~~~
3d5pA    0 GMEVIESKWYKKDGASSASIDDVEKLLNTTLPKQYKSFLLWSNGGEGKLGDNYIYIWAIEDVIAYNHDYGIQKYLQKEYWAFGMDGDIGYILHLSDNSIYRVDLGDLDITSIKYIAPSFDDFLGKAIYLNFNK----------- 132

Residue change log: change 1, 83, MSE to MET; remove 0 G as it is not present in target sequence;

We suggest to evaluate this target as a single domain spanning whole chain. However, N-terminal segment is swapped with another chain. N-terminal segment (target 1-3, pdb 0-3) can be removed for domain evaluation, resulting in this domain definition:

1st domain: target 4-132 ; pdb 4-132

Sequence classification:

SMI1/KNR4 family (PF09346) in Pfam.

Server predictions:

T0401:pdb 1-132:seq 1-132:CM_hard;   alignment

distribution of first scores
First models for T0401: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

401_1:pdb 4-132:seq 4-132:CM_hard;   alignment

distribution of first scores
First models for T0401_1: Gaussian kernel density estimation for GDT-TS scores of the first server models, plotted at various bandwidths (=standard deviations). The GDT-TS scores are shown as a spectrum along the horizontal axis: each bar represents first server model. The bars are colored green, gray and black for top 10, bottom 25% and the rest of servers. The family of curves with varying bandwidth is shown. Bandwidth varies from 0.3 to 8.2 GDT-TS % units with a step of 0.1, which corresponds to the color ramp from magenta through blue to cyan. Thicker curves: red, yellow-framed brown and black, correspond to bandwidths 1, 2 and 4 respectively.

click on a score in the table below to display the model in PyMOL

# GROUP ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ TS ↓ TR ↓ CS ↓ ↓ GROUP #
T0401 401_1 T0401 401_1 T0401 401_1 T0401 401_1
First score First Z-score Best score Best Z-score
1 IBT_LT 64.77 57.32 67.73 66.28 58.66 68.04 0.94 1.13 1.86 0.96 1.14 1.88 64.77 57.32 67.73 66.28 58.66 68.04 0.84 1.00 1.56 0.85 1.02 1.57 IBT_LT 1
2 HHpred4 64.58 53.09 65.79 65.89 54.13 65.90 0.93 0.74 1.65 0.92 0.73 1.64 64.58 53.09 65.79 65.89 54.13 65.90 0.82 0.55 1.34 0.82 0.55 1.33 HHpred4 2
3 BAKER−ROBETTA 64.39 53.28 68.51 65.89 54.65 68.62 0.91 0.76 1.95 0.92 0.78 1.94 64.39 54.73 68.51 65.89 56.01 68.62 0.80 0.73 1.65 0.82 0.74 1.64 BAKER−ROBETTA 3
4 HHpred5 64.02 53.79 65.26 65.50 55.04 65.30 0.88 0.80 1.59 0.89 0.81 1.57 64.02 53.79 65.26 65.50 55.04 65.30 0.77 0.63 1.28 0.78 0.65 1.26 HHpred5 4
5 MULTICOM 63.26 55.43 61.30 64.53 56.52 61.63 0.82 0.96 1.15 0.82 0.95 1.16 64.58 56.82 69.66 65.89 57.95 70.03 0.82 0.95 1.78 0.82 0.94 1.80 MULTICOM 5
6 McGuffin 63.07 55.24 61.57 64.34 56.33 61.90 0.80 0.94 1.18 0.80 0.93 1.19 63.07 55.87 61.79 64.34 56.98 62.14 0.68 0.85 0.89 0.67 0.84 0.91 McGuffin 6
7 Zhang 62.88 56.06 59.37 63.95 56.98 59.72 0.79 1.01 0.93 0.77 0.99 0.95 63.45 56.50 61.00 64.73 57.49 61.34 0.71 0.91 0.80 0.71 0.90 0.82 Zhang 7
8 Zhang−Server 62.69 55.87 61.20 63.95 56.98 61.27 0.77 1.00 1.14 0.77 0.99 1.12 63.07 56.06 61.57 64.34 57.17 61.66 0.68 0.87 0.86 0.67 0.86 0.85 Zhang−Server 8
9 3DShotMQ 62.50 55.18 60.34 63.76 56.27 60.65 0.76 0.93 1.04 0.75 0.92 1.06 62.50 55.18 60.34 63.76 56.27 60.65 0.62 0.77 0.72 0.62 0.77 0.74 3DShotMQ 9
10 Ozkan−Shell 62.50 54.92 59.48 63.37 56.27 59.79 0.76 0.91 0.95 0.72 0.92 0.96 62.50 55.30 60.17 63.37 56.59 60.43 0.62 0.79 0.71 0.59 0.80 0.71 Ozkan−Shell 10
11 MULTICOM−CMFR 62.50 52.78 63.96 63.76 53.94 64.06 0.76 0.71 1.44 0.75 0.71 1.44 63.45 53.73 64.45 64.73 54.78 64.52 0.71 0.62 1.19 0.71 0.62 1.18 MULTICOM−CMFR 11
12 PRI−Yang−KiharA 62.50 52.40 58.52 63.76 53.42 58.83 0.76 0.67 0.84 0.75 0.67 0.85 62.50 52.40 58.52 63.76 53.42 58.83 0.62 0.48 0.52 0.62 0.48 0.53 PRI−Yang−KiharA 12
13 Zico 62.31 55.62 60.96 63.57 56.72 61.28 0.74 0.97 1.11 0.74 0.97 1.13 62.88 56.31 61.66 64.15 57.43 62.00 0.66 0.89 0.87 0.66 0.89 0.89 Zico 13
14 ZicoFullSTP 62.31 55.62 60.96 63.57 56.72 61.28 0.74 0.97 1.11 0.74 0.97 1.13 62.88 56.31 61.66 64.15 57.43 62.00 0.66 0.89 0.87 0.66 0.89 0.89 ZicoFullSTP 14
15 ZicoFullSTPFullData 62.31 55.62 60.96 63.57 56.72 61.28 0.74 0.97 1.11 0.74 0.97 1.13 62.88 56.31 61.66 64.15 57.43 62.00 0.66 0.89 0.87 0.66 0.89 0.89 ZicoFullSTPFullData 15
16 LevittGroup 62.31 52.08 60.35 63.37 54.97 60.80 0.74 0.64 1.04 0.72 0.81 1.07 62.50 55.81 60.83 63.76 56.91 61.19 0.62 0.84 0.78 0.62 0.84 0.80 LevittGroup 16
17 MidwayFolding 62.12 54.92 59.84 63.57 56.20 60.16 0.73 0.91 0.99 0.74 0.92 1.00 62.12 54.92 59.84 63.57 56.20 60.16 0.59 0.75 0.67 0.60 0.76 0.68 MidwayFolding 17
18 COMA−M 61.93 51.45 56.51 63.37 52.00 56.52 0.71 0.59 0.62 0.72 0.54 0.60 63.07 55.49 58.94 64.53 56.78 59.00 0.68 0.81 0.57 0.69 0.82 0.55 COMA−M 18
19 CBSU 61.74 52.08 62.28 63.18 53.30 62.56 0.69 0.64 1.26 0.71 0.66 1.27 64.20 55.30 65.27 65.50 56.40 65.62 0.78 0.79 1.28 0.78 0.78 1.30 CBSU 19
20 nFOLD3 61.36 55.68 56.12 62.60 56.78 56.24 0.66 0.98 0.57 0.66 0.97 0.57 61.36 55.68 57.37 62.60 56.78 57.29 0.52 0.83 0.39 0.52 0.82 0.36 nFOLD3 20
21 Sternberg 61.36 52.02 59.90 62.60 53.04 60.25 0.66 0.64 0.99 0.66 0.63 1.01 62.12 54.55 61.33 63.37 55.62 61.70 0.59 0.71 0.84 0.59 0.70 0.86 Sternberg 21
22 Phyre_de_novo 61.36 52.02 59.90 62.60 53.04 60.00 0.66 0.64 0.99 0.66 0.63 0.98 62.12 54.55 61.33 63.37 55.62 61.46 0.59 0.71 0.84 0.59 0.70 0.83 Phyre_de_novo 22
23 mGenTHREADER 61.17 50.32 61.81 62.40 51.29 61.84 0.65 0.48 1.20 0.65 0.47 1.19 61.17 50.32 61.81 62.40 51.29 61.84 0.50 0.26 0.89 0.50 0.26 0.87 mGenTHREADER 23
24 FFASsuboptimal 60.98 53.41 60.21 62.02 54.26 60.24 0.63 0.77 1.03 0.62 0.74 1.01 60.98 53.41 60.21 62.02 54.26 60.24 0.48 0.59 0.71 0.46 0.56 0.69 FFASsuboptimal 24
25 MUSTER 60.80 53.47 55.37 62.02 54.52 55.47 0.62 0.77 0.49 0.62 0.77 0.48 60.80 53.47 57.13 62.02 54.52 57.20 0.47 0.59 0.36 0.46 0.59 0.35 MUSTER 25
26 SAM−T08−server 60.80 51.83 60.69 62.21 53.04 60.78 0.62 0.62 1.08 0.63 0.63 1.07 60.80 51.83 60.69 62.21 53.04 60.78 0.47 0.42 0.76 0.48 0.44 0.75 SAM−T08−server 26
27 GS−KudlatyPred 60.61 52.15 58.54 61.82 53.16 58.49 0.60 0.65 0.84 0.60 0.64 0.82 60.61 52.15 58.54 61.82 53.16 58.49 0.45 0.46 0.52 0.44 0.45 0.49 GS−KudlatyPred 27
28 SAM−T08−human 60.42 50.32 58.06 61.43 51.10 58.41 0.59 0.48 0.79 0.57 0.46 0.81 61.93 53.66 61.01 63.18 54.52 61.34 0.57 0.61 0.80 0.57 0.59 0.82 SAM−T08−human 28
29 panther_server 60.23 52.78 53.15 61.63 54.01 53.11 0.57 0.71 0.24 0.58 0.72 0.22 60.23 52.78 53.15 61.63 54.01 53.11 0.41 0.52 -0.09 0.43 0.54 -0.12 panther_server 29
30 AMU−Biology 60.23 52.15 57.77 61.63 53.36 58.13 0.57 0.65 0.76 0.58 0.66 0.78 60.61 52.27 58.14 62.02 53.49 58.49 0.45 0.47 0.48 0.46 0.49 0.49 AMU−Biology 30
31 GS−MetaServer2 60.23 52.02 58.85 61.43 53.04 58.76 0.57 0.64 0.88 0.57 0.63 0.85 60.23 52.02 58.85 61.43 53.04 58.76 0.41 0.44 0.56 0.41 0.44 0.52 GS−MetaServer2 31
32 fleil 60.23 51.01 53.75 61.43 52.00 54.10 0.57 0.55 0.31 0.57 0.54 0.33 60.23 51.01 53.75 61.43 52.00 54.10 0.41 0.34 -0.02 0.41 0.33 -0.00 fleil 32
33 Frankenstein 60.04 52.08 55.21 61.24 53.10 55.27 0.56 0.64 0.47 0.55 0.64 0.46 60.04 52.08 55.21 61.24 53.10 55.27 0.39 0.45 0.15 0.39 0.45 0.13 Frankenstein 33
34 COMA 59.85 51.77 56.45 61.24 52.97 56.53 0.54 0.62 0.61 0.55 0.63 0.60 59.85 52.59 58.94 61.24 53.42 59.00 0.38 0.50 0.57 0.39 0.48 0.55 COMA 34
35 PS2−server 59.85 48.93 61.42 61.05 50.06 61.57 0.54 0.35 1.16 0.54 0.36 1.16 59.85 48.93 61.42 61.05 50.06 61.57 0.38 0.12 0.85 0.37 0.13 0.84 PS2−server 35
36 PS2−manual 59.85 48.93 61.42 61.05 50.06 61.80 0.54 0.35 1.16 0.54 0.36 1.18 59.85 48.93 61.42 61.05 50.06 61.80 0.38 0.12 0.85 0.37 0.13 0.87 PS2−manual 36
37 GeneSilico 59.47 51.01 60.18 60.66 52.00 60.52 0.51 0.55 1.02 0.51 0.54 1.04 60.42 53.22 60.18 61.43 53.30 60.52 0.43 0.57 0.71 0.41 0.47 0.72 GeneSilico 37
38 FAMS−multi 59.47 50.13 51.29 60.66 51.10 51.59 0.51 0.46 0.04 0.51 0.46 0.05 59.47 50.82 51.96 60.66 51.42 52.27 0.34 0.32 -0.22 0.34 0.27 -0.21 FAMS−multi 38
39 Hao_Kihara 59.47 48.86 55.83 60.85 48.71 56.14 0.51 0.35 0.54 0.52 0.24 0.55 59.47 51.83 55.83 60.85 52.84 56.14 0.34 0.42 0.22 0.36 0.42 0.23 Hao_Kihara 39
40 METATASSER 59.28 53.09 55.60 60.27 53.94 55.55 0.49 0.74 0.52 0.48 0.71 0.49 60.42 53.22 55.60 61.63 54.39 55.55 0.43 0.57 0.19 0.43 0.58 0.16 METATASSER 40
41 circle 59.28 51.83 54.99 60.66 53.04 54.98 0.49 0.62 0.45 0.51 0.63 0.43 60.42 52.08 57.35 61.43 53.04 57.26 0.43 0.45 0.39 0.41 0.44 0.35 circle 41
42 RAPTOR 59.09 52.27 53.76 60.47 53.49 53.90 0.48 0.66 0.31 0.49 0.67 0.31 59.09 52.27 53.76 60.47 53.49 53.90 0.31 0.47 -0.02 0.32 0.49 -0.03 RAPTOR 42
43 3DShot1 59.09 52.15 52.76 60.27 53.16 53.07 0.48 0.65 0.20 0.48 0.64 0.21 59.09 52.15 52.76 60.27 53.16 53.07 0.31 0.46 -0.13 0.30 0.45 -0.12 3DShot1 43
44 3DShot2 59.09 50.25 52.44 60.27 51.23 52.48 0.48 0.47 0.17 0.48 0.47 0.15 59.09 50.25 52.44 60.27 51.23 52.48 0.31 0.26 -0.17 0.30 0.25 -0.19 3DShot2 44
45 GeneSilicoMetaServer 59.09 50.00 51.68 60.08 50.77 51.75 0.48 0.45 0.08 0.46 0.43 0.07 60.23 52.02 58.85 61.43 53.04 58.76 0.41 0.44 0.56 0.41 0.44 0.52 GeneSilicoMetaServer 45
46 MUProt 59.09 49.62 51.96 60.27 50.58 52.04 0.48 0.42 0.11 0.48 0.41 0.10 63.64 53.28 64.36 64.92 54.33 64.49 0.73 0.57 1.18 0.73 0.57 1.17 MUProt 46
47 Elofsson 59.09 47.85 52.05 60.27 48.77 52.41 0.48 0.25 0.12 0.48 0.25 0.14 59.28 51.14 52.54 60.47 52.13 52.91 0.32 0.35 -0.15 0.32 0.35 -0.14 Elofsson 47
48 FAMSD 58.90 52.21 54.58 60.08 53.23 54.57 0.46 0.66 0.40 0.46 0.65 0.38 58.90 52.21 55.08 60.08 53.23 55.07 0.29 0.46 0.13 0.29 0.46 0.11 FAMSD 48
49 MULTICOM−REFINE 58.90 51.20 52.19 60.08 52.20 52.27 0.46 0.56 0.14 0.46 0.56 0.12 63.07 52.34 63.67 64.34 53.36 63.77 0.68 0.47 1.10 0.67 0.47 1.09 MULTICOM−REFINE 49
50 FUGUE_KM 58.90 51.20 51.84 60.08 52.20 51.85 0.46 0.56 0.10 0.46 0.56 0.08 58.90 51.20 51.84 60.08 52.20 51.85 0.29 0.36 -0.23 0.29 0.35 -0.26 FUGUE_KM 50
51 MULTICOM−RANK 58.90 50.69 52.77 60.08 51.68 52.82 0.46 0.52 0.20 0.46 0.51 0.19 64.02 53.03 64.67 65.31 54.07 64.78 0.77 0.55 1.21 0.76 0.55 1.21 MULTICOM−RANK 51
52 MULTICOM−CLUSTER 58.90 50.69 52.77 60.08 51.68 52.82 0.46 0.52 0.20 0.46 0.51 0.19 58.90 50.69 52.77 60.08 51.68 52.82 0.29 0.30 -0.13 0.29 0.30 -0.15 MULTICOM−CLUSTER 52
53 pipe_int 58.71 49.75 51.96 60.08 50.90 51.88 0.45 0.43 0.11 0.46 0.44 0.08 58.71 49.75 54.46 60.08 50.90 54.48 0.27 0.20 0.06 0.29 0.22 0.04 pipe_int 53
54 Pcons_dot_net 58.71 49.75 52.21 59.88 50.71 52.28 0.45 0.43 0.14 0.44 0.42 0.13 61.17 54.61 58.37 62.40 55.69 58.50 0.50 0.71 0.50 0.50 0.71 0.49 Pcons_dot_net 54
55 Pcons_multi 58.71 49.75 52.21 59.88 50.71 52.28 0.45 0.43 0.14 0.44 0.42 0.13 59.09 49.87 57.95 60.27 50.97 58.10 0.31 0.22 0.46 0.30 0.23 0.45 Pcons_multi 55
56 keasar−server 58.71 46.97 53.48 59.88 48.00 53.51 0.45 0.17 0.28 0.44 0.18 0.26 61.36 47.35 59.07 62.60 48.00 59.10 0.52 -0.05 0.58 0.52 -0.08 0.56 keasar−server 56
57 FFASflextemplate 58.52 50.69 52.27 59.69 51.68 52.24 0.43 0.52 0.15 0.43 0.51 0.12 58.71 50.88 52.73 59.88 51.87 52.81 0.27 0.32 -0.13 0.27 0.32 -0.15 FFASflextemplate 57
58 HHpred2 58.52 50.44 51.91 59.88 51.62 51.98 0.43 0.49 0.11 0.44 0.50 0.09 58.52 50.44 51.91 59.88 51.62 51.98 0.25 0.28 -0.23 0.27 0.29 -0.24 HHpred2 58
59 taylor 58.33 51.77 50.13 59.69 52.97 50.93 0.42 0.62 -0.09 0.43 0.63 -0.02 58.33 51.77 50.13 59.69 52.97 50.93 0.23 0.42 -0.43 0.25 0.43 -0.36 taylor 59
60 LEE−SERVER 58.33 49.62 60.31 59.50 50.58 60.41 0.42 0.42 1.04 0.41 0.41 1.03 60.42 49.62 60.69 61.63 50.58 60.75 0.43 0.19 0.76 0.43 0.19 0.75 LEE−SERVER 60
61 pro−sp3−TASSER 58.33 49.37 50.12 59.50 50.32 50.16 0.42 0.39 -0.09 0.41 0.39 -0.11 60.42 55.37 53.07 61.63 56.46 53.17 0.43 0.79 -0.09 0.43 0.79 -0.11 pro−sp3−TASSER 61
62 mti 58.14 49.43 55.76 59.30 50.39 55.98 0.40 0.40 0.53 0.40 0.39 0.54 60.04 49.43 55.96 60.85 50.39 56.27 0.39 0.17 0.23 0.36 0.17 0.24 mti 62
63 fams−ace2 58.14 47.66 52.02 59.30 48.58 52.34 0.40 0.23 0.12 0.40 0.23 0.13 58.71 50.25 52.47 59.88 51.42 52.77 0.27 0.26 -0.16 0.27 0.27 -0.15 fams−ace2 63
64 DBAKER 58.14 46.09 51.59 59.30 46.70 51.92 0.40 0.09 0.07 0.40 0.06 0.09 63.26 56.69 55.97 64.73 58.01 56.14 0.69 0.93 0.23 0.71 0.95 0.23 DBAKER 64
65 FEIG 57.95 50.38 52.95 59.11 51.36 53.01 0.38 0.49 0.22 0.38 0.48 0.21 59.85 52.52 52.95 61.05 53.55 53.01 0.38 0.49 -0.11 0.37 0.49 -0.13 FEIG 65
66 Jiang_Zhu 57.95 48.48 48.89 59.11 49.42 49.16 0.38 0.31 -0.23 0.38 0.30 -0.22 59.09 52.15 50.43 60.27 53.16 50.81 0.31 0.46 -0.39 0.30 0.45 -0.38 Jiang_Zhu 66
67 LEE 57.95 48.11 58.68 59.11 49.03 59.01 0.38 0.28 0.86 0.38 0.27 0.87 59.66 50.95 59.99 61.05 52.13 60.34 0.36 0.33 0.69 0.37 0.35 0.70 LEE 67
68 TASSER 57.77 50.06 52.26 58.91 51.03 52.68 0.37 0.46 0.15 0.37 0.45 0.17 60.61 54.55 55.78 61.82 55.62 56.17 0.45 0.71 0.21 0.44 0.70 0.23 TASSER 68
69 SAM−T06−server 57.77 49.31 54.39 59.11 50.45 54.50 0.37 0.39 0.38 0.38 0.40 0.37 57.77 49.31 54.39 59.11 50.45 54.50 0.18 0.16 0.05 0.20 0.17 0.04 SAM−T06−server 69
70 SMEG−CCP 57.58 50.76 49.16 58.53 51.68 49.54 0.35 0.52 -0.20 0.34 0.51 -0.18 57.58 50.76 49.16 58.53 51.68 49.54 0.16 0.31 -0.54 0.14 0.30 -0.52 SMEG−CCP 70
71 Jones−UCL 57.58 49.62 52.61 58.91 50.77 52.92 0.35 0.42 0.19 0.37 0.43 0.20 57.58 49.62 52.61 58.91 50.77 52.92 0.16 0.19 -0.15 0.18 0.21 -0.14 Jones−UCL 71
72 FFASstandard 57.58 48.99 52.73 58.72 49.94 52.81 0.35 0.36 0.20 0.35 0.35 0.18 59.09 50.63 53.90 60.27 51.62 53.93 0.31 0.30 -0.00 0.30 0.29 -0.02 FFASstandard 72
73 3D−JIGSAW_V3 57.01 47.92 45.48 58.33 49.03 45.46 0.31 0.26 -0.61 0.32 0.27 -0.63 57.20 49.62 46.09 58.53 50.77 46.17 0.13 0.19 -0.88 0.14 0.21 -0.90 3D−JIGSAW_V3 73
74 3D−JIGSAW_AEP 57.01 47.92 46.11 58.14 48.84 46.16 0.31 0.26 -0.54 0.30 0.25 -0.56 57.01 47.98 46.11 58.14 49.10 46.16 0.11 0.02 -0.88 0.11 0.03 -0.90 3D−JIGSAW_AEP 74
75 A−TASSER 56.44 46.84 49.70 57.56 47.74 50.03 0.26 0.16 -0.14 0.26 0.15 -0.13 57.77 49.12 51.38 58.91 50.06 51.62 0.18 0.14 -0.29 0.18 0.13 -0.28 A−TASSER 75
76 3Dpro 56.25 46.65 49.71 57.36 47.55 49.78 0.25 0.14 -0.14 0.24 0.13 -0.15 56.25 46.65 49.71 57.36 47.55 49.78 0.04 -0.12 -0.47 0.04 -0.12 -0.49 3Dpro 76
77 CpHModels 56.06 45.64 53.01 57.36 46.70 53.52 0.23 0.05 0.23 0.24 0.06 0.26 56.06 45.64 53.01 57.36 46.70 53.52 0.02 -0.23 -0.10 0.04 -0.21 -0.07 CpHModels 77
78 Bilab−UT 55.68 48.48 47.58 56.98 49.61 47.86 0.20 0.31 -0.37 0.21 0.32 -0.37 58.71 50.63 52.15 59.88 51.62 52.50 0.27 0.30 -0.20 0.27 0.29 -0.18 Bilab−UT 78
79 fais−server 55.49 46.02 44.70 56.59 46.90 44.56 0.18 0.08 -0.69 0.18 0.08 -0.73 55.49 46.02 48.12 56.59 46.90 48.16 -0.03 -0.19 -0.65 -0.03 -0.19 -0.68 fais−server 79
80 FALCON_CONSENSUS 55.30 48.48 55.46 56.59 49.61 55.57 0.17 0.31 0.50 0.18 0.32 0.49 62.31 53.35 61.79 63.37 54.20 61.91 0.61 0.58 0.89 0.59 0.56 0.88 FALCON_CONSENSUS 80
81 FALCON 55.30 48.48 55.46 56.59 49.61 55.57 0.17 0.31 0.50 0.18 0.32 0.49 62.31 53.35 61.79 63.37 54.20 61.91 0.61 0.58 0.89 0.59 0.56 0.88 FALCON 81
82 PSI 54.92 44.07 45.58 56.20 45.09 45.54 0.14 -0.10 -0.59 0.15 -0.09 -0.62 54.92 44.07 45.58 56.20 45.09 45.54 -0.08 -0.39 -0.94 -0.07 -0.38 -0.97 PSI 82
83 Chicken_George 54.36 44.26 58.65 55.62 45.28 58.99 0.09 -0.08 0.85 0.10 -0.07 0.87 63.64 54.29 69.79 64.92 55.36 70.09 0.73 0.68 1.79 0.73 0.68 1.81 Chicken_George 83
84 Pcons_local 53.98 46.53 44.12 55.23 47.61 44.61 0.06 0.13 -0.76 0.07 0.14 -0.73 55.68 46.53 47.79 56.98 47.61 48.28 -0.01 -0.13 -0.69 0.00 -0.12 -0.66 Pcons_local 84
85 LOOPP_Server 53.60 45.14 49.72 54.84 46.19 50.22 0.03 -0.00 -0.14 0.04 0.01 -0.10 53.60 45.14 49.72 54.84 46.19 50.22 -0.21 -0.28 -0.47 -0.19 -0.26 -0.44 LOOPP_Server 85
86 Kolinski 53.60 36.68 49.81 54.46 37.15 50.15 0.03 -0.79 -0.13 0.01 -0.81 -0.11 56.06 48.36 50.48 57.17 49.29 50.86 0.02 0.06 -0.39 0.02 0.05 -0.37 Kolinski 86
87 Poing 53.22 41.60 42.90 53.68 42.57 42.97 -0.00 -0.33 -0.89 -0.05 -0.32 -0.91 61.74 53.28 60.70 62.40 53.42 60.82 0.55 0.57 0.77 0.50 0.48 0.76 Poing 87
88 Phragment 52.84 43.69 42.37 53.88 44.96 42.47 -0.03 -0.14 -0.95 -0.04 -0.10 -0.97 61.36 51.64 59.87 62.40 52.45 59.99 0.52 0.40 0.67 0.50 0.38 0.66 Phragment 88
89 ACOMPMOD 52.84 42.11 50.20 53.88 42.89 50.25 -0.03 -0.28 -0.08 -0.04 -0.29 -0.10 52.84 42.11 50.20 53.88 42.89 50.25 -0.28 -0.60 -0.42 -0.28 -0.60 -0.44 ACOMPMOD 89
90 Phyre2 52.27 45.45 42.40 53.49 46.51 42.45 -0.08 0.03 -0.95 -0.07 0.04 -0.97 60.98 53.66 59.82 62.40 54.52 59.97 0.48 0.61 0.67 0.50 0.59 0.66 Phyre2 90
91 FrankensteinLong 51.89 44.19 45.56 53.10 45.22 45.95 -0.11 -0.09 -0.60 -0.10 -0.08 -0.58 52.65 44.19 47.75 53.88 45.22 48.11 -0.29 -0.38 -0.69 -0.28 -0.36 -0.68 FrankensteinLong 91
92 SAM−T02−server 51.70 43.24 43.30 52.91 44.25 43.78 -0.13 -0.18 -0.85 -0.11 -0.16 -0.82 51.70 43.24 43.30 52.91 44.25 43.78 -0.38 -0.48 -1.20 -0.37 -0.46 -1.17 SAM−T02−server 92
93 rehtnap 51.52 42.55 43.09 52.71 43.54 43.56 -0.14 -0.24 -0.87 -0.13 -0.23 -0.84 55.68 46.47 43.84 56.98 47.55 44.32 -0.01 -0.14 -1.14 0.00 -0.12 -1.11 rehtnap 93
94 Zhou−SPARKS 51.52 42.30 49.67 52.52 43.09 49.92 -0.14 -0.26 -0.14 -0.15 -0.27 -0.14 51.52 42.30 49.67 52.52 43.09 49.92 -0.40 -0.58 -0.48 -0.41 -0.58 -0.48 Zhou−SPARKS 94
95 ABIpro 50.95 44.63 47.48 52.13 45.67 47.68 -0.19 -0.05 -0.38 -0.18 -0.04 -0.39 51.33 44.63 47.48 52.71 45.67 47.68 -0.42 -0.33 -0.72 -0.39 -0.32 -0.73 ABIpro 95
96 fais@hgc 50.95 42.23 47.84 52.13 43.35 48.22 -0.19 -0.27 -0.34 -0.18 -0.25 -0.33 64.20 56.06 67.12 65.70 57.17 67.44 0.78 0.87 1.49 0.80 0.86 1.51 fais@hgc 96
97 tripos_08 48.67 36.17 46.86 49.61 36.82 47.27 -0.37 -0.83 -0.45 -0.38 -0.84 -0.43 48.67 36.17 46.86 49.61 36.82 47.27 -0.67 -1.22 -0.79 -0.67 -1.23 -0.78 tripos_08 97
98 Bates_BMM 47.35 38.64 39.70 48.45 39.53 40.17 -0.48 -0.61 -1.25 -0.47 -0.59 -1.22 47.35 38.64 39.70 48.45 39.53 40.17 -0.79 -0.96 -1.60 -0.78 -0.95 -1.58 Bates_BMM 98
99 EB_AMU_Physics 47.16 39.33 40.95 48.06 41.21 41.31 -0.50 -0.54 -1.11 -0.50 -0.44 -1.09 47.16 39.33 40.95 48.06 41.21 41.31 -0.81 -0.89 -1.46 -0.81 -0.78 -1.45 EB_AMU_Physics 99
100 xianmingpan 46.97 36.49 36.93 47.29 36.82 37.19 -0.51 -0.81 -1.55 -0.56 -0.84 -1.55 46.97 36.49 36.93 47.29 36.82 37.19 -0.82 -1.19 -1.91 -0.88 -1.23 -1.92 xianmingpan 100
101 SHORTLE 46.40 34.91 38.80 47.48 35.72 39.64 -0.56 -0.95 -1.35 -0.55 -0.94 -1.28 46.40 34.91 41.85 47.48 35.72 42.68 -0.88 -1.35 -1.36 -0.87 -1.34 -1.30 SHORTLE 101
102 StruPPi 44.89 36.43 42.97 45.74 37.08 43.37 -0.68 -0.81 -0.88 -0.69 -0.81 -0.87 44.89 36.43 42.97 45.74 37.08 43.37 -1.02 -1.19 -1.23 -1.03 -1.20 -1.22 StruPPi 102
103 FOLDpro 43.18 37.50 39.57 44.19 38.37 39.60 -0.82 -0.71 -1.26 -0.81 -0.70 -1.28 56.25 46.65 49.71 57.36 47.55 49.78 0.04 -0.12 -0.47 0.04 -0.12 -0.49 FOLDpro 103
104 Softberry 39.20 35.29 43.16 40.12 36.11 43.48 -1.15 -0.92 -0.86 -1.14 -0.90 -0.85 39.20 35.29 43.16 40.12 36.11 43.48 -1.55 -1.31 -1.21 -1.54 -1.30 -1.21 Softberry 104
105 TJ_Jiang 37.12 28.79 44.68 37.98 29.46 45.12 -1.32 -1.52 -0.69 -1.31 -1.50 -0.67 55.68 46.09 49.30 56.78 46.96 49.71 -0.01 -0.18 -0.52 -0.02 -0.19 -0.50 TJ_Jiang 105
106 keasar 26.52 22.48 42.32 27.13 23.00 42.60 -2.19 -2.11 -0.96 -2.18 -2.09 -0.95 53.03 40.91 48.30 53.88 41.47 48.72 -0.26 -0.72 -0.63 -0.28 -0.75 -0.61 keasar 106
107 POEM 26.33 23.30 40.28 26.94 23.84 40.60 -2.20 -2.03 -1.18 -2.19 -2.01 -1.17 26.33 23.30 67.27 26.94 23.84 67.56 -2.75 -2.57 1.51 -2.74 -2.56 1.52 POEM 107
108 POEMQA 26.14 21.97 42.40 26.74 22.48 42.81 -2.22 -2.16 -0.95 -2.21 -2.14 -0.93 64.39 54.73 67.27 66.08 55.81 67.56 0.80 0.73 1.51 0.83 0.72 1.52 POEMQA 108
109 SAINT1 26.14 21.84 43.36 26.55 22.29 43.58 -2.22 -2.17 -0.84 -2.22 -2.15 -0.84 26.14 21.84 43.36 26.55 22.29 43.58 -2.77 -2.73 -1.19 -2.78 -2.72 -1.20 SAINT1 109
110 RBO−Proteus 25.76 24.37 43.16 26.36 24.93 43.05 -2.25 -1.93 -0.86 -2.24 -1.91 -0.90 30.11 26.58 43.48 31.01 27.39 43.55 -2.40 -2.23 -1.18 -2.37 -2.20 -1.20 RBO−Proteus 110
111 JIVE08 24.24 21.09 29.44 24.61 20.22 29.83 -2.37 -2.24 -2.38 -2.38 -2.34 -2.37 32.58 29.55 38.17 33.33 30.23 38.62 -2.17 -1.92 -1.77 -2.16 -1.91 -1.76 JIVE08 111
112 Sasaki−Cetin−Sasai 22.73 20.96 34.19 23.26 21.45 34.54 -2.50 -2.25 -1.86 -2.49 -2.23 -1.85 23.86 21.72 39.16 24.42 22.22 39.63 -2.98 -2.74 -1.66 -2.97 -2.73 -1.64 Sasaki−Cetin−Sasai 112
113 Distill 22.54 17.55 34.43 23.06 17.96 34.37 -2.51 -2.57 -1.83 -2.50 -2.54 -1.87 22.92 20.39 34.74 23.06 20.09 34.64 -3.07 -2.88 -2.16 -3.10 -2.95 -2.21 Distill 113
114 Wolynes 22.16 19.19 27.01 22.87 19.25 27.54 -2.54 -2.41 -2.65 -2.52 -2.43 -2.63 22.16 19.19 27.01 22.87 19.25 27.54 -3.14 -3.00 -3.03 -3.12 -3.03 -3.01 Wolynes 114
115 DistillSN 21.40 18.12 25.52 21.51 18.15 25.98 -2.61 -2.51 -2.82 -2.63 -2.53 -2.80 21.40 18.12 25.52 21.51 18.15 25.98 -3.21 -3.12 -3.20 -3.24 -3.15 -3.19 DistillSN 115
116 DelCLab 19.13 15.47 17.19 18.99 13.11 17.66 -2.79 -2.76 -3.74 -2.83 -2.98 -3.72 51.89 46.21 47.18 53.30 47.48 47.51 -0.37 -0.17 -0.76 -0.33 -0.13 -0.75 DelCLab 116
117 BioSerf 19.13 14.96 36.23 19.57 15.31 36.28 -2.79 -2.81 -1.63 -2.78 -2.78 -1.65 19.13 14.96 36.23 19.57 15.31 36.28 -3.42 -3.45 -1.99 -3.42 -3.44 -2.02 BioSerf 117
118 FLOUDAS 18.75 15.66 29.93 18.80 15.63 30.24 -2.82 -2.74 -2.33 -2.85 -2.76 -2.33 43.18 34.85 41.33 44.19 35.66 41.73 -1.18 -1.36 -1.42 -1.17 -1.35 -1.40 FLOUDAS 118
119 Scheraga 17.99 14.21 25.65 18.41 14.54 25.97 -2.88 -2.88 -2.80 -2.88 -2.85 -2.80 19.32 16.98 25.91 19.77 17.38 26.39 -3.40 -3.23 -3.16 -3.40 -3.23 -3.14 Scheraga 119
120 ProtAnG 16.48 15.34 23.36 16.86 15.70 23.71 -3.01 -2.77 -3.06 -3.00 -2.75 -3.05 16.48 15.34 23.36 16.86 15.70 23.71 -3.67 -3.41 -3.44 -3.66 -3.40 -3.45 ProtAnG 120
121 forecast 15.91 13.89 26.21 15.70 13.63 26.17 -3.05 -2.91 -2.74 -3.09 -2.94 -2.78 18.56 14.27 26.26 18.99 14.60 26.17 -3.47 -3.52 -3.12 -3.47 -3.51 -3.17 forecast 121
122 mahmood−torda−server 15.72 13.83 22.21 16.28 13.82 22.00 -3.07 -2.91 -3.18 -3.05 -2.92 -3.24 15.72 13.83 24.54 16.28 13.82 24.38 -3.74 -3.57 -3.31 -3.72 -3.59 -3.37 mahmood−torda−server 122
123 RANDOM 15.32 12.46 15.32 15.75 13.12 15.75 -3.10 -3.04 -3.95 -3.09 -2.98 -3.94 15.32 12.46 15.32 15.75 13.12 15.75 -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 RANDOM 123
124 MUFOLD−Server 14.96 12.88 22.14 15.31 13.18 21.93 -3.13 -3.00 -3.19 -3.12 -2.98 -3.25 14.96 12.88 22.14 15.31 13.18 21.93 -3.81 -3.67 -3.58 -3.81 -3.66 -3.65 MUFOLD−Server 124
125 MeilerLabRene 14.21 11.43 23.06 14.54 11.69 23.41 -3.19 -3.14 -3.09 -3.19 -3.11 -3.09 18.56 16.79 23.06 18.99 17.18 23.41 -3.47 -3.25 -3.48 -3.47 -3.25 -3.48 MeilerLabRene 125
126 SAMUDRALA 13.64 12.69 24.59 13.95 12.98 25.04 -3.24 -3.02 -2.92 -3.23 -3.00 -2.90 14.96 14.21 26.34 15.31 14.54 26.66 -3.81 -3.53 -3.11 -3.81 -3.52 -3.11 SAMUDRALA 126
127 mariner1 13.64 10.10 10.10 13.95 10.34 10.48 -3.24 -3.26 -4.53 -3.23 -3.23 -4.52 17.80 14.46 26.06 18.22 14.79 26.49 -3.54 -3.50 -3.14 -3.54 -3.49 -3.13 mariner1 127
128 Pushchino 13.45 10.16 7.09 13.76 10.40 7.47 -3.26 -3.25 -4.86 -3.25 -3.23 -4.86 13.45 10.16 7.09 13.76 10.40 7.47 -3.95 -3.95 -5.28 -3.95 -3.94 -5.28 Pushchino 128
129 psiphifoldings 13.26 12.18 15.26 13.57 12.47 15.57 -3.27 -3.07 -3.95 -3.26 -3.04 -3.96 13.26 12.18 15.26 13.57 12.47 15.57 -3.97 -3.74 -4.36 -3.97 -3.73 -4.37 psiphifoldings 129
130 schenk−torda−server 13.26 11.68 14.24 13.57 11.95 14.25 -3.27 -3.11 -4.07 -3.26 -3.09 -4.10 13.64 11.74 17.30 14.15 12.66 17.29 -3.93 -3.78 -4.13 -3.91 -3.71 -4.17 schenk−torda−server 130
131 TWPPLAB 12.50 10.73 13.68 12.98 11.18 14.04 -3.33 -3.20 -4.13 -3.31 -3.16 -4.13 12.50 10.73 13.68 12.98 11.18 14.04 -4.04 -3.89 -4.53 -4.02 -3.86 -4.54 TWPPLAB 131
132 OLGAFS 11.55 9.91 4.90 12.02 9.56 4.82 -3.41 -3.28 -5.10 -3.39 -3.31 -5.15 13.07 11.99 10.31 13.37 12.27 10.26 -3.99 -3.76 -4.91 -3.98 -3.75 -4.97 OLGAFS 132
133 MUFOLD−MD 0.00 0.00 12.25 0.00 0.00 12.13 -4.36 -4.20 -4.29 -4.35 -4.17 -4.34 3.22 2.84 12.25 4.07 3.62 12.13 -4.90 -4.72 -4.70 -4.83 -4.64 -4.76 MUFOLD−MD 133
134 Abagyan                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 Abagyan 134
135 BHAGEERATH                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 BHAGEERATH 135
136 FEIG_REFINE                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 FEIG_REFINE 136
137 Fiser−M4T                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 Fiser−M4T 137
138 HCA                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 HCA 138
139 Handl−Lovell                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 Handl−Lovell 139
140 KudlatyPredHuman                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 KudlatyPredHuman 140
141 Linnolt−UH−CMB                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 Linnolt−UH−CMB 141
142 NIM2                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 NIM2 142
143 Nano_team                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 Nano_team 143
144 NirBenTal                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 NirBenTal 144
145 PHAISTOS                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 PHAISTOS 145
146 POISE                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 POISE 146
147 PZ−UAM                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 PZ−UAM 147
148 ProteinShop                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 ProteinShop 148
149 RPFM                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 RPFM 149
150 ShakAbInitio                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 ShakAbInitio 150
151 TsaiLab                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 TsaiLab 151
152 UCDavisGenome                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 UCDavisGenome 152
153 Wolfson−FOBIA                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 Wolfson−FOBIA 153
154 YASARA                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 YASARA 154
155 YASARARefine                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 YASARARefine 155
156 dill_ucsf                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 dill_ucsf 156
157 dill_ucsf_extended                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 dill_ucsf_extended 157
158 huber−torda−server                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 huber−torda−server 158
159 igor                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 igor 159
160 jacobson                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 jacobson 160
161 mufold                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 mufold 161
162 mumssp                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 mumssp 162
163 ricardo                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 ricardo 163
164 rivilo                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 rivilo 164
165 sessions                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 sessions 165
166 test_http_server_01                                     -3.10 -3.04 -3.95 -3.09 -2.98 -3.94                                     -3.78 -3.71 -4.35 -3.77 -3.66 -4.35 test_http_server_01 166